WorldWideScience

Sample records for astatine 204

  1. Organic chemistry of astatine

    International Nuclear Information System (INIS)

    The paper surveys the investigations on the chemical behaviour of astatine in organic systems and deals with the preparation and identification of its organic compounds. A discussion is given on some of the physico-chemical properties of these compounds determined by extrapolation techniques as well as by direct measurement. The biomedical importance of 211At-labelled compounds is briefly referred to. (authors)

  2. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  3. Astatine-211: production and availability.

    Science.gov (United States)

    Zalutsky, Michael R; Pruszynski, Marek

    2011-07-01

    The 7.2-h half life radiohalogen (211)At offers many potential advantages for targeted α-particle therapy; however, its use for this purpose is constrained by its limited availability. Astatine-211 can be produced in reasonable yield from natural bismuth targets via the (209)Bi(α,2n)(211)At nuclear reaction utilizing straightforward methods. There is some debate as to the best incident α-particle energy for maximizing 211At production while minimizing production of (210)At, which is problematic because of its 138.4-day half life α-particle emitting daughter, (210)Po. The intrinsic cost for producing (211)At is reasonably modest and comparable to that of commercially available (123)I. The major impediment to (211)At availability is attributed to the need for a medium energy α-particle beam for its production. On the other hand, there are about 30 cyclotrons in the world that have the beam characteristics required for (211)At production. PMID:22201707

  4. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211At species, 211At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  5. Dosimetrical considerations in astatine-211 radioimmunotherapy

    International Nuclear Information System (INIS)

    Several dosimetrical quantities have been suggested for use in alpha-particle dosimetry. To evaluate the expected biological effect when using these quantities, a Monte Carlo program was set to register the single-event distribution of both specific energy and alpha-particle track length to a cell nucleus (r=5.6 μm). Distributions were acquired for both 'bound' (simulating the effect of 211At-labelled antibodies bound to antigens on cell surfaces (r=7.0 μm)) as well as 'non-bound' (simulating 211At-labelled antibodies that have not bound to a cell) astatine-211. From these distributions, various theoretical cell survival curves were established for 3 different dosimetrical quantities, i.e. specific energy, number of alpha-particle hits and total track length. The survival curves for all quantities are presented for the corresponding mean absorbed dose in order to facilitate comparisons of the expected effects of using the 3 different quantities for both distributions of 211At decays. The theoretical survival curves presented here could, combined with experiments using 'bound' and 'non-bound' 211At in a single-cell suspension, reveal which dosimetrical quantity is most suitable for 211 At-radioimmunotherapy. (author)

  6. Discovery of the astatine, radon, francium, and radium isotopes

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  7. Extraction of astatine isotopes for development of radiopharmaceuticals using a 211Rn-211At generator

    International Nuclear Information System (INIS)

    In order to utilize a 211At isotope, a promising α-emitter for radionuclide therapy, the chemical properties of astatine isotopes are studied. We have examined wet chemistry methods through the distribution ratios of astatine in liquid-liquid extraction. The astatine isotopes have been found to be well extracted into DIPE and MIBK. We observed that the distribution ratio of astatine isotopes increases with concentrations of HCl greater than 3 M, while it decreases with the HCl concentration less than 2 M. The results will be useful for development of the 211Rn-211At generator. (author)

  8. Astatine-211-Labeled Targeted Radiotherapeutics: An Update

    International Nuclear Information System (INIS)

    The heavy halogen 211At was first proposed for use in α-particle targeted radiotherapy more than 30 years ago and continues to be one of the most promising radionuclides for this purpose. Although its 7.2-h half life is not ideal for intravenously administered whole antibodies, it is compatible with the pharmacokinetics of antibody fragments, peptides, aptamers and organic molecules. Its diverse chemistry allows its incorporation into a wide array of targeting vehicles, relying on its chemical similarity to iodine to provide a useful point of departure. On the other hand, the relatively low carbon-astatine bond strength is challenging. In common with the other α-emitters being discussed at this symposium, lack of reliable availability is one of the biggest hurdles in the use of 211At for targeted radiotherapy. However, in the case of 211At, it is not a question of production cost or availability of target material, because 211At can be produced in reasonable yield from natural bismuth targets. Rather, the difficulty is the lack of cyclotrons equipped with the medium energy α-particle beams required for its production. If the infrastructure for producing 211At is to be improved to the stage where 211At-labeled radiopharmaceuticals can have a meaningful impact, several developments must occur. First, the ability to produce clinically relevant levels of 211At that can be shipped to remote locations in chemically tractable form must be demonstrated. Approaches under consideration include compensating for radiolysis-mediated effects and the consideration of alternative chemistries. Second, strategies for compensating for heterogeneities in dose deposition must be developed, hopefully in a way that is compatible with approval for human use. And third, it is essential that more clinical trials be performed with 211At-labeled therapeutics, particularly in settings of minimum residual disease where the radiobiological advantages of α-particles can be best exploited. Our

  9. Scrutinizing "Invisible" astatine: A challenge for modern density functionals.

    Science.gov (United States)

    Sergentu, Dumitru-Claudiu; David, Grégoire; Montavon, Gilles; Maurice, Rémi; Galland, Nicolas

    2016-06-01

    The main-group 6p elements did not receive much attention in the development of recent density functionals. In many cases it is still difficult to choose among the modern ones a relevant functional for various applications. Here, we illustrate the case of astatine species (At, Z = 85) and we report the first, and quite complete, benchmark study on several properties concerning such species. Insights on geometries, transition energies and thermodynamic properties of a set of 19 astatine species, for which reference experimental or theoretical data has been reported, are obtained with relativistic (two-component) density functional theory calculations. An extensive set of widely used functionals is employed. The hybrid meta-generalized gradient approximation (meta-GGA) PW6B95 functional is overall the best choice. It is worth noting that the range-separated HSE06 functional as well as the old and very popular B3LYP and PBE0 hybrid-GGAs appear to perform quite well too. Moreover, we found that astatine chemistry in solution can accurately be predicted using implicit solvent models, provided that specific parameters are used to build At cavities. © 2016 Wiley Periodicals, Inc. PMID:27059181

  10. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  11. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates.

    Science.gov (United States)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Svedhem, Sofia; Lindegren, Sture

    2016-03-16

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single cancer cells. A promising radioactive nuclide for this type of therapy is astatine-211. Astatine-211 attached to tumor-specific antibodies as carrier molecules is a system currently under investigation for use in targeted alpha therapy. In the common radiolabeling procedure, astatine is coupled to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies. PMID:26791409

  12. Astatine-211: production, injection into monoclonal antibodies radiological effect, possible application to cancer treatment

    International Nuclear Information System (INIS)

    Methods developed in the Laboratory of Nuclear Problems, JINR, for producing astatine-211 and injecting it into monoclonal antibodies are described. The use of its diethylene triamine penta-acetic acid complex is shown to be the most effective method of injecting astatine into a biomolecules. The biological effect of the α-particles emitted from the astatine-211 is investigated using Chinese hamster fibroblasts and Ehrlich carcinoma cells. It is established that the mitotic activity depression, number of degenerating cells, number of cells with chromosome aberrations, and cellular surviving fraction depend on the concentration of the radionuclide in the medium 'in vitro'. The RBE of α-particles in comparison with 60Co γ-rays is 3. Injection of astatine-211 absorbed on tellurium particles into mice with ascitic tumors resulted in prolongation of their life or elimination of the tumors. (author). 39 refs, 7 figs

  13. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    OpenAIRE

    Rothe, S.; A. N. Andreyev; Antalic, S; Borschevsky, A.; Capponi, L.; Cocolios, T.E.; Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the io...

  14. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    Science.gov (United States)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-07-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and physical properties for use in targeted therapies for cancer. Due to the very short range of the emitted α-particles, this therapy is particularly suited to treating occult, disseminated cancers. Astatine is not intrinsically tumour-specific; therefore, it requires an appropriate tumour-specific targeting vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method that combines dry distillation of astatine-211 and a synthesis module for producing radiopharmaceuticals into a process platform. This platform will standardize production of astatinated radiopharmaceuticals, and hence, it will facilitate large clinical studies focused on this promising, but chemically challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies.

  15. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-01-01

    vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method......To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  16. Study of Astatine (III) reactions with O, S and N ligands in solution

    International Nuclear Information System (INIS)

    Full text of publication follows. Astatine (At, Z=85: [Xe]4f145d106s26p5) belongs to the halogen group and is located below iodine in the periodic table. One of its isotopes (211At) appears promising as a therapeutic agent in nuclear medicine (Ref.1) owing to the energy of the alpha particles emitted during the disintegration of its nucleus and its short physical half-life (7.2 h). Since there are no stable isotopes of astatine, the chemistry of this element remains poorly understood. Generally, At is supposed to behave as a halogen (Ref.2) but it has been shown recently in our group that astatine presents a metallic behaviour in aqueous solution: it notably exists as At+ and AtO+ species under the oxidation states +I and +III (Ref.3). At the present time, the number of studies dealing with the complexation properties of the cationic forms of astatine remains limited (Ref.4), owing to its low availability. In this work, we have investigated the reactions of AtO+ species with different hetero-atomic (N, S, O) model ligands. A combined approach based on experimental and theoretical studies has been used (Ref.5). On account of the difficulties of experimental investigations of astatine species, the reactivity of AtO+ was explored using a competition method founded on astatine distributions between two distinct phases. Furthermore, for each AtO+/ ligand complex, the nature of the species formed and the associated thermodynamic constants were determined by computational modeling (DFT calculations). In this framework, an original computational methodology was developed to take into account the specificities of astatine, notably the associated relativistic effects. The computed equilibrium constants have been confronted with the experimental results. This comparison demonstrates an outstanding coherence between experience and theory. Furthermore, the analysis of the results shows a key role of solvent effects on astatine chemistry. Lastly, a specific reactivity for the

  17. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments (209At, 210At, 211At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  18. Astatine-211 Pathway from Radiochemistry to Clinical Investigation

    International Nuclear Information System (INIS)

    Particularly in clinical settings where tumour burden is low and cancers are located in close proximity to essential normal tissue structures, α-particle emitting radionuclides can offer significant advantages for targeted radionuclide therapy. One of the first alpha emitters to be evaluated for this purpose is the 7.2-h half-life radiohalogen Astatine-211 (211At). From a commercialization-potential perspective 211At, is less appealing than the longer half-life alpha particle emitters Radium-223, Actinium-225 and Thorium-227, which have become the focus of many laboratories. However, if methods for providing a better supply of 211At could be developed, this alpha emitter would be the radionuclide of choice for many potential therapeutic applications. With regard to the production of 211At, this can be readily be accomplished by bombarding natural bismuth targets with 28−29.5 MeV alpha particles via the 209Bi(α,2n)211At reaction. The goal is to utilize an alpha particle beam energy that provides the required balance for maximizing 211At production while minimizing creation of 210At, which is problematic because of its 138.4-day half life alpha-particle emitting daughter, 210Po. For most intended clinical applications, alpha particle beam energy of about 29 MeV offers the best compromise between maximizing yield and providing 211At with sufficient radionuclidic purity for clinical use. Clinically relevant levels of 211At have been produced at several institutions using both internal and external cyclotron targets

  19. HIS 204 ASH Course Tutorial / Tutorialoutlet

    OpenAIRE

    JOHN

    2015-01-01

    For more course tutorials visit www.tutorialoutlet.com   HIS 204 Week 1 DQ 1 (Ash) HIS 204 Week 1 DQ 2 (Ash) HIS 204 Week 1 Quiz (Ash) HIS 204 Week 2 DQ 1 (Ash) HIS 204 Week 2 DQ 2 (Ash) HIS 204 Week 2 Quiz (Ash) HIS 204 Week 3 Assignment Women Right, Sacrifices & Independence (Ash) HIS 204 Week 3 DQ 1 (Ash) HIS 204 Week 3 DQ 2 (Ash) HIS 204 Week 4 DQ 1 (Ash) HIS 204 Week 4 DQ 2 (Ash) HIS 204 Week 4 Quiz (Ash) HIS 204 Week 5 DQ 1 (Ash) ...

  20. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  1. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  2. Labelling prospects of astatine-211 with immunoglobulins (IgG): some general considerations

    International Nuclear Information System (INIS)

    The tumour therapeutic potential of the short lived alpha emitting radiohalogen 211At has been already been well recognised in the field of radioimmuno therapy. There is no evidence as such to show that astatine itself is a tumour seeking isotope. Therefore it has to be tagged to tumour seeking compound such as a drug or a protein preferably an antibody (IgG). In this communication, the labelling parameters which are required to be investigated for obtaining a stable product which could be useful as radioimmuno therapeutic agent, are described. (author). 6 refs

  3. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron anity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photodetachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral linewidth of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in o-line tests by the clear observation of the photodetachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148 [1].

  4. Extraction of 211At-astatine from hydrochloric acid solutions by means of TOPO, TBP, and triphenylphosphine

    International Nuclear Information System (INIS)

    The extraction behaviour of astatine was studied under defined conditions from hydrochloride acid solutions (cHCl>0.1 M or 1 and 2M). Therefore other effects like adsorption, reduction or hydrolysis can be excluded. The present work describes the extraction with tri- n- octylphosphinoxide (TOPO), tri- n-butylphosphate (TBP) and tri-phenylphosphine in chloroform. (orig.)

  5. No-carrier-added astatination of N-succinimidyl-3-(tri-n-butylstannyl) benzoate (ATE) via electrophilic destannylation

    International Nuclear Information System (INIS)

    The no-carrier-added synthesis of N-succinimidyl 3-[211At]astato-benzoate from N-succinimidyl 3-(tri-n-butylstannyl)benzoate (ATE) is described. The nature of the solvent in which the 211At was isolated from the target was an important factor influencing both the radiochemical yields and the nature of the incorporated astatine activity. (orig.)

  6. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    211At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At- to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At- anions, but first of all because of the kinetic inertness of low spin rhodium(III) d6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh3+. The experiments related to optimization of the reaction conditions were performed with the 131I, basing on a chemical similarity of I- to At-. The experiments with 211At were then carried out under the conditions found optimal for I-. The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211At-Rh(16-S4-diol) complex

  7. HIS 204 NEW Course Tutorial / Tutorialoutlet

    OpenAIRE

    JOHN

    2015-01-01

    For more course tutorials visit www.tutorialoutlet.com   HIS 204 Week 1 DQ 1 The History of Reconstruction (Ash) (New) HIS 204 Week 1 DQ 2 The Industrial Revolution (Ash) (New) HIS 204 Week 1 Quiz (Ash) (New) HIS 204 Week 2 DQ 1 The Progressive Movement (Ash) (New) HIS 204 Week 2 DQ 2 America's Age of Imperialism (Ash) (New) HIS 204 Week 2 Quiz (Ash) (New) HIS 204 Week 2 Paper The Progressive Presidents (Ash) (New) HIS 204 Week 3 DQ 1 Normalcy and the...

  8. 48 CFR 3017.204 - Contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Contracts. 3017.204... ACQUISITION REGULATION (HSAR) CONTRACT METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options. 3017.204 Contracts....

  9. 30 CFR 204.204 - What accounting and auditing relief will MMS not allow?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What accounting and auditing relief will MMS not allow? 204.204 Section 204.204 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT ALTERNATIVES FOR MARGINAL PROPERTIES Accounting and Auditing...

  10. 48 CFR 243.204 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Administration. 243.204... OF DEFENSE CONTRACT MANAGEMENT CONTRACT MODIFICATIONS Change Orders 243.204 Administration. Follow the procedures at PGI 243.204 for administration of change orders....

  11. 48 CFR 217.204 - Contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contracts. 217.204 Section... DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 217.204 Contracts. (e)(i) Notwithstanding FAR 17.204(e), the ordering period of a task order or delivery order...

  12. 48 CFR 2017.204 - Contracts

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contracts 2017.204 Section 2017.204 Federal Acquisition Regulations System NUCLEAR REGULATORY COMMISSION CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 2017.204 Contracts (a) The contracting officer...

  13. 48 CFR 317.204 - Contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Contracts. 317.204 Section 317.204 Federal Acquisition Regulations System HEALTH AND HUMAN SERVICES CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 317.204 Contracts. (e) The total of the basic and...

  14. 48 CFR 1517.204 - Contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contracts. 1517.204 Section 1517.204 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 1517.204 Contracts. The SCM may approve a contract...

  15. 48 CFR 17.204 - Contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Contracts. 17.204 Section 17.204 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 17.204 Contracts. (a) The contract shall specify...

  16. 48 CFR 617.204 - Contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Contracts. 617.204 Section 617.204 Federal Acquisition Regulations System DEPARTMENT OF STATE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 617.204 Contracts. (e) The Procurement Executive shall...

  17. 48 CFR 817.204 - Contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contracts. 817.204 Section 817.204 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 817.204 Contracts. (a) The contracting officer...

  18. 42 CFR 93.204 - Contract.

    Science.gov (United States)

    2010-10-01

    ... MISCONDUCT Definitions § 93.204 Contract. Contract means an acquisition instrument awarded under the HHS Federal Acquisition Regulation (FAR), 48 CFR Chapter 1, excluding any small purchases awarded pursuant to... 42 Public Health 1 2010-10-01 2010-10-01 false Contract. 93.204 Section 93.204 Public...

  19. 48 CFR 2417.204 - Contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contracts. 2417.204 Section 2417.204 Federal Acquisition Regulations System DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT CONTRACTING METHODS AND CONTRACTING TYPES SPECIAL CONTRACTING METHODS Options 2417.204 Contracts. (e) The...

  20. 48 CFR 417.204 - Contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Contracts. 417.204 Section 417.204 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 417.204 Contracts. The head of the contracting...

  1. 48 CFR 811.204 - Contract clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clause. 811.204 Section 811.204 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS COMPETITION AND ACQUISITION PLANNING DESCRIBING AGENCY NEEDS Using and Maintaining Requirements Documents 811.204...

  2. 14 CFR 1212.204 - Fees.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Fees. 1212.204 Section 1212.204 Aeronautics... § 1212.204 Fees. (a) Fees will not be charged for: (1) Search for a retrieval of the requesting... is determined to be in the best interest of the Government. (b) Fees for the duplication of...

  3. 7 CFR 1416.204 - Application process.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Application process. 1416.204 Section 1416.204 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT... PROGRAMS Livestock Indemnity Program II § 1416.204 Application process. (a) Applicants must submit to CCC...

  4. 40 CFR 243.204 - Collection management.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Collection management. 243.204 Section 243.204 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES... and Recommended Procedures § 243.204 Collection management....

  5. 40 CFR 240.204-1 - Requirement.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirement. 240.204-1 Section 240.204-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE THERMAL PROCESSING OF SOLID WASTES Requirements and Recommended Procedures § 240.204-1...

  6. 47 CFR 25.204 - Power limits.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Power limits. 25.204 Section 25.204... Technical Standards § 25.204 Power limits. (a) In bands shared coequally with terrestrial radio... not exceed the following limits except as provided for in paragraph (c) of this section: +40 dBW...

  7. 40 CFR 240.204 - Water quality.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Water quality. 240.204 Section 240.204 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE THERMAL PROCESSING OF SOLID WASTES Requirements and Recommended Procedures § 240.204 Water quality....

  8. 31 CFR 800.204 - Control.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Control. 800.204 Section 800.204... FOREIGN PERSONS Definitions § 800.204 Control. (a) The term control means the power, direct or indirect... in paragraphs (a)(1) through (9) of this section. (b) In examining questions of control in...

  9. 32 CFR 204.4 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 204.4 Section 204.4 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS USER FEES § 204.4 Responsibilities. (a) The USD(C) shall develop and monitor policies governing...

  10. 22 CFR 20.4 - Retirement benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Retirement benefits. 20.4 Section 20.4 Foreign Relations DEPARTMENT OF STATE PERSONNEL BENEFITS FOR CERTAIN FORMER SPOUSES § 20.4 Retirement benefits. (a) Type of benefits. (1) A former spouse who meets the qualification requirements of § 20.3 is entitled...

  11. 7 CFR 1430.204 - Requesting benefits.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Requesting benefits. 1430.204 Section 1430.204... Program § 1430.204 Requesting benefits. (a) A request for benefits or contract application, under this... MILC benefits must certify the accuracy and truthfulness of the information in their...

  12. 12 CFR 204.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ...) Company; (2) The United States government or an agency thereof; or (3) The Export-Import Bank of the... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Definitions. 204.2 Section 204.2 Banks and... DEPOSITORY INSTITUTIONS (REGULATION D) § 204.2 Definitions. For purposes of this part, the...

  13. 22 CFR 204.41 - Arbitration.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Arbitration. 204.41 Section 204.41 Foreign... § 204.41 Arbitration. Any controversy or claim between A.I.D. and the Lender or any Assignee arising out of this Guaranty shall be settled by arbitration to be held in Washington, DC in accordance with...

  14. 19 CFR 204.5 - Reports.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Reports. 204.5 Section 204.5 Customs Duties UNITED... ON AGRICULTURAL PROGRAMS § 204.5 Reports. After completion of its investigation, the Commission will transmit to the President a report of the results thereof, including its findings and recommendations...

  15. 22 CFR 204.43 - Governing law.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Governing law. 204.43 Section 204.43 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT HOUSING GUARANTY STANDARD TERMS AND CONDITIONS Administration § 204.43 Governing law. This Guaranty shall be governed by and construed in accordance with the laws...

  16. Unexpected Behavior of the Heaviest Halogen Astatine in the Nucleophilic Substitution of Aryliodonium Salts.

    Science.gov (United States)

    Guérard, François; Lee, Yong-Sok; Baidoo, Kwamena; Gestin, Jean-François; Brechbiel, Martin W

    2016-08-22

    Aryliodonium salts have become precursors of choice for the synthesis of (18) F-labeled tracers for nuclear imaging. However, little is known on the reactivity of these compounds with heavy halides, that is, radioiodide and astatide, at the radiotracer scale. In the first comparative study of radiohalogenation of aryliodonium salts with (125) I(-) and (211) At(-) , initial experiments on a model compound highlight the higher reactivity of astatide compared to iodide, which could not be anticipated from the trends previously observed within the halogen series. Kinetic studies indicate a significant difference in activation energy (Ea =23.5 and 17.1 kcal mol(-1) with (125) I(-) and (211) At(-) , respectively). Quantum chemical calculations suggest that astatination occurs via the monomeric form of an iodonium complex whereas iodination occurs via a heterodimeric iodonium intermediate. The good to excellent regioselectivity of halogenation and high yields achieved with diversely substituted aryliodonium salts indicate that this class of compounds is a promising alternative to the stannane chemistry currently used for heavy radiohalogen labeling of tracers in nuclear medicine. PMID:27305065

  17. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  18. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  19. Dicty_cDB: CHR204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR204 (Link to dictyBase) - - - Contig-U16471-1 CHR204P (Link to Original site) CHR...204F 167 CHR204Z 819 CHR204P 966 - - Show CHR204 Library CH (Link to library) Clone ID CHR... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHR2-A/CHR204Q.Seq.d/ Representative seq. ID CHR...204P (Link to Original site) Representative DNA sequence >CHR204 (CHR204Q) /CSM/CH/CHR2-A/CHR2... significant alignments: (bits) Value CHR204 (CHR204Q) /CSM/CH/CHR2-A/CHR204Q.Seq

  20. 9 CFR 204.1 - Introduction.

    Science.gov (United States)

    2010-01-01

    ... Introduction. The Grain Inspection, Packers and Stockyards Administration (Packers and Stockyards Programs... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Introduction. 204.1 Section 204.1 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS...

  1. 17 CFR 204.6 - Agency review.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Agency review. 204.6 Section... COLLECTION Administrative Offset § 204.6 Agency review. (a) To the extent that a debt owed has not been... request to review a disputed debt must be submitted to the Commission official who provided...

  2. 48 CFR 1817.204 - Contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contracts. 1817.204 Section... CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 1817.204 Contracts. (e)(i) The 5-year limitation (basic plus option periods) applies to all NASA contracts regardless of type and...

  3. 48 CFR 2033.204 - Policy.

    Science.gov (United States)

    2010-10-01

    ... the NRC and the Department of Energy. The EBCA rules appear in 10 CFR part 1023. ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Policy. 2033.204 Section... REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 2033.204 Policy. Final decisions of the...

  4. 48 CFR 2052.204-70 - Security.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Security. 2052.204-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 2052.204-70 Security. As prescribed... National Security information, restricted data, formerly restricted data, and other classified...

  5. 28 CFR 36.204 - Administrative methods.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Administrative methods. 36.204 Section 36... PUBLIC ACCOMMODATIONS AND IN COMMERCIAL FACILITIES General Requirements § 36.204 Administrative methods... standards or criteria or methods of administration that have the effect of discriminating on the basis...

  6. 41 CFR 50-204.67 - Oxygen.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Oxygen. 50-204.67 Section..., Vapors, Fumes, Dusts, and Mists § 50-204.67 Oxygen. The in-plant transfer, handling, storage, and utilization of oxygen as a liquid or a compressed gas shall be in accordance with Compressed Gas...

  7. 27 CFR 26.204 - Regauge.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Regauge. 26.204 Section 26.204 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE... of the distiller; and the serial number, the proof of the spirits, and the wine and proof...

  8. 17 CFR 204.75 - Collection services.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Collection services. 204.75... DEBT COLLECTION Miscellaneous: Credit Bureau Reporting, Collection Services § 204.75 Collection services. Section 13 of the Debt Collection Act (31 U.S.C. 3718) authorizes agencies to enter...

  9. Tank 241-U-204 tank characterization plan

    International Nuclear Information System (INIS)

    This document is the tank characterization plan for Tank 241-U-204 located in the 200 Area Tank Farm on the Hanford Reservation in Richland, Washington. This plan describes Data Quality Objectives (DQO) and presents historical information and scheduled sampling events for tank 241-U-204

  10. 9 CFR 204.2 - Organization.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Organization. 204.2 Section 204.2 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND... Financial Protection Branch, Marketing Practices Branch, and Scales and Weighing Branch. The...

  11. 48 CFR 204.7202-3 - TINs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false TINs. 204.7202-3 Section... OF DEFENSE GENERAL ADMINISTRATIVE MATTERS Contractor Identification 204.7202-3 TINs. Requirements for use of TINs are in FAR subpart 4.9....

  12. 20 CFR 633.204 - Responsibility review.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Responsibility review. 633.204 Section 633.204 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR MIGRANT AND..., reviews, assessments, etc. (7) Failure to return a grant closeout package or outstanding advances...

  13. 44 CFR 206.204 - Project performance.

    Science.gov (United States)

    2010-10-01

    ... accordance with 44 CFR 13.21, Payment. (c) Time limitations for completion of work—(1) Deadlines. The project... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Project performance. 206.204... § 206.204 Project performance. (a) General. This section describes the policies and...

  14. 41 CFR 50-204.68 - Hydrogen.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Hydrogen. 50-204.68..., Vapors, Fumes, Dusts, and Mists § 50-204.68 Hydrogen. The in-plant transfer, handling, storage, and utilization of hydrogen shall be in accordance with Compressed Gas Association Pamphlets G-5.1-1961 and...

  15. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  16. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  17. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  18. Neutron inelastic scattering studies for lead-204

    International Nuclear Information System (INIS)

    A 9.57-g sample of lead metal, enriched to 99.7 percent 204Pb, was used in an investigation of neutron inelastic scattering from this rare isotope at the Argonne National Laboratory Fast-Neutron Generator Facility. Neutron excitation of the 66.9-m isomeric state at 2.186 MeV in 204Pb was measured from near threshold to approximately 10 MeV using activation techniques. Cross sections and a value for the isomeric half life were derived from these data. Time-of-flight techniques were employed to measure spectra of promptly-emitted gamma rays from the 204Pb(n;n',γ)204Pb reaction at neutron energies less than or equal to 3 MeV. Cross sections and angular distributions were derived from these data for several of the stronger transitions. Other available fast-neutron data for this isotope are reviewed briefly

  19. 41 CFR 50-204.36 - Radiation standards for mining.

    Science.gov (United States)

    2010-07-01

    .... Department of Labor, Radiation Safety and Health Standards (41 CFR 50-204.36). You should preserve this... mining. 50-204.36 Section 50-204.36 Public Contracts and Property Management Other Provisions Relating to... CONTRACTS Radiation Standards § 50-204.36 Radiation standards for mining. (a) For the purpose of...

  20. Dicty_cDB: SSA204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA204 (Link to dictyBase) - - - Contig-U14136-1 SSA204F (Link to Original site) SSA...204F 277 - - - - - - Show SSA204 Library SS (Link to library) Clone ID SSA204 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-A/SSA204Q.Seq.d/ Representative seq. ID SSA20...4F (Link to Original site) Representative DNA sequence >SSA204 (SSA204Q) /CSM/SS/SSA2-A/SSA204Q.Seq.d/ AAAAT...vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA484 (SSA484Q) /CSM/SS/SSA

  1. Dicty_cDB: CHL204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHL204 (Link to dictyBase) - - - Contig-U16411-1 | Contig-U16470-1 CHL204P ... EISPNSLFLQVLRSAARHQKNNGDSHLAVDHLILGLLDDRDILSVLGDAG ATK --- ---IDMSEYMXQHSVSRLIGAPPGYVGYDQGGQLTEAVRRRPYSVVL ... EISPNSLFLQVLRSAARHQKNNGDSHLAVDHLILGLLDDRDILSVLGDAG ATK --- ---IDMSEYMXQHSVSRLIGAPPGYVGYDQGGQLTEAVRRRPYSVVL ...

  2. 41 CFR 109-50.204 - Limitations.

    Science.gov (United States)

    2010-07-01

    ... Condition Codes 1 and 4, as defined in 41 CFR 101-43.4801(e), meet this criteria. Serviceability of... DISPOSAL AUTHORITIES 50.2-Math and Science Equipment Gift Program § 109-50.204 Limitations. (a) Excess and... the appropriate gift instrument where the book value of an item of equipment exceeds $25,000 or...

  3. 12 CFR 204.121 - Bankers' banks.

    Science.gov (United States)

    2010-01-01

    ... D (12 CFR 204.3(i)) and if the Federal Reserve is satisfied that the quality of management and...-through correspondent in accordance with Regulation D. Satisfaction of these criteria will assure that... general public if it meets two conditions. First, the range of customers with which the institution...

  4. 48 CFR 50.204 - Policy.

    Science.gov (United States)

    2010-10-01

    ... EXTRAORDINARY CONTRACTUAL ACTIONS AND THE SAFETY ACT Support Anti-terrorism by Fostering Effective Technologies Act of 2002 50.204 Policy. (a) Agencies should— (1) Determine whether the technology to be procured is...)(viii) of 6 CFR 25.4, Designation of Qualified Anti-Terrorism Technologies; (2) Encourage offerors...

  5. Stability and in vivo behavior of Rh[16aneS4-diol]211At complex: A potential precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Introduction: The heavy halogen 211At is of great interest for targeted radiotherapy because it decays by the emission of short-range, high-energy α-particles. However, many astatine compounds that have been synthesized are unstable in vivo, providing motivation for seeking other 211At labeling strategies. One relatively unexplored approach is to utilize prosthetic groups based on astatinated rhodium (III) complex stabilized with a tetrathioether macrocyclic ligand – Rh[16aneS4-diol]211At. The purpose of the current study was to evaluate the in vitro and in vivo stability of this complex in comparison to its iodine analog – Rh[16aneS4-diol]131I. Methods: Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I complexes were synthesized and purified by HPLC. The stability of both complexes was evaluated in vitro by incubation in phosphate-buffered saline (PBS) and human serum at different temperatures. The in vivo behavior of the two radiohalogenated complexes was assessed by a paired-label biodistribution study in normal Balb/c mice. Results: Both complexes were synthesized in high yield and purity. Almost no degradation was observed for Rh[16aneS4-diol]131I in PBS over a 72 h incubation. The astatinated analog exhibited good stability in PBS over 14 h. A slow decline in the percentage of intact complex was observed for both tracers in human serum. In the biodistribution study, retention of 211At in most tissues was higher than that of 131I at all time points, especially in spleen and lungs. Renal clearance of Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I predominated, with 84.1 ± 2.3% and 94.6 ± 0.9% of injected dose excreted via the urine at 4 h. Conclusions: The Rh[16aneS4-diol]211At complex might be useful for constructing prosthetic groups for the astatination of biomolecules and further studies are planned to evaluate this possibility

  6. 40 CFR 204.57 - Selective enforcement auditing.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Selective enforcement auditing. 204.57 Section 204.57 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS NOISE EMISSION STANDARDS FOR CONSTRUCTION EQUIPMENT Portable Air Compressors § 204.57 Selective enforcement...

  7. 41 CFR 50-204.8 - Use of compressed air.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Use of compressed air. 50-204.8 Section 50-204.8 Public Contracts and Property Management Other Provisions Relating to Public... General Safety and Health Standards § 50-204.8 Use of compressed air. Compressed air shall not be used...

  8. 7 CFR 3560.204 - Security deposits and membership fees.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Security deposits and membership fees. 3560.204 Section 3560.204 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, DEPARTMENT OF AGRICULTURE DIRECT MULTI-FAMILY HOUSING LOANS AND GRANTS Rents § 3560.204 Security deposits and membership fees. (a)...

  9. 5 CFR 179.204 - Applicability of regulations.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Applicability of regulations. 179.204 Section 179.204 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Salary Offset § 179.204 Applicability of regulations. These regulations are to...

  10. 12 CFR 204.8 - International banking facilities.

    Science.gov (United States)

    2010-01-01

    ... specified in 12 CFR 204.125. (ii) (A) That is payable (1) On a specified date not less than two business... 12 Banks and Banking 2 2010-01-01 2010-01-01 false International banking facilities. 204.8 Section 204.8 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE...

  11. 41 CFR 50-204.10 - Occupational noise exposure.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Occupational noise exposure. 50-204.10 Section 50-204.10 Public Contracts and Property Management Other Provisions Relating to... CONTRACTS General Safety and Health Standards § 50-204.10 Occupational noise exposure. (a)...

  12. 48 CFR 952.204-73 - Facility clearance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Facility clearance. 952.204-73 Section 952.204-73 Federal Acquisition Regulations System DEPARTMENT OF ENERGY CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.204-73 Facility clearance. As prescribed in 904.404(d)(5),...

  13. 41 CFR 101-6.204 - Discrimination prohibited.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Discrimination prohibited. 101-6.204 Section 101-6.204 Public Contracts and Property Management Federal Property Management...-Nondiscrimination in Programs Receiving Federal Financial Assistance § 101-6.204 Discrimination prohibited....

  14. 40 CFR 204.3 - Number and gender.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Number and gender. 204.3 Section 204.3... STANDARDS FOR CONSTRUCTION EQUIPMENT General Provisions § 204.3 Number and gender. As used in this part, words in the singular shall be deemed to import the plural, and words in the masculine gender shall...

  15. 31 CFR 586.204 - Prohibited new investment within Serbia.

    Science.gov (United States)

    2010-07-01

    ... persons designated in or pursuant to 31 CFR § 587.201(a), the new investment activities of United States... Serbia. 586.204 Section 586.204 Money and Finance: Treasury Regulations Relating to Money and Finance... (SERBIA & MONTENEGRO) KOSOVO SANCTIONS REGULATIONS Prohibitions § 586.204 Prohibited new investment...

  16. 23 CFR 973.204 - Management systems requirements.

    Science.gov (United States)

    2010-04-01

    ... system; (2) A process to operate and maintain the management systems and their associated databases; (3... 23 Highways 1 2010-04-01 2010-04-01 false Management systems requirements. 973.204 Section 973.204... Indian Affairs Management Systems § 973.204 Management systems requirements. (a) The BIA, in...

  17. 23 CFR 972.204 - Management systems requirements.

    Science.gov (United States)

    2010-04-01

    ... to operate and maintain the management systems and their associated databases; and (5) A process for... 23 Highways 1 2010-04-01 2010-04-01 false Management systems requirements. 972.204 Section 972.204... WILDLIFE SERVICE MANAGEMENT SYSTEMS Fish and Wildlife Service Management Systems § 972.204...

  18. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D., Scott

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  19. High spin states in 204At

    International Nuclear Information System (INIS)

    Exploring high spin states of the trans-lead nuclei have attracted much attention in recent years. Very little information is known about the excited states of neutron deficient nuclei in this mass region. High spins states of 208-210Fr nuclei were investigated in recent times using the INGA facility. Several isomeric states were found, and their spin differences were obtained from the DCO ratio measurement across the isomeric levels. Attempts for a complete study of the high spin states and isomer decays in 204At will be undertaken in this work

  20. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    International Nuclear Information System (INIS)

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET α-emitter astatine-211 (211At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 (123I), 340-fold for technetium-99m pertechnetate (99mTcO4-) and 60-fold for 211At. Cellular 211At accumulation was found to be dependent on extracellular Na+ ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and 99mTcO4- uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated 211At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and 211At were rapidly (apparent t1/2 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times (123I), 25 times (99mTcO4-) and 10 times (211At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of 123I and 211At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for 123I, 5.2 h for 211At) and preliminary dosimetric calculations indicate high tumour absorbed doses (3.5 Gy/MBqtumour for 131I and 50.3 Gy/MBqtumour for 211At). In

  1. 15 CFR 2011.204 - Entry of specialty sugars.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Entry of specialty sugars. 2011.204 Section 2011.204 Commerce and Foreign Trade Regulations Relating to Foreign Trade Agreements OFFICE OF THE UNITED STATES TRADE REPRESENTATIVE ALLOCATION OF TARIFF-RATE QUOTA ON IMPORTED SUGARS, SYRUPS...

  2. 40 CFR 204.57-3 - Test compressor preparation.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Test compressor preparation. 204.57-3... PROGRAMS NOISE EMISSION STANDARDS FOR CONSTRUCTION EQUIPMENT Portable Air Compressors § 204.57-3 Test compressor preparation. (a) Prior to the official test, the test compressor selected in accordance with §...

  3. 40 CFR 204.57-2 - Test compressor sample selection.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Test compressor sample selection. 204... ABATEMENT PROGRAMS NOISE EMISSION STANDARDS FOR CONSTRUCTION EQUIPMENT Portable Air Compressors § 204.57-2 Test compressor sample selection. (a) Compressors comprising the batch sample which are required to...

  4. 5 CFR 353.204 - Notice to employer.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Notice to employer. 353.204 Section 353... DUTY FROM UNIFORMED SERVICE OR COMPENSABLE INJURY Uniformed Service § 353.204 Notice to employer. To be... service in which service is to be performed) must give the employer advance written or verbal notice...

  5. 14 CFR 125.204 - Portable electronic devices.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Portable electronic devices. 125.204 Section 125.204 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR CARRIERS AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS CERTIFICATION AND OPERATIONS: AIRPLANES HAVING A...

  6. 48 CFR 952.204-77 - Computer security.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Computer security. 952.204... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.204-77 Computer security. As prescribed in 904.404(d)(7), the following clause shall be included: Computer Security (AUG 2006)...

  7. 23 CFR 810.204 - Application by mass transit authority.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Application by mass transit authority. 810.204 Section... MASS TRANSIT AND SPECIAL USE HIGHWAY PROJECTS Making Highway Rights-of-Way Available for Mass Transit Projects § 810.204 Application by mass transit authority. A publicly-owned mass transit authority...

  8. 48 CFR 204.270 - Electronic Document Access.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE GENERAL ADMINISTRATIVE MATTERS Contract Distribution 204.270 Electronic Document Access. Follow the procedures at PGI 204.270 relating to obtaining an account in the Electronic Document Access... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Electronic Document...

  9. 41 CFR 50-204.1a - Variances.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Variances. 50-204.1a... and Application § 50-204.1a Variances. (a) Variances from standards in this part may be granted in the same circumstances in which variances may be granted under sections 6(b)(6)(A) or 6(d) of the...

  10. 48 CFR 15.204-1 - Uniform contract format.

    Science.gov (United States)

    2010-10-01

    ...) Solicitations using the uniform contract format shall include Parts I, II, III, and IV (see 15.204-2 through 15... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Uniform contract format... Information 15.204-1 Uniform contract format. (a) Contracting officers shall prepare solicitations...

  11. 5 CFR 2638.204 - Deputy ethics official.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Deputy ethics official. 2638.204 Section 2638.204 Administrative Personnel OFFICE OF GOVERNMENT ETHICS GOVERNMENT ETHICS OFFICE OF GOVERNMENT ETHICS AND EXECUTIVE AGENCY ETHICS PROGRAM RESPONSIBILITIES Designated Agency Ethics Official §...

  12. 20 CFR 416.204 - Redeterminations of SSI eligibility.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Redeterminations of SSI eligibility. 416.204... AGED, BLIND, AND DISABLED Eligibility General § 416.204 Redeterminations of SSI eligibility. (a... eligible and that you are receiving the right amount of SSI benefits. This review deals with...

  13. 8 CFR 204.6 - Petitions for employment creation aliens.

    Science.gov (United States)

    2010-01-01

    ... Commissioner for Examinations as provided in 8 CFR 103.3. (7) Requirements for alien entrepreneurs. An alien... this manner does not exempt the petitioner from the requirements of 8 CFR 204.6(j) (2) and (3) relating... meet the criteria set forth in 8 CFR 204.6(j)(4)(ii). (i) State designation of a high unemployment...

  14. 48 CFR 204.7003 - Basic PII number.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Basic PII number. 204.7003 Section 204.7003 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT...), the National Industries for the Severely Handicapped (NISH), and the Federal Prison Industries...

  15. 8 CFR 204.311 - Convention adoption home study requirements.

    Science.gov (United States)

    2010-01-01

    ... or entity defined under 8 CFR 204.301 as a home study preparer for Convention cases may complete a... under 22 CFR part 96 to complete home studies for Convention adoption cases. The certification must... placed in the home. See 8 CFR 204.309(a) for the consequences of failure to disclose information...

  16. 34 CFR 300.204 - Exception to maintenance of effort.

    Science.gov (United States)

    2010-07-01

    ... the child has terminated; or (3) No longer needs the program of special education. (d) The termination....204 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL... CHILDREN WITH DISABILITIES Local Educational Agency Eligibility § 300.204 Exception to maintenance...

  17. 7 CFR 400.204 - Notification of deviation from standards.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Notification of deviation from standards. 400.204... Contract-Standards for Approval § 400.204 Notification of deviation from standards. A Contractor shall... that the deviation is temporary, the Corporation may grant a temporary waiver pending compliance...

  18. 40 CFR 600.204-77 - Section numbering, construction.

    Science.gov (United States)

    2010-07-01

    ....204-77 Section 600.204-77 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-Procedures for Calculating Fuel Economy Values §...

  19. Dicty_cDB: SSB204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSB204 (Link to dictyBase) - - - Contig-U12232-1 SSB204F (Link to Original ... 2-128... 106 4e-22 AB211503_1( AB211503 |pid:none) Drosera ... adelae RNase DA-I mRNA for... 105 7e-22 ( P42813 ) ...

  20. 48 CFR 252.204-7006 - Billing Instructions.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Billing Instructions. 252... Provisions And Clauses 252.204-7006 Billing Instructions. As prescribed in 204.7109, use the following clause: Billing Instructions (OCT 2005) When submitting a request for payment, the Contractor shall— (a)...

  1. 14 CFR 1214.204 - Patent and data rights.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Patent and data rights. 1214.204 Section... Substantial Investment in the STS Program § 1214.204 Patent and data rights. (a) When accommodating missions... purposes rights to inventions, patents and data resulting from such missions, subject to the...

  2. 18 CFR 1304.204 - Docks, piers, and boathouses.

    Science.gov (United States)

    2010-04-01

    ... structures due to extreme water level fluctuations. Roofs over docks or piers to provide shade are allowed on... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Docks, piers, and boathouses. 1304.204 Section 1304.204 Conservation of Power and Water Resources TENNESSEE VALLEY...

  3. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    Energy Technology Data Exchange (ETDEWEB)

    Petrich, T.; Helmeke, H.-J.; Meyer, G.J.; Knapp, W.H.; Poetter, E. [Department of Nuclear Medicine, Medizinische Hochschule Hannover (Germany)

    2002-07-01

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET {alpha}-emitter astatine-211 ({sup 211}At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 ({sup 123}I), 340-fold for technetium-99m pertechnetate ({sup 99m}TcO{sub 4}{sup -}) and 60-fold for {sup 211}At. Cellular {sup 211}At accumulation was found to be dependent on extracellular Na{sup +} ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and {sup 99m}TcO{sub 4}{sup -} uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated {sup 211}At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and {sup 211}At were rapidly (apparent t{sub 1/2} 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times ({sup 123}I), 25 times ({sup 99m}TcO{sub 4}{sup -}) and 10 times ({sup 211}At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of {sup 123}I and {sup 211}At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for {sup 123}I, 5.2 h for {sup 211}At) and

  4. Vasorelaxation Effect of Estrone Derivate EA204 in Rabbit Aorta

    Science.gov (United States)

    Li, Wei-Qi

    2016-01-01

    Estrogen and its derivatives exert vascular protective effects, but the underlying mechanisms remain to be studied fully. Objective. To investigate the vasorelaxation effect and related mechanisms of an estrone derivate EA204[3-(2-piperidin-1-yl)-ethoxy-estra-1, 3, 5 (10)-trien-17-one] on isolated arterial preparation from rabbit thoracic aorta. Methods. Aortic rings from rabbit thoracic aorta were prepared and held in small organ bath filled with Krebs solution; tension change was recorded by a multichannel physiological signal collection and handling system. Results. EA204 (10−5 to 10−3 M) induced a concentration-dependent relaxation of aortic rings with endothelium and without endothelium. In denuded arterial preparations, EA204 had a potent relaxing effect on isolated arterial preparations contracted with phenylephrine, norepinephrine, and high-K+ solution or BaCl2. Mechanism study indicates that EA204 relaxes aortic rings by inhibiting Ca2+ channels (both receptor-operating Ca2+ channels and the voltage-dependent Ca2+ channels were involved) to decrease extracellular Ca2+ influx and intracellular Ca2+ release. EA204 is different from verapamil, which is a noncompetitive inhibitor of Ca2+ channels. In addition, K+ channels opening may contribute to this vasorelaxation effect. Conclusion. EA204 had a potent endothelium-independent relaxing effect on isolated arterial preparation by inhibiting Ca2+ channels and opening K+ channels. The results suggest that EA204 is a potential compound for treatment of cardiovascular diseases in postmenopausal women. PMID:27190689

  5. 48 CFR 3003.204 - Treatment of violations.

    Science.gov (United States)

    2010-10-01

    ... COCO shall ensure that the hearing procedures required by (FAR) 48 CFR 3.204(b) are afforded to the... during the “conduct of an agency procurement” the COCO shall consult with Government legal...

  6. 42 CFR 50.204 - Informed consent requirement.

    Science.gov (United States)

    2010-10-01

    ... APPLICABILITY Sterilization of Persons in Federally Assisted Family Planning Projects § 50.204 Informed consent... available alternative methods of family planning and birth control; (3) Advice that the...

  7. 12 CFR 204.126 - Depository institution participation in “Federal funds” market.

    Science.gov (United States)

    2010-01-01

    ...Federal fundsâ market. 204.126 Section 204.126 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS...) Interpretations § 204.126 Depository institution participation in “Federal funds” market. (a) Under § 204.2(a)(1... (article XII) Company, the Export-Import Bank of the United States, Minbanc Capital Corp., and...

  8. Emergence of OXA-204 β-lactamase in Tunisia.

    Science.gov (United States)

    Charfi, Karama; Mansour, Wejdène; Khalifa, Anis Ben Haj; Mastouri, Maha; Aouni, Mahjoub; Mammeri, Hedi

    2015-08-01

    A retrospective epidemiological survey was carried out to determine the prevalence of carbapenemase producers among enterobacterial clinical isolates recovered in the center of maternity and neonatology of Monastir (Tunisia). PCR screening identified 1 OXA-48 and 2 OXA-204 producers, which coexpressed the CTX-M-15 or the CMY-4 β-lactamases. PCR mapping showed that the bla(OXA-48) gene was carried by a Tn1999.2 transposon, whereas the bla(OXA-204) gene was part of the Tn2016 transposon-like structure. The OXA-48- or OXA-204-producing Klebsiella pneumoniae clinical isolates and the OXA-204-expressing Escherichia coli clinical isolate belonged to the widespread sequence types ST11, ST101, and ST617, respectively. The OXA-204 enzyme, which is a point derivative of the OXA-48 carbapenemase, had hitherto been reported in 2013 from K. pneumoniae isolate. Our study shows for the first time the dissemination of this resistance marker in E. coli strain. The coproduction of OXA-204 with CTX-M-15 and CMY-4 enzymes may potentiate the risk of multiresistance and may enhance the risk of dissemination. PMID:26001616

  9. 12 CFR 204.125 - Foreign, international, and supranational entities referred to in §§ 204.2(c)(1)(iv)(E) and 204.8...

    Science.gov (United States)

    2010-01-01

    ....2(c)(1)(iv)(E) and 204.8(a)(2)(i)(B)(5) are: Europe Bank for International Settlements. European Atomic Energy Community. European Central Bank. European Coal and Steel Community. The European Communities. European Development Fund. European Economic Community. European Free Trade Association....

  10. Self-absorption correction in standardisation of 204Tl

    International Nuclear Information System (INIS)

    In the frame of the CCRI(II) (Consultative Committee for Ionizing Radiation at the BIPM) working group on 204Tl, dedicated to investigate the problem and explain the reasons for the discrepancy between methods in standardisation of 204Tl, IRMM was assigned the task of studying the influence of self-absorption in solid sources of 204Tl. This was investigated by measuring the activity of quantitative solid sources of different carrier content, prepared by employing a special source drying technique, developed at IRMM. The activity of the solid sources was determined using a 4π pressurised proportional counter. The self-absorption was calculated using the activity determined from liquid scintillation spectrometry, unaffected by self-absorption, as the reference value. After correction for foil absorption and non-detected X-rays, the self-absorption showed a linear relation to the logarithm of the dry mass of the source. For a typical source, the self-absorption correction for 204Tl was found to be as high as 8%. This article describes a way to minimise and correct for self-absorption in solid sources of 204Tl or nuclides with similar decay properties

  11. 30 CFR 204.6 - May I appeal if MMS denies my request for prepayment or other relief?

    Science.gov (United States)

    2010-07-01

    ... prepayment or other relief? 204.6 Section 204.6 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT ALTERNATIVES FOR MARGINAL PROPERTIES General Provisions § 204... under 30 CFR part 290....

  12. Durable donor engraftment after radioimmunotherapy using α-emitter astatine-211-labeled anti-CD45 antibody for conditioning in allogeneic hematopoietic cell transplantation.

    Science.gov (United States)

    Chen, Yun; Kornblit, Brian; Hamlin, Donald K; Sale, George E; Santos, Erlinda B; Wilbur, D Scott; Storer, Barry E; Storb, Rainer; Sandmaier, Brenda M

    2012-02-01

    To reduce toxicity associated with external γ-beam radiation, we investigated radioimmunotherapy with an anti-CD45 mAb labeled with the α-emitter, astatine-211 ((211)At), as a conditioning regimen in dog leukocyte antigen-identical hematopoietic cell transplantation (HCT). Dose-finding studies in 6 dogs treated with 100 to 618 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) without HCT rescue demonstrated dose-dependent myelosuppression with subsequent autologous recovery, and transient liver toxicity in dogs treated with (211)At doses less than or equal to 405 μCi/kg. Higher doses of (211)At induced clinical liver failure. Subsequently, 8 dogs were conditioned with 155 to 625 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) before HCT with dog leukocyte antigen-identical bone marrow followed by a short course of cyclosporine and mycophenolate mofetil immunosuppression. Neutropenia (1-146 cells/μL), lymphopenia (0-270 cells/μL), and thrombocytopenia (1500-6560 platelets/μL) with prompt recovery was observed. Seven dogs had long-term donor mononuclear cell chimerism (19%-58%), whereas 1 dog treated with the lowest (211)At dose (155 μCi/kg) had low donor mononuclear cell chimerism (5%). At the end of follow-up (18-53 weeks), only transient liver toxicity and no renal toxicity had been observed. In conclusion, conditioning with (211)At-labeled anti-CD45 mAb is safe and efficacious and provides a platform for future clinical trials of nonmyeloablative transplantation with radioimmunotherapy-based conditioning. PMID:22134165

  13. 31 CFR 537.204 - Prohibited new investment in Burma.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Prohibited new investment in Burma... Prohibitions § 537.204 Prohibited new investment in Burma. Except as otherwise authorized, new investment, as... Foreign Operations, Export Financing, and Related Programs Appropriations Act, 1997 (Public Law...

  14. 18 CFR 281.204 - Tariff filing requirements.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Tariff filing....204 Tariff filing requirements. (a) General rule. Each interstate pipeline listed in § 281.202 shall file tariff sheets, in accordance with § 154.4 of this chapter, including an index of...

  15. 41 CFR 50-204.75 - Transportation safety.

    Science.gov (United States)

    2010-07-01

    ... Transportation Safety § 50-204.75 Transportation safety. Any requirements of the U.S. Department of Transportation under 49 CFR Parts 171-179 and Parts 390-397 and 14 CFR Part 103 shall be applied to... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Transportation safety....

  16. 41 CFR 50-204.20 - Radiation-definitions.

    Science.gov (United States)

    2010-07-01

    ... Radiation Standards § 50-204.20 Radiation—definitions. As used in this subpart: (a) Radiation includes alpha... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Radiation-definitions. 50... controlled by the employer for purposes of protection of individuals from exposure to radiation...

  17. 40 CFR 204.56 - Testing by the Administrator.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Testing by the Administrator. 204.56... the Administrator. (a)(1) The Administrator may require that any compressor tested or scheduled to be...) The Administrator may specify that he will conduct such testing at the manufacturer's facility,...

  18. 42 CFR 460.204 - Financial recordkeeping and reporting requirements.

    Science.gov (United States)

    2010-10-01

    ..., accounting, statistical, and reporting practices that are widely accepted in the health care industry. (d... 42 Public Health 4 2010-10-01 2010-10-01 false Financial recordkeeping and reporting requirements...-INCLUSIVE CARE FOR THE ELDERLY (PACE) Data Collection, Record Maintenance, and Reporting § 460.204...

  19. 48 CFR 16.204 - Fixed-price incentive contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Fixed-price incentive... CONTRACTING METHODS AND CONTRACT TYPES TYPES OF CONTRACTS Fixed-Price Contracts 16.204 Fixed-price incentive contracts. A fixed-price incentive contract is a fixed-price contract that provides for adjusting profit...

  20. 41 CFR 101-6.204-3 - Special benefits.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Special benefits. 101-6...-Nondiscrimination in Programs Receiving Federal Financial Assistance § 101-6.204-3 Special benefits. An individual shall not be deemed subjected to discrimination by reason of his exclusion from benefits limited...

  1. 18 CFR 367.2040 - Account 204, Preferred stock issued.

    Science.gov (United States)

    2010-04-01

    ..., FEDERAL POWER ACT AND NATURAL GAS ACT UNIFORM SYSTEM OF ACCOUNTS FOR CENTRALIZED SERVICE COMPANIES SUBJECT TO THE PROVISIONS OF THE PUBLIC UTILITY HOLDING COMPANY ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT Balance Sheet Chart of Accounts Proprietary Capital § 367.2040 Account 204, Preferred...

  2. 48 CFR 204.7004 - Supplementary PII numbers.

    Science.gov (United States)

    2010-10-01

    ...) Positions 2 through 3. These are the first two digits in a serial number. They may be either alpha or... the office identified in the basic PII number, assign a serial number to the order or call. The first... Identification Numbers 204.7004 Supplementary PII numbers. (a) Uses of the supplementary number....

  3. 41 CFR 50-204.7 - Personal protective equipment.

    Science.gov (United States)

    2010-07-01

    ... assure its adequacy, including proper maintenance and sanitation of such equipment. All personal... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Personal protective... CONTRACTS General Safety and Health Standards § 50-204.7 Personal protective equipment. Protective...

  4. 48 CFR 52.204-2 - Security Requirements.

    Science.gov (United States)

    2010-10-01

    ... performance of work under the contract in compliance with the change in security classification or... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Security Requirements. 52....204-2 Security Requirements. As prescribed in 4.404(a), insert the following clauses:...

  5. 40 CFR 94.204 - Designation of engine families.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Designation of engine families. 94.204... Designation of engine families. This section specifies the procedure and requirements for grouping of engines into engine families. (a) Manufacturers shall divide their engines into groupings of engines which...

  6. 9 CFR 113.204 - Mink Enteritis Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mink Enteritis Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.204 Mink Enteritis Vaccine, Killed Virus. Mink Enteritis...

  7. 20 CFR 345.204 - Sale or transfer of assets.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Sale or transfer of assets. 345.204 Section... or transfer of assets. (a) In the event property of an employer is sold or transferred to another... shall be subject to the approval of the Board. Where the employer acquiring the assets is an...

  8. 42 CFR 59.204 - Application for a grant.

    Science.gov (United States)

    2010-10-01

    ... PLANNING SERVICES Grants for Family Planning Service Training § 59.204 Application for a grant. (a) An... instructions may be obtained from the Program Director, Family Planning Services, at the Regional Office of the... of Family Planning, Office of the Assistant Secretary for Health, Washington, DC 20201. (b)...

  9. 5 CFR 847.204 - Elections of FERS coverage.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Elections of FERS coverage. 847.204... REGULATIONS (CONTINUED) ELECTIONS OF RETIREMENT COVERAGE BY CURRENT AND FORMER EMPLOYEES OF NONAPPROPRIATED FUND INSTRUMENTALITIES Elections To Continue Retirement Coverage After a Qualifying Move §...

  10. 40 CFR 180.204 - Dimethoate; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Dimethoate; tolerances for residues...) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.204 Dimethoate; tolerances for residues. (a) General. Tolerances are established for...

  11. 31 CFR 575.204 - Prohibited importation of goods or services from Iraq.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Prohibited importation of goods or services from Iraq. 575.204 Section 575.204 Money and Finance: Treasury Regulations Relating to Money and... REGULATIONS Prohibitions § 575.204 Prohibited importation of goods or services from Iraq. Except as...

  12. 48 CFR 52.204-5 - Women-Owned Business (Other Than Small Business).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Women-Owned Business (Other Than Small Business). 52.204-5 Section 52.204-5 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.204-5 Women-Owned Business (Other Than Small Business). As prescribed in...

  13. 30 CFR 285.204 - What areas are available for leasing consideration?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What areas are available for leasing consideration? 285.204 Section 285.204 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR... OCS Renewable Energy Leases General Lease Information § 285.204 What areas are available for...

  14. 12 CFR 204.122 - Secondary market activities of international banking facilities.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Secondary market activities of international banking facilities. 204.122 Section 204.122 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF...) Interpretations § 204.122 Secondary market activities of international banking facilities. (a) Questions have...

  15. 48 CFR 52.204-4 - Printed or Copied Double-Sided on Recycled Paper.

    Science.gov (United States)

    2010-10-01

    ... submit paper documents, such as offers, letters, or reports, that are printed or copied double-sided on...-Sided on Recycled Paper. 52.204-4 Section 52.204-4 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.204-4 Printed or Copied Double-Sided on Recycled Paper. As prescribed in...

  16. 15 CFR 270.204 - Provision of additional resources and services needed by a Team.

    Science.gov (United States)

    2010-01-01

    ... services needed by a Team. 270.204 Section 270.204 Commerce and Foreign Trade Regulations Relating to... CONSTRUCTION SAFETY TEAMS NATIONAL CONSTRUCTION SAFETY TEAMS Investigations § 270.204 Provision of additional resources and services needed by a Team. The Director will determine the appropriate resources that a...

  17. 18 CFR 3b.204 - Safeguarding information in manual and computer-based record systems.

    Science.gov (United States)

    2010-04-01

    ... information in manual and computer-based record systems. 3b.204 Section 3b.204 Conservation of Power and Water... Collection of Records § 3b.204 Safeguarding information in manual and computer-based record systems. (a) The administrative and physical controls to protect the information in the manual and computer-based record...

  18. 8 CFR 204.306 - Classification as an immediate relative based on a Convention adoption.

    Science.gov (United States)

    2010-01-01

    ....306 Classification as an immediate relative based on a Convention adoption. (a) Unless 8 CFR 204.309... process: (1) First, the U.S. citizen must file a Form I-800A under 8 CFR 204.310; (2) Then, once USCIS has... adoptee, the U.S. citizen must file a Form I-800 under 8 CFR 204.313....

  19. 17 CFR 204.55 - Change in notification to Financial Management Service.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Change in notification to Financial Management Service. 204.55 Section 204.55 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES RELATING TO DEBT COLLECTION Tax Refund Offset § 204.55 Change in notification...

  20. 12 CFR 741.204 - Maximum public unit and nonmember accounts, and low-income designation.

    Science.gov (United States)

    2010-01-01

    ... low-income designation. 741.204 Section 741.204 Banks and Banking NATIONAL CREDIT UNION ADMINISTRATION... Unions § 741.204 Maximum public unit and nonmember accounts, and low-income designation. Any credit union...) Obtain a low-income designation in order to accept nonmember accounts, other than from public units...

  1. 41 CFR 50-204.33 - Disclosure to former employee of individual employee's record.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Disclosure to former employee of individual employee's record. 50-204.33 Section 50-204.33 Public Contracts and Property Management Other Provisions Relating to Public Contracts PUBLIC CONTRACTS, DEPARTMENT OF LABOR 204-SAFETY AND HEALTH STANDARDS FOR FEDERAL...

  2. 40 CFR 721.4587 - Lithium manganese oxide (LiMn204) (generic name).

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Lithium manganese oxide (LiMn204... Specific Chemical Substances § 721.4587 Lithium manganese oxide (LiMn204) (generic name). (a) Chemical... as lithium manganese oxide (LiMn204) (P-96-175) is subject to reporting under this section for...

  3. 41 CFR 109-38.204-50 - Records of exempted motor vehicles.

    Science.gov (United States)

    2010-07-01

    ... motor vehicles. 109-38.204-50 Section 109-38.204-50 Public Contracts and Property Management Federal... AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 38-MOTOR EQUIPMENT MANAGEMENT 38.2-Registration, Identification, and Exemptions § 109-38.204-50 Records of exempted motor vehicles. The Director, Office...

  4. 41 CFR 50-204.6 - Medical services and first aid.

    Science.gov (United States)

    2010-07-01

    ... first aid. 50-204.6 Section 50-204.6 Public Contracts and Property Management Other Provisions Relating... SUPPLY CONTRACTS General Safety and Health Standards § 50-204.6 Medical services and first aid. (a) The... trained to render first aid. First aid supplies approved by the consulting physician shall be...

  5. 48 CFR 53.204-1 - Safeguarding classified information within industry (DD Form 254, DD Form 441).

    Science.gov (United States)

    2010-10-01

    ... information within industry (DD Form 254, DD Form 441). 53.204-1 Section 53.204-1 Federal Acquisition....204-1 Safeguarding classified information within industry (DD Form 254, DD Form 441). The following... specified in subpart 4.4 and the clause at 52.204-2: (a) DD Form 254 (Department of Defense (DOD)),...

  6. 19 CFR 351.204 - Time periods and persons examined; voluntary respondents; exclusions.

    Science.gov (United States)

    2010-04-01

    ... § 351.204 Time periods and persons examined; voluntary respondents; exclusions. (a) Introduction... fiscal quarters (or, in an investigation involving merchandise imported from a nonmarket economy...

  7. 30 CFR 204.205 - How do I obtain accounting and auditing relief?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I obtain accounting and auditing relief? 204.205 Section 204.205 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT ALTERNATIVES FOR MARGINAL PROPERTIES Accounting and Auditing Relief §...

  8. 30 CFR 204.201 - Who may obtain accounting and auditing relief?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Who may obtain accounting and auditing relief? 204.201 Section 204.201 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT ALTERNATIVES FOR MARGINAL PROPERTIES Accounting and Auditing Relief §...

  9. 30 CFR 210.204 - How do I submit facility data?

    Science.gov (United States)

    2010-07-01

    ... you submit facility data by paper copy, send it to the applicable address given in § 210.202(c)(2). ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I submit facility data? 210.204 Section... MANAGEMENT FORMS AND REPORTS Production and Royalty Reports-Solid Minerals § 210.204 How do I submit...

  10. 17 CFR 275.204A-1 - Investment adviser codes of ethics.

    Science.gov (United States)

    2010-04-01

    ... ethics. 275.204A-1 Section 275.204A-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... codes of ethics. (a) Adoption of code of ethics. If you are an investment adviser registered or required... enforce a written code of ethics that, at a minimum, includes: (1) A standard (or standards) of...

  11. 12 CFR 303.204 - Applications for acquisitions, branching, and new lines of business.

    Science.gov (United States)

    2010-01-01

    ... in acquisitions, branching or new lines of business. (2) A new line of business will include any new... new lines of business. 303.204 Section 303.204 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION... acquisitions, branching, and new lines of business. (a) Scope. (1) Any insured state nonmember bank and...

  12. 48 CFR 3052.204-70 - Security requirements for unclassified information technology resources.

    Science.gov (United States)

    2010-10-01

    ... for unclassified information technology resources. As prescribed in (HSAR) 48 CFR 3004.470-3, insert a clause substantially the same as follows: Security Requirements for Unclassified Information Technology... unclassified information technology resources. 3052.204-70 Section 3052.204-70 Federal Acquisition...

  13. 48 CFR 1652.204-72 - Filing health benefit claims/court review of disputed claims.

    Science.gov (United States)

    2010-10-01

    ... inserted in all FEHB Program contracts. Filing Health Benefit Claims/Court Review of Disputed Claims (MAR... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Filing health benefit claims/court review of disputed claims. 1652.204-72 Section 1652.204-72 Federal Acquisition...

  14. 7 CFR 1400.204 - Limited partnerships, limited liability partnerships, limited liability companies, corporations...

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Limited partnerships, limited liability partnerships, limited liability companies, corporations, and other similar legal entities. 1400.204 Section 1400.204... entities. (a) A limited partnership, limited liability partnership, limited liability company,......

  15. 27 CFR 26.204a - Verification of eligible wines and eligible flavors.

    Science.gov (United States)

    2010-04-01

    ... wines and eligible flavors. 26.204a Section 26.204a Alcohol, Tobacco Products and Firearms ALCOHOL AND... Verification of eligible wines and eligible flavors. (a) Any person who, after December 1, 1990, brings into... eligible wines shall, before the first tax determination at that rate, request and receive a statement...

  16. 5 CFR 890.204 - Withdrawal of approval of health benefits plans or carriers.

    Science.gov (United States)

    2010-01-01

    ... CFR subpart 1609.70 are not met. Such action carries with it the right to a hearing as provided in... plans or carriers. 890.204 Section 890.204 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT... documentary evidence, including rebuttal evidence, in opposition to the proposed action. (i) A...

  17. 23 CFR 500.204 - TMS components for highway traffic data.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false TMS components for highway traffic data. 500.204 Section... INFRASTRUCTURE MANAGEMENT MANAGEMENT AND MONITORING SYSTEMS Traffic Monitoring System § 500.204 TMS components for highway traffic data. (a) General. Each State's TMS, including those using alternative...

  18. 41 CFR 50-204.65 - Inspection of compressed gas cylinders.

    Science.gov (United States)

    2010-07-01

    ... Hazardous Materials Regulations of the Department of Transportation (49 CFR Parts 171-179 and 14 CFR Part... gas cylinders. 50-204.65 Section 50-204.65 Public Contracts and Property Management Other Provisions... cylinders. Each contractor shall determine that compressed gas cylinders under his extent that this can...

  19. Separation of nickel, cobalt and copper by solvent extraction with P204

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Nickel, cobalt and copper were separated by solvent extraction with P204. The experimental results show that [Co(NH3)6]3+ is an inert complex in extraction kinetics, therefore cobalt can be separated from nickel and copper by non-equilibrium solvent extraction. Under the conditions of temperature 25℃, contact time of two phases 10 min, phase ratio 1:1, aqueous pH 10.10 and concentration of P204 20 %, [ Co(NH3 )6 3+ is hardly extracted by P204, while the percentage extractions of nickel and copper are 79.3 % and 93.9 % respectively. Nickel and copper are separated by equi librium solvent extraction with P204. Under the conditions of temperature 25 ℃, contact time of two phases 1 min, phase ratio 1:1, equilibrium pH 4.01 and concentration of P204 20%, the separation factor of copper and nickel is 216.

  20. Research on extracted 90Y with P204 in lipiodol for liver cancer

    International Nuclear Information System (INIS)

    Research on extracted 90Y with di(2-ethylhexyl) orthophosphoric acid (P204) in lipiodol for liver cancer was made to evaluate the stability of extracted 90Y with P204 in lipiodol (90Y-P204-lipiodol) in serum of newly-born cattle and human's blood. At first, P204 (extractant) was dissolved in lipiodol (organic phase). Secondly, 90Y was extracted to organic phase after adding 90Y solution into test tube with P204 and lipiodol in it. The extracting efficiency with 0.01 mol/l P204 could reach 99.4%. The stability of 90Y-P204-lipiodol has been experimented in physiological saline solution as preparation for further stability experiment. The result indicated that the extracted 90Y lost 0.02%-0.36% in physiological saline solution. The results of further stability experiment showed that loss efficiencies of extracted 90Y after adding newly-born cattle serum 1 hour, 1 day, 3 and 7 days are 3.38%, 3.12%, 4.29% and 6.62%, respectively, and loss efficiencies of extracted 90Y after adding human's blood 1 hour, 1 day, 3 and 7 days are 2.55%, 5.91%, 7.88% and 5.63%, respectively. Our data also indicated that 90Y is the most possible radioisotope for being extracted with P204 in lipiodol to treat hepatocellular carcinoma, particularly in cases of unresectable liver tumors, since 90Y is available from several commercial sources in clinical quality. We conclude that the stability of 90Y-P204-lipiodol tested with newly-born cattle serum and human's blood attained great results. 90Y-P204-lipiodol is a kind of potential and exciting pharmaceutical in interventional therapy for liver cancer and we can carry on the further animal test and clinical trial. (author)

  1. Strain gage sting balance 204-6. Calibration report

    Science.gov (United States)

    Blaettler, Heinz

    1986-12-01

    The strain gage sting balance 204-6 was developed for aerodynamic measurements on rocket models in the transonic and supersonic wind tunnel. Data are: X = +/- 50 (N); Y = +/- 150 (N); Z = +/- 400 (N); Mx = +/- 1.5 (Nm); My = +/- 20 (Nm); and Mz = +/- 10 (Nm). Compared to the existing balances of same size the ratio Y/Z is changed from 1:8 to 1:3.75. This change of specifications was introduced with regard to measurements to be taken with a sting providing automatic roll positioning around the X-axis. The resistance module was separately constructed and prestressed by a factor of 0.5, and connected to the model and sting part of the balance by electron-beam welding.

  2. Decreased expression of miR-204 is associated with poor prognosis in patients with breast cancer

    OpenAIRE

    Li, Weidong; Jin, Xuejun; Zhang, Qianbing; Zhang, Gong; Deng, Xubin; Ma, Lei

    2014-01-01

    The identification of biomarkers in breast cancer diagnosis and therapy is important in achieving early cancer diagnosis and improving patient outcomes. The aim of this study was to examine clinical significance of miR-204 expression in tissues from breast cancer patients. The relationship between miR-204 expression and clinicopathological characteristics was investigated. MiR-204 expression was significantly associated with TNM stage and metastasis. Patients with low miR-204 expression had p...

  3. 30 CFR 204.207 - Who will approve, deny, or modify my request for accounting and auditing relief?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Who will approve, deny, or modify my request for accounting and auditing relief? 204.207 Section 204.207 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT ALTERNATIVES FOR MARGINAL PROPERTIES Accounting and Auditing Relief § 204.207 Who...

  4. 30 CFR 204.5 - What statutory requirements must I meet to obtain royalty prepayment or accounting and auditing...

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What statutory requirements must I meet to obtain royalty prepayment or accounting and auditing relief? 204.5 Section 204.5 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT ALTERNATIVES FOR MARGINAL PROPERTIES General Provisions § 204.5...

  5. 24 CFR 960.204 - Denial of admission for criminal activity or drug abuse by household members.

    Science.gov (United States)

    2010-04-01

    ... activity or drug abuse by household members. 960.204 Section 960.204 Housing and Urban Development... HOUSING Admission § 960.204 Denial of admission for criminal activity or drug abuse by household members. (a) Required denial of admission—(1) Persons evicted for drug-related criminal activity. The...

  6. 20 CFR 204.7 - Employment relation-service to a local lodge or division of a railway labor organization.

    Science.gov (United States)

    2010-04-01

    ... or division of a railway labor organization. 204.7 Section 204.7 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT EMPLOYMENT RELATION § 204.7 Employment relation—service to a local lodge or division of a railway labor organization. Service by an individual...

  7. 10 CFR 431.204 - Uniform test method for the measurement of energy consumption of illuminated exit signs.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Uniform test method for the measurement of energy consumption of illuminated exit signs. 431.204 Section 431.204 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION... Procedures § 431.204 Uniform test method for the measurement of energy consumption of illuminated exit...

  8. 48 CFR 27.204-1 - Use of patented technology under the North American Free Trade Agreement.

    Science.gov (United States)

    2010-10-01

    ... under the North American Free Trade Agreement. 27.204-1 Section 27.204-1 Federal Acquisition Regulations... Patents and Copyrights 27.204-1 Use of patented technology under the North American Free Trade Agreement... the patent holder is from a country that is a party to the North American Free Trade Agreement...

  9. 5 CFR 894.204 - May I be enrolled in more than one dental or vision plan at a time?

    Science.gov (United States)

    2010-01-01

    ... or vision plan at a time? 894.204 Section 894.204 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL EMPLOYEES DENTAL AND VISION INSURANCE PROGRAM Coverage and Types of Enrollment § 894.204 May I be enrolled in more than one dental or...

  10. 8 CFR 204.7 - Preservation of benefits contained in savings clause of Immigration and Nationality Act...

    Science.gov (United States)

    2010-01-01

    ... savings clause of Immigration and Nationality Act Amendments of 1976. 204.7 Section 204.7 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS IMMIGRANT PETITIONS Immigrant Visa Petitions § 204.7 Preservation of benefits contained in savings clause of Immigration and Nationality...

  11. Treatment of cultured glioma cells with the EGFR-TKI gefitinib (''Iressa'', ZD1839) increases the uptake of astatinated EGF despite the absence of gefitinib-mediated growth inhibition

    International Nuclear Information System (INIS)

    The EGFR-TKI (epidermal growth factor receptor tyrosine kinase inhibitor) gefitinib (''Iressa'', ZD1839), a reversible growth inhibitor of EGFR-expressing tumour cells, has been shown to enhance the antitumour effect of ionising radiation, and also to increase the uptake of radioiodinated EGF. Thus, combination of gefitinib treatment and radionuclide targeting is an interesting option for therapy of brain tumours that are difficult to treat with conventional methods. The aim of this study was to evaluate how pre-treatment with gefitinib affects binding of astatinated EGF (211At-EGF) to cultured glioma U343 cells, which express high levels of EGFR. The growth of U343 cells in the presence of gefitinib was investigated, and it was found that gefitinib does not significantly inhibit the growth of these cells. Nevertheless, the uptake of 211At-EGF in U343 cells was markedly increased (up to 3.5 times) in cells pre-treated with gefitinib (1 μM). This indicates that a combination of gefitinib treatment and radionuclide targeting to EGFR might be a useful therapeutic modality, even for patients who do not respond to treatment with gefitinib alone. (orig.)

  12. miR-204-5p suppresses cell proliferation by inhibiting IGFBP5 in papillary thyroid carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Lianyong; Wang, Jingnan; Li, Xiangqi; Ma, Junhua; Shi, Chao; Zhu, Hongling; Xi, Qian; Zhang, Jichen; Zhao, Xuemei; Gu, Mingjun, E-mail: mjgugonglihos@yeah.net

    2015-02-20

    microRNAs (miRNAs) are frequently dysregulated in human malignancies. It was recently shown that miR-204-5p is downregulated in papillary thyroid carcinoma (PTC); however, the functional significance of this observation is not known. This study investigated the role of miR-204-5p in PTC. Overexpressing miR-204-5p suppressed PTC cell proliferation and induced cell cycle arrest and apoptosis. The results of a luciferase reporter assay showed that miR-204-5p can directly bind to the 3′ untranslated region (UTR) of insulin-like growth factor-binding protein 5 (IGFBP5) mRNA, and IGFBP5 overexpression partially reversed the growth-inhibitory effects of miR-204-5p. These results indicate that miR-204-5p acts as a tumor suppressor in PTC by regulating IGFBP5 expression and that miR-204-5p can potentially serve as an antitumorigenic agent in the treatment of PTC. - Highlights: • miR-204-5p expression is downregulated in PTC tissues and cell lines. • miR-204-5p suppresses proliferation and promotes apoptosis in PTC cells. • miR-204-5p suppresses IGFBP5 expression by direct binding to the 3′-UTR. • IGFBP5 overexpression reverses the effects of miR-204-5p.

  13. 14 CFR 221.204 - Adoption of provisions of one carrier by another carrier.

    Science.gov (United States)

    2010-01-01

    ... TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Electronically Filed Tariffs § 221.204... carrier, the effective and prospective fares of the adopted carrier shall be changed to reflect the...

  14. Ginseng Purified Dry Extract, BST204, Improved Cancer Chemotherapy-Related Fatigue and Toxicity in Mice

    Directory of Open Access Journals (Sweden)

    Hyun-Jung Park

    2015-01-01

    Full Text Available Cancer related fatigue (CRF is one of the most common side effects of cancer and its treatments. A large proportion of cancer patients experience cancer-related physical and central fatigue so new strategies are needed for treatment and improved survival of these patients. BST204 was prepared by incubating crude ginseng extract with ginsenoside-β-glucosidase. The purpose of the present study was to examine the effects of BST204, mixture of ginsenosides on 5-fluorouracil (5-FU-induced CRF, the glycogen synthesis, and biochemical parameters in mice. The mice were randomly divided into the following groups: the naïve normal (normal, the HT-29 cell inoculated (xenograft, xenograft and 5-FU treated (control, xenograft + 5-FU + BST204-treated (100 and 200 mg/kg (BST204, and xenograft + 5-FU + modafinil (13 mg/kg treated group (modafinil. Running wheel activity and forced swimming test were used for evaluation of CRF. Muscle glycogen, serum inflammatory cytokines, aspartic aminotransferase (AST, alanine aminotransferase (ALT, creatinine (CRE, white blood cell (WBC, neutrophil (NEUT, red blood cell (RBC, and hemoglobin (HGB were measured. Treatment with BST204 significantly increased the running wheel activity and forced swimming time compared to the control group. Consistent with the behavioral data, BST204 markedly increased muscle glycogen activity and concentrations of WBC, NEUT, RBC, and HGB. Also, tumor necrosis factor-α (TNF-α and interleukin-6 (IL-6, AST, ALT, and CRE levels in the serum were significantly reduced in the BST204-treated group compared to the control group. This result suggests that BST204 may improve chemotherapy-related fatigue and adverse toxic side effects.

  15. miR-204 targets Bcl-2 expression and enhances responsiveness of gastric cancer

    Science.gov (United States)

    Sacconi, A; Biagioni, F; Canu, V; Mori, F; Di Benedetto, A; Lorenzon, L; Ercolani, C; Di Agostino, S; Cambria, A M; Germoni, S; Grasso, G; Blandino, R; Panebianco, V; Ziparo, V; Federici, O; Muti, P; Strano, S; Carboni, F; Mottolese, M; Diodoro, M; Pescarmona, E; Garofalo, A; Blandino, G

    2012-01-01

    Micro RNAs (miRs) are small non-coding RNAs aberrantly expressed in human tumors. Here, we aim to identify miRs whose deregulated expression leads to the activation of oncogenic pathways in human gastric cancers (GCs). Thirty nine out of 123 tumoral and matched uninvolved peritumoral gastric specimens from three independent European subsets of patients were analyzed for the expression of 851 human miRs using Agilent Platform. The remaining 84 samples were used to validate miRs differentially expressed between tumoral and matched peritumoral specimens by qPCR. miR-204 falls into a group of eight miRs differentially expressed between tumoral and peritumoral samples. Downregulation of miR-204 has prognostic value and correlates with increased staining of Bcl-2 protein in tumoral specimens. Ectopic expression of miR-204 inhibited colony forming ability, migration and tumor engraftment of GC cells. miR-204 targeted Bcl-2 messenger RNA and increased responsiveness of GC cells to 5-fluorouracil and oxaliplatin treatment. Ectopic expression of Bcl-2 protein counteracted miR-204 pro-apoptotic activity in response to 5-fluorouracil. Altogether, these findings suggest that modulation of aberrant expression of miR-204, which in turn releases oncogenic Bcl-2 protein activity might hold promise for preventive and therapeutic strategies of GC. PMID:23152059

  16. Corrective Action Decision Document for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    The six bunkers included in CAU 204 were primarily used to monitor atmospheric testing or store munitions. The 'Corrective Action Investigation Plan (CAIP) for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada' (NNSA/NV, 2002a) provides information relating to the history, planning, and scope of the investigation; therefore, it will not be repeated in this CADD. This CADD identifies potential corrective action alternatives and provides a rationale for the selection of a recommended corrective action alternative for each CAS within CAU 204. The evaluation of corrective action alternatives is based on process knowledge and the results of investigative activities conducted in accordance with the CAIP (NNSA/NV, 2002a) that was approved prior to the start of the Corrective Action Investigation (CAI). Record of Technical Change (ROTC) No. 1 to the CAIP (approval pending) documents changes to the preliminary action levels (PALs) agreed to by the Nevada Division of Environmental Protection (NDEP) and DOE, National Nuclear Security Administration Nevada Site Office (NNSA/NSO). This ROTC specifically discusses the radiological PALs and their application to the findings of the CAU 204 corrective action investigation. The scope of this CADD consists of the following: (1) Develop corrective action objectives; (2) Identify corrective action alternative screening criteria; (3) Develop corrective action alternatives; (4) Perform detailed and comparative evaluations of corrective action alternatives in relation to corrective action objectives and screening criteria; and (5) Recommend and justify a preferred corrective action alternative for each CAS within CAU 204

  17. Lung collagens perpetuate pulmonary fibrosis via CD204 and M2 macrophage activation.

    Directory of Open Access Journals (Sweden)

    Mirjam Stahl

    Full Text Available Idiopathic pulmonary fibrosis is characterized by abundant collagen production and accumulation of alternatively activated macrophages (M2 in the lower respiratory tract. Mechanisms as to how alveolar macrophages are activated by collagen breakdown products are unknown. Alveolar macrophages were obtained by bronchoalveolar lavage from 30 patients with idiopathic pulmonary fibrosis (IPF and 37 healthy donors (HD. Alveolar macrophages were cultured in the presence of collagen type I, III, IV and V monomers w/wo a neutralizing antibody against scavenger receptor I class A (CD204. Culture supernatants were assayed for the M2 markers CCL18, CCL2, and interleukin-1 receptor antagonist (IL-1ra by ELISA. Furthermore, expression of phospho-Akt was measured using ELISA and expression of CD204 by RT-PCR and flow cytometry. Stimulation with collagen type I and III monomers significantly up-regulated CCL18, IL-1ra production of alveolar macrophages. Furthermore, expression of CCL2 and CD204 were up-regulated by collagen type I exposure. In addition, collagen type I stimulation increased pospho-Akt expression. Collagen type I effects were abrogated by neutralizing antiCD204 and a non-selective Phosphatidylinositide 3-kinase inhibitor (LY294002. Spontaneous CD204 expression of alveolar macrophages was significantly increased in patients with IPF. In conclusion, our findings demonstrate that monomeric collagen type I via CD204 induces phospho-Akt expression shifting alveolar macrophages to the profibrotic M2 type. Innate immune responses induced by collagen monomers might perpetuate pulmonary fibrosis.

  18. MiR-204 is responsible for inherited retinal dystrophy associated with ocular coloboma.

    Science.gov (United States)

    Conte, Ivan; Hadfield, Kristen D; Barbato, Sara; Carrella, Sabrina; Pizzo, Mariateresa; Bhat, Rajeshwari S; Carissimo, Annamaria; Karali, Marianthi; Porter, Louise F; Urquhart, Jill; Hateley, Sofie; O'Sullivan, James; Manson, Forbes D C; Neuhauss, Stephan C F; Banfi, Sandro; Black, Graeme C M

    2015-06-23

    Ocular developmental disorders, including the group classified as microphthalmia, anophthalmia, and coloboma (MAC) and inherited retinal dystrophies, collectively represent leading causes of hereditary blindness. Characterized by extreme genetic and clinical heterogeneity, the separate groups share many common genetic causes, in particular relating to pathways controlling retinal and retinal pigment epithelial maintenance. To understand these shared pathways and delineate the overlap between these groups, we investigated the genetic cause of an autosomal dominantly inherited condition of retinal dystrophy and bilateral coloboma, present in varying degrees in a large, five-generation family. By linkage analysis and exome sequencing, we identified a previously undescribed heterozygous mutation, n.37 C > T, in the seed region of microRNA-204 (miR-204), which segregates with the disease in all affected individuals. We demonstrated that this mutation determines significant alterations of miR-204 targeting capabilities via in vitro assays, including transcriptome analysis. In vivo injection, in medaka fish (Oryzias latipes), of the mutated miR-204 caused a phenotype consistent with that observed in the family, including photoreceptor alterations with reduced numbers of both cones and rods as a result of increased apoptosis, thereby confirming the pathogenic effect of the n.37 C > T mutation. Finally, knockdown assays in medaka fish demonstrated that miR-204 is necessary for normal photoreceptor function. Overall, these data highlight the importance of miR-204 in the regulation of ocular development and maintenance and provide the first evidence, to our knowledge, of its contribution to eye disease, likely through a gain-of-function mechanism. PMID:26056285

  19. Ginseng Purified Dry Extract, BST204, Improved Cancer Chemotherapy-Related Fatigue and Toxicity in Mice

    OpenAIRE

    Hyun-Jung Park; Hyun Soo Shim; Jeom Yong Kim; Joo Young Kim; Sun Kyu Park; Insop Shim

    2015-01-01

    Cancer related fatigue (CRF) is one of the most common side effects of cancer and its treatments. A large proportion of cancer patients experience cancer-related physical and central fatigue so new strategies are needed for treatment and improved survival of these patients. BST204 was prepared by incubating crude ginseng extract with ginsenoside-β-glucosidase. The purpose of the present study was to examine the effects of BST204, mixture of ginsenosides on 5-fluorouracil (5-FU)-induced CRF, t...

  20. 48 CFR 27.204-2 - Use of patented technology under the General Agreement on Tariffs and Trade (GATT).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Use of patented technology under the General Agreement on Tariffs and Trade (GATT). 27.204-2 Section 27.204-2 Federal Acquisition... and Trade (GATT). Article 31 of Annex 1C, Agreement on Trade-Related Aspects of Intellectual...

  1. 31 CFR 560.204 - Prohibited exportation, reexportation, sale or supply of goods, technology, or services to Iran.

    Science.gov (United States)

    2010-07-01

    ..., sale or supply of goods, technology, or services to Iran. 560.204 Section 560.204 Money and Finance..., reexportation, sale or supply of goods, technology, or services to Iran. Except as otherwise authorized pursuant..., or services to Iran or the Government of Iran is prohibited, including the exportation,...

  2. 12 CFR 204.124 - Repurchase agreement involving shares of a money market mutual fund whose portfolio consists...

    Science.gov (United States)

    2010-01-01

    ... money market mutual fund whose portfolio consists wholly of United States Treasury and Federal agency... § 204.124 Repurchase agreement involving shares of a money market mutual fund whose portfolio consists... thereof that the depository institution is obligated to repurchase (12 CFR 204.2(a)(1)(vii)(B)). (b)...

  3. 31 CFR 500.536 - Certain transactions with respect to merchandise affected by § 500.204.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Certain transactions with respect to merchandise affected by § 500.204. 500.536 Section 500.536 Money and Finance: Treasury Regulations Relating... transactions with respect to merchandise affected by § 500.204. (a) With respect to merchandise the...

  4. 31 CFR 515.536 - Certain transactions with respect to merchandise affected by § 515.204.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Certain transactions with respect to merchandise affected by § 515.204. 515.536 Section 515.536 Money and Finance: Treasury Regulations Relating... transactions with respect to merchandise affected by § 515.204. (a) With respect to merchandise the...

  5. 12 CFR 204.123 - Sale of Federal funds by investment companies or trusts in which the entire beneficial interest...

    Science.gov (United States)

    2010-01-01

    ... CFR 204.2(a)(1)(vii)(A)(1)). These exemptions from the definition of deposit are known collectively as... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Sale of Federal funds by investment companies... SYSTEM RESERVE REQUIREMENTS OF DEPOSITORY INSTITUTIONS (REGULATION D) Interpretations § 204.123 Sale...

  6. 8 CFR 204.3 - Orphan cases under section 101(b)(1)(F) of the Act (non-Convention cases).

    Science.gov (United States)

    2010-01-01

    ... effective date, as defined in 8 CFR 204.301, on behalf of a child who is habitually resident in a Convention country, as defined in 8 CFR 204.301. On or after the Convention effective date, USCIS may approve a Form... and submitted with the required supporting documentation and the fee as required in 8 CFR...

  7. 40 CFR 204.52 - Portable air compressor noise emission standard.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Portable air compressor noise emission... ABATEMENT PROGRAMS NOISE EMISSION STANDARDS FOR CONSTRUCTION EQUIPMENT Portable Air Compressors § 204.52 Portable air compressor noise emission standard. (a) Effective January 1, 1978, portable air...

  8. 12 CFR 204.133 - Multiple savings deposits treated as a transaction account.

    Science.gov (United States)

    2010-01-01

    ... authorities. (b) Background. Under Regulation D, 12 CFR 204.2(d)(2), the term “savings deposit” includes a... depository institution may authorize up to three of these six transfers to be made by check, draft, debit card, or similar order drawn by the depositor and payable to third parties. If more than six...

  9. 45 CFR 46.204 - Research involving pregnant women or fetuses.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Research involving pregnant women or fetuses. 46... PROTECTION OF HUMAN SUBJECTS Additional Protections for Pregnant Women, Human Fetuses and Neonates Involved in Research § 46.204 Research involving pregnant women or fetuses. Pregnant women or fetuses may...

  10. 49 CFR 174.204 - Tank car delivery of gases, including cryogenic liquids.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Tank car delivery of gases, including cryogenic... CARRIAGE BY RAIL Detailed Requirements for Class 2 (Gases) Materials § 174.204 Tank car delivery of gases, including cryogenic liquids. (a) A tank car containing Class 2 (gases) material may not be unloaded...

  11. 7 CFR 760.204 - Eligible livestock, honeybees, and farm-raised fish.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Eligible livestock, honeybees, and farm-raised fish... for Livestock, Honeybees, and Farm-Raised Fish Program § 760.204 Eligible livestock, honeybees, and farm-raised fish. (a) To be considered eligible livestock for livestock feed losses and grazing...

  12. 45 CFR 204.1 - Submittal of State plans for Governor's review.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Submittal of State plans for Governor's review... GENERAL ADMINISTRATION-STATE PLANS AND GRANT APPEALS § 204.1 Submittal of State plans for Governor's... Mental Health Centers Construction Act, must be submitted to the State Governor for his review...

  13. 13 CFR 106.204 - Who has the authority to approve and sign a Cosponsorship Agreement?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Who has the authority to approve... Cosponsored Activities § 106.204 Who has the authority to approve and sign a Cosponsorship Agreement? The... administrator, after consultation with the General Counsel (or designee), has the authority to approve...

  14. 42 CFR 412.204 - Payment to hospitals located in Puerto Rico.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Payment to hospitals located in Puerto Rico. 412... Payment System for Inpatient Operating Costs for Hospitals Located in Puerto Rico § 412.204 Payment to hospitals located in Puerto Rico. (a) FY 1988 through FY 1997. For discharges occurring on or after...

  15. 40 CFR 204.57-7 - Acceptance and rejection of batch sequence.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Acceptance and rejection of batch... § 204.57-7 Acceptance and rejection of batch sequence. (a) The manufacturer will continue to inspect consecutive batches until the batch sequence is accepted or rejected. The batch sequence will be accepted...

  16. 48 CFR 15.204-3 - Part II-Contract Clauses.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Part II-Contract Clauses... Information 15.204-3 Part II—Contract Clauses. Section I, Contract clauses. The contracting officer shall... uniform contract format. An index may be inserted if this section's format is particularly complex....

  17. 48 CFR 26.204 - Justification for expenditures to other than local firms.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Justification for... Activities 26.204 Justification for expenditures to other than local firms. (a) 42 U.S.C. 5150(b)(1) requires... writing in the contract file. The justification should include consideration for the scope of the...

  18. 5 CFR 842.204 - Immediate voluntary retirement-basic age and service requirements.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Immediate voluntary retirement-basic age... ANNUITY Eligibility § 842.204 Immediate voluntary retirement—basic age and service requirements. (a) An... paragraph (d) of this section, after attaining the minimum retirement age and completing 10 years of...

  19. 42 CFR 420.204 - Principals convicted of a program-related crime.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Principals convicted of a program-related crime... and Control Information § 420.204 Principals convicted of a program-related crime. (a) Information... the facts and circumstances of the specific case, including the nature and severity of the...

  20. 34 CFR 403.204 - What are the State's responsibilities for program evaluation and improvement?

    Science.gov (United States)

    2010-07-01

    ... APPLIED TECHNOLOGY EDUCATION PROGRAM What Are the Administrative Responsibilities of a State Under the State Vocational and Applied Technology Education Program? § 403.204 What are the State's... 34 Education 3 2010-07-01 2010-07-01 false What are the State's responsibilities for...

  1. 41 CFR 50-204.71 - Safety relief devices for compressed gas containers.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Safety relief devices for... FOR FEDERAL SUPPLY CONTRACTS Gases, Vapors, Fumes, Dusts, and Mists § 50-204.71 Safety relief devices... pressure relief devices installed and maintained in accordance with Compressed Gas Association Pamphlets...

  2. 27 CFR 19.204 - Alternation of distilled spirits plant and taxpaid wine bottling house premises.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Alternation of distilled... and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DISTILLED SPIRITS PLANTS Qualification of Distilled Spirits Plants Alternate Operations § 19.204 Alternation...

  3. 41 CFR 109-38.204-4 - Report of exempted motor vehicles.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Report of exempted motor..., TRANSPORTATION, AND MOTOR VEHICLES 38-MOTOR EQUIPMENT MANAGEMENT 38.2-Registration, Identification, and Exemptions § 109-38.204-4 Report of exempted motor vehicles. DOE offices shall provide upon request...

  4. 31 CFR 515.803 - Customs procedures; merchandise specified in § 515.204.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Customs procedures; merchandise... CONTROL REGULATIONS Procedures § 515.803 Customs procedures; merchandise specified in § 515.204. (a) With... thereto) whether or not such merchandise has been imported into the United States, collectors of...

  5. 31 CFR 500.803 - Customs procedures; merchandise specified in § 500.204.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Customs procedures; merchandise... CONTROL REGULATIONS Procedures § 500.803 Customs procedures; merchandise specified in § 500.204. (a) With... United States, directors of customs shall not accept or allow any: (1) Entry for consumption...

  6. 20 CFR 652.204 - Must funds authorized under section 7(b) of the Act (the Governor's reserve) flow through the One...

    Science.gov (United States)

    2010-04-01

    ... the Act (the Governor's reserve) flow through the One-Stop delivery system? 652.204 Section 652.204... § 652.204 Must funds authorized under section 7(b) of the Act (the Governor's reserve) flow through the One-Stop delivery system? No, these funds are reserved for use by the Governor for the...

  7. miR-204 downregulates EphB2 in aging mouse hippocampal neurons.

    Science.gov (United States)

    Danka Mohammed, Chand Parvez; Rhee, Hwanseok; Phee, Bong-Kwan; Kim, Kunhyung; Kim, Hee-Jin; Lee, Hyehyeon; Park, Jung Hoon; Jung, Jung Hee; Kim, Jeong Yeon; Kim, Hyoung-Chin; Park, Sang Ki; Nam, Hong Gil; Kim, Keetae

    2016-04-01

    Hippocampal synaptic function and plasticity deteriorate with age, often resulting in learning and memory deficits. As MicroRNAs (miRNAs) are important regulators of neuronal protein expression, we examined whether miRNAs may contribute to this age-associated decline in hippocampal function. We first compared the small RNA transcriptome of hippocampal tissues from young and old mice. Among 269 hippocampal miRNAs, 80 were differentially expressed (≥ twofold) among the age groups. We focused on 36 miRNAs upregulated in the old mice compared with those in the young mice. The potential targets of these 36 miRNAs included 11 critical Eph/Ephrin synaptic signaling components. The expression levels of several genes in the Eph/Ephrin pathway, including EphB2, were significantly downregulated in the aged hippocampus. EphB2 is a known regulator of synaptic plasticity in hippocampal neurons, in part by regulating the surface expression of the NMDA receptor NR1 subunit. We found that EphB2 is a direct target of miR-204 among miRNAs that were upregulated with age. The transfection of primary hippocampal neurons with a miR-204 mimic suppressed both EphB2 mRNA and protein expression and reduced the surface expression of NR1. Transfection of miR-204 also decreased the total expression of NR1. miR-204 induces senescence-like phenotype in fully matured neurons as evidenced by an increase in p16-positive cells. We suggest that aging is accompanied by the upregulation of miR-204 in the hippocampus, which downregulates EphB2 and results in reduced surface and total NR1 expression. This mechanism may contribute to age-associated decline in hippocampal synaptic plasticity and the related cognitive functions. PMID:26799631

  8. Activity standardisation of 45Ca and 204Tl using the new TDCR system at CMI

    International Nuclear Information System (INIS)

    A new triple-to-double coincidence ratio (TDCR) system has been established at CMI as an additional technique for primary activity standardisation. Details of the detectors and the electronics are given. Construction of the optical chamber was validated using measurement of a 3H standard—the efficiency achieved with Ultima Gold was 58%. Several methods of efficiency variation (coloured bands painted on vial, positioning and photomultipliers defocussing) are compared. Activity concentrations of 204Tl and 45Ca were determined with the TDCR method and with the efficiency tracer technique. Advantages of the TDCR method compared to the efficiency tracing method and agreement between results are shown. - Highlights: ► The new TDCR system was constructed and verified at CMI. ► Maximum detection efficiency was 58% for H-3. ► Consistent results for Tl-204, Ca-45 with ∼50% lower uncertainty than the tracer method.

  9. Variable Star Status of Two Stars: V204 and I-I-39 in M3

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The star I-I-42 (=vZ1390), a cluster member in M3, located near the red edge of the instability strip of the horizontal branch, was discovered by Roberts and Sandage as a low amplitude variable, it was designated as V204 in the "second catalogue of variable stars in globular clusters", but its coordinates given in all versions of this catalogue are wrong since 1955. We argue that V204 is indeed a low amplitude HB variable star, located near to the red edge of the instability strip, with a period of 0.74785d and an amplitude of about 0.04 mag in V. We also find that the red cluster member star I-I-39 is a low amplitude variable with a period of 1.16d and amplitude of about 0.03 mag in V which might be pulsating at the second overtone.

  10. 41 CFR 101-27.204 - Types of shelf-life items.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Types of shelf-life items...-Management of Shelf-Life Materials § 101-27.204 Types of shelf-life items. Shelf-life items are classified as nonextendable (Type I) and extendable (Type II). Type I items have a definite storage life after which the...

  11. Radiochemical separation of carrier free 204,206Bi from α-irradiated thallium oxide target

    International Nuclear Information System (INIS)

    Carrier-free 204,206Bi produced by the α-activation of Tl2O3 target, was separated from the target matrix using two different radiochemical methods, (i) liquid-liquid extraction (LLX) with methyl isobutyl ketone (MIBK)-HCl system and (ii) solid-liquid extraction with inorganic ion exchanger, zirconium vanadate from HCl medium. The separation was found to be maximum around pH 2. (author)

  12. Neutron inelastic scattering studies for lead-204. [Threshold energy to 10 MeV, transitions, cross sections, angular distributions

    Energy Technology Data Exchange (ETDEWEB)

    Smith, D.L.; Meadows, J.W.

    1977-12-01

    A 9.57-g sample of lead metal, enriched to 99.7 percent /sup 204/Pb, was used in an investigation of neutron inelastic scattering from this rare isotope at the Argonne National Laboratory Fast-Neutron Generator Facility. Neutron excitation of the 66.9-m isomeric state at 2.186 MeV in /sup 204/Pb was measured from near threshold to approximately 10 MeV using activation techniques. Cross sections and a value for the isomeric half life were derived from these data. Time-of-flight techniques were employed to measure spectra of promptly-emitted gamma rays from the /sup 204/Pb(n;n',..gamma..)/sup 204/Pb reaction at neutron energies less than or equal to 3 MeV. Cross sections and angular distributions were derived from these data for several of the stronger transitions. Other available fast-neutron data for this isotope are reviewed briefly.

  13. Neutron capture at the s-process branching points $^{171}$Tm and $^{204}$Tl

    CERN Multimedia

    Branching points in the s-process are very special isotopes for which there is a competition between the neutron capture and the subsequent b-decay chain producing the heavy elements beyond Fe. Typically, the knowledge on the associated capture cross sections is very poor due to the difficulty in obtaining enough material of these radioactive isotopes and to measure the cross section of a sample with an intrinsic activity; indeed only 2 out o the 21 ${s}$-process branching points have ever been measured by using the time-of-flight method. In this experiment we aim at measuring for the first time the capture cross sections of $^{171}$Tm and $^{204}$Tl, both of crucial importance for understanding the nucleosynthesis of heavy elements in AGB stars. The combination of both (n,$\\gamma$) measurements on $^{171}$Tm and $^{204}$Tl will allow one to accurately constrain neutron density and the strength of the 13C(α,n) source in low mass AGB stars. Additionally, the cross section of $^{204}$Tl is also of cosmo-chrono...

  14. 45-day safety screen results for tank 241-U-204, push mode, cores 81 and 82

    International Nuclear Information System (INIS)

    This is the 45-Day report for the fiscal year 1995 tank 241-U-204 (U-204) push-mode characterization effort. Included are a summary of analytical results and copies of the differential scanning calorimetry (DSC) and thermogravimetric analysis (TGA) scans. Core samples 81 and 82 from tank U-204, obtained by the push-mode core sampling method, were received by the 222-S Laboratories. Each core consisted of only one segment. Both core samples and the field blank were extruded, subsampled, and analyzed in accordance with Reference 1. Drainable liquids and the field blank were analyzed at the segment level for energetics by DSC, percent water by TGA, and total organic carbon (TOC) by furnace oxidation. In addition, the presence or absence of any separable, presumably organic, layer in drainable liquid samples was noted and none was observed. The solids were analyzed directly at the half segment level for energetics by DSC, percent water by TGA, and TOC by persulfate oxidation. Total alpha activity was determined on fusion digestions of the sludge subsamples. No immediate notifications were necessary on samples from cores 81 or 82

  15. M5640+P204+P507萃取净化镍电解液%Nickel Sulphate Electrolyte Extraction Purified by M5640+P204+P507

    Institute of Scientific and Technical Information of China (English)

    李学鹏

    2011-01-01

    The extraction purification of nickel sulphate electrolyte was studied. M5640 was used to remove Cu2+. The extraction rate was higher than 99. 83% and the content of Cu2+ was lower than 0. 1 mg/L on the conditions including pH = 3. 0, O/A=l/1, volume concentration of M5640 to be 15%, and the reaction time as 2 min. Then, P204 was used to remove other impurities. The conditions included pH = 4. 0, O/A=2/1, volume concentration of P204 to be 25%, and reaction time as 7 min. At last, raffinate was purified with P507 on the following conditions that 75 % P507 was saponificated by sodium hydroxide solution, the concentration of Co2+ was increased to 4. 19 g/L (Co/Ni=l/10), pH = 4~5 and extraction series was 4. The final raffinate can satisfied the standard of 5N nickel.%对硫酸镍电解液的萃取净化除杂进行了系统研究.采用M5640对铜离子进行除杂的条件为:pH3.0,相比1∶1,萃取剂体积浓度15%,振荡时间5 min,在此条件下铜离子的萃取率大于99.83%,萃余液含铜已达到5N镍电解液标准要求.去除铜离子之后,采用P204对电解液进行除杂,试验条件:pH4.0,相比2∶1,萃取剂体积浓度25%,振荡时间7 min,温度20℃.萃余液再用P507萃取除杂,试验条件:用氢氧化钠溶液均相制皂75%,提高待萃液当中钴离子的含量至4.19 g/L,即Co/Ni为1/10,4级萃取,控制水相pH 4~5.副终萃余液中各杂质离子的含量均达到生产5N镍的电解液标准.

  16. Identification of ML204, a Novel Potent Antagonist That Selectively Modulates Native TRPC4/C5 Ion Channels*

    Science.gov (United States)

    Miller, Melissa; Shi, Jie; Zhu, Yingmin; Kustov, Maksym; Tian, Jin-bin; Stevens, Amy; Wu, Meng; Xu, Jia; Long, Shunyou; Yang, Pu; Zholos, Alexander V.; Salovich, James M.; Weaver, C. David; Hopkins, Corey R.; Lindsley, Craig W.; McManus, Owen; Li, Min; Zhu, Michael X.

    2011-01-01

    Transient receptor potential canonical (TRPC) channels are Ca2+-permeable nonselective cation channels implicated in diverse physiological functions, including smooth muscle contractility and synaptic transmission. However, lack of potent selective pharmacological inhibitors for TRPC channels has limited delineation of the roles of these channels in physiological systems. Here we report the identification and characterization of ML204 as a novel, potent, and selective TRPC4 channel inhibitor. A high throughput fluorescent screen of 305,000 compounds of the Molecular Libraries Small Molecule Repository was performed for inhibitors that blocked intracellular Ca2+ rise in response to stimulation of mouse TRPC4β by μ-opioid receptors. ML204 inhibited TRPC4β-mediated intracellular Ca2+ rise with an IC50 value of 0.96 μm and exhibited 19-fold selectivity against muscarinic receptor-coupled TRPC6 channel activation. In whole-cell patch clamp recordings, ML204 blocked TRPC4β currents activated through either μ-opioid receptor stimulation or intracellular dialysis of guanosine 5′-3-O-(thio)triphosphate (GTPγS), suggesting a direct interaction of ML204 with TRPC4 channels rather than any interference with the signal transduction pathways. Selectivity studies showed no appreciable block by 10–20 μm ML204 of TRPV1, TRPV3, TRPA1, and TRPM8, as well as KCNQ2 and native voltage-gated sodium, potassium, and calcium channels in mouse dorsal root ganglion neurons. In isolated guinea pig ileal myocytes, ML204 blocked muscarinic cation currents activated by bath application of carbachol or intracellular infusion of GTPγS, demonstrating its effectiveness on native TRPC4 currents. Therefore, ML204 represents an excellent novel tool for investigation of TRPC4 channel function and may facilitate the development of therapeutics targeted to TRPC4. PMID:21795696

  17. Networking automation of ECI’s G-204 electronic engineering laboratory

    Directory of Open Access Journals (Sweden)

    Hernán Paz Penagos

    2010-04-01

    Full Text Available Increased use (by students and teachers of the “Escuela Colombiana de Ingeniería Julio Garavito” Electronic Engineering laboratories during the last year has congested access to these laboratories; the School’s Electronic Engineering (Ecitronica programme’s applied Electronic studies’ centre research group thus proposed, designed and developed a research prolect taking advantage of G building’s electrical distribution to offer access facilities, laboratory equipment control, energy saving and improved service quality. The G-204 laboratory’s network sys- tem will have an access control subsystem with client–main computer architecture. The latter consists of a user, schedule, group and work-bank database; the user is connected from any computer (client to the main computer through Internet to reserve his/her turn at laboratory practice by selecting the schedule, group, work-bank, network type required (1Ф or 3Ф and registering co-workers. Access to the G-204 laboratory on the day and time of practice is made by means of an intelligent card reader. Information of public interest produced and controlled by the main computer is displayed on three LCD screens located on one of G building’s second floor walls, as is an electronic clock. The G-204 laboratory temperature and time are continually updated. Work-banks are enabled or disabled by the main computer; the work banks are provided with power (beginning of practice or disconnected (end of practice or due to eventualities to protect the equipment, save energy, facilitate monitors and supervise the logistics of the state of the equipment at the end of each practice. The research group was organised into Transmission Line and Applications sub-groups. Power Line Communications PLC technology was used for to exploring digital modulation alternatives, coding and detecting errors, coupling, data transmission protocols and new applications, all based on channel estimation (networking

  18. Yeast Interacting Proteins Database: YPL204W, YHR185C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YPL204W HRR25 Protein kinase involved in regulating diverse events including vesicu...cription Protein kinase involved in regulating diverse events including vesicular traffickin...PD) 0 Co-induced by (YPD) - Co-repressed by (YPD) - Not affected by(YPD) - Interologs - Expression similarity (BRITE) - Alternative... path with 1 intervening protein (YPD) 0 Alternative path with 2 intervening proteins (YPD) 0 IST hit 6 IST hit in the opposite bait/prey orientation - ... ... functionality of all four spindle pole bodies during meiosis II; not required for meiotic rec

  19. Yeast Interacting Proteins Database: YPL204W, YOL149W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YPL204W HRR25 Protein kinase involved in regulating diverse events including vesicu...tion Protein kinase involved in regulating diverse events including vesicular trafficking, DNA repair, and c...1p-Dcp2p decapping enzyme complex, which removes the 5' cap structure from mRNAs prior to their degradation; enhances the activ... by (YPD) - Not affected by(YPD) - Interologs - Expression similarity (BRITE) - Alternative path with 1 interve...Subunit of the Dcp1p-Dcp2p decapping enzyme complex, which removes the 5' cap str

  20. Yeast Interacting Proteins Database: YPL204W, YER095W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YPL204W HRR25 Protein kinase involved in regulating diverse events including vesicu... gene name HRR25 Bait description Protein kinase involved in regulating diverse events including vesicular t...d in the recombinational repair of double-strand breaks in DNA during vegetative growth and me...in the recombinational repair of double-strand breaks in DNA during vegetative growth and meiosis; homolog o...sion similarity (BRITE) - Alternative path with 1 intervening protein (YPD) 0 Alternative path with 2 interve

  1. Residual Waste from Hanford Tanks 241-C-203 and 241-C-204. 2. Contaminant Release Model

    International Nuclear Information System (INIS)

    Fusion analyses, water leaches, selective extractions, empirical solubility measurements, and thermodynamic modeling were used with results from solid-phase characterization studies [see companion paper (1)] to determine total concentrations, contaminant-phase associations, and develop contaminant release models for residual sludge from single-shell underground waste tanks 241-C-203 and 241-C-204 at the U.S. Department of Energy?s Hanford Site in southeastern Washington state. U and Tc are primary contaminants of concern because of their long half-lives and their generally high mobility in oxidizing soil and groundwater environments. Uranium release was determined to be controlled by two phases; ?ejkaite [Na4(UO2)(CO3)3] and poorly crystalline Na2U2O7 [or clarkeite Na[(UO2)O(OH)](H2O)0-1] which were identified in C-203 and C-204 sludge samples (1). U release was determined to occur in three stages from these phases. In the first stage, U release will be controlled by the solubility of ?ejkaite, which is suppressed by high concentrations of sodium released from dissolution of NaNO3 in the residual sludges. Equilibrium solubility calculations indicate the U released during this stage will have a maximum concentration of 0.021 M. When all the NaNO3 has dissolved from the sludge, the solubility of the remaining ?ejkaite will increase to 0.28 M. After ?ejkaite has completely dissolved, the maximum concentration of U released is expected to be controlled by the solubility of Na2U2O7 at a concentration of 3.0 ? 10-5 M. For Tc, a significant fraction of its concentration in the residual sludge was determined to be relatively insoluble (20 wt% for C-203 and 80 wt% for C-204). Because of the low concentrations of Tc in these sludge materials, the characterization studies did not identify any discrete Tc solids phases. Therefore, release of the readily soluble fraction of Tc was assumed to be controlled by the solubility of NaTcO4 at 7.1 M. Selective extraction results

  2. Acondicionamiento y mejora de la carretera M-204 tramo: Tielmes-Carabaña (Madrid)

    OpenAIRE

    García Flores, Miguel

    2013-01-01

    El proyecto estudia un tramo de la carretera M-204 de la red secundaria del territorio español, perteneciente a la Comunidad Autónoma de Madrid, en el sureste de ésta y en concreto se encuentra entre los términos municipales de Tielmes y Carabaña. Discurre por la vega del río Tajuña con una trayectoria sensiblemente paralela al cauce. Se sitúa entre dos pequeños sistemas de montañas y su trazado divide al paisaje en dos. Se ha realizado un Estudio Previo de Soluciones para poder determinar qu...

  3. Activity standardisation of 45Ca and 204Tl using the new TDCR system at CMI.

    Science.gov (United States)

    Sochorová, Jana; Auerbach, Pavel; Dutka, Zdeněk

    2012-09-01

    A new triple-to-double coincidence ratio (TDCR) system has been established at CMI as an additional technique for primary activity standardisation. Details of the detectors and the electronics are given. Construction of the optical chamber was validated using measurement of a (3)H standard-the efficiency achieved with Ultima Gold was 58%. Several methods of efficiency variation (coloured bands painted on vial, positioning and photomultipliers defocussing) are compared. Activity concentrations of (204)Tl and (45)Ca were determined with the TDCR method and with the efficiency tracer technique. Advantages of the TDCR method compared to the efficiency tracing method and agreement between results are shown. PMID:22476016

  4. The Mouse Clock Locus: Sequence and Comparative Analysis of 204 Kb from Mouse Chromosome 5

    OpenAIRE

    Wilsbacher, Lisa D.; Sangoram, Ashvin M.; Antoch, Marina P.; Takahashi, Joseph S.

    2000-01-01

    The Clock gene encodes a basic helix-loop-helix (bHLH)–PAS transcription factor that regulates circadian rhythms in mice. We previously cloned Clock in mouse and human using a battery of behavioral and molecular techniques, including shotgun sequencing of two bacterial artificial chromosome (BAC) clones. Here we report the finished sequence of a 204-kb region from mouse chromosome 5. This region contains the complete loci for the Clock and Tpardl (pFT27) genes, as well as the 3′ partial locus...

  5. The critical release rates for the dissociating gas N204/N02/N0

    International Nuclear Information System (INIS)

    Dissociating vapour systems have certain characteristics which make them attractive as coolants, notably a large effective specific heat which is significantly greater than that for the individual components of the gas mixture, and also an enhanced boundary layer heat transfer coefficient resulting from the physical characteristics of thermal dissociation. In part these effects ensure that a dissociating gas has a greatly improved thermal capacity and heat transfer capability when compared with most inert gases. In this report the critical release rates for the dissociating vapour system N204-N02-N0 are established, principally in the two phase region, and the thermodynamics of nitrogen tetroxide are examined. (U.K.)

  6. 42 CFR 495.204 - Incentive payments to qualifying MA organizations for MA-EPs and MA-affiliated eligible hospitals.

    Science.gov (United States)

    2010-10-01

    ... CERTIFICATION STANDARDS FOR THE ELECTRONIC HEALTH RECORD TECHNOLOGY INCENTIVE PROGRAM Requirements Specific to Medicare Advantage (MA) Organizations § 495.204 Incentive payments to qualifying MA organizations for...

  7. Astatination of closo-dodecaborate(2-) anion

    Czech Academy of Sciences Publication Activity Database

    Orlova, A.; Lebeda, Ondřej; Tolmachev, V.; Lundquist, H.; Carlsson, J.; Sjöberg, S.

    Cambridge : The Royal Society of Chemistry , 2000 - (Davidson, M.; Hughes, A.; Marder, T.; Wade , K.), s. 144-147 [Conference "Contemporary Boron Chemistry ". Durham (GB), 11.07.1999-15.07.1999] Institutional research plan: CEZ:AV0Z1048901 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  8. Corrective Action Decision Document for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada, Rev. No. 0

    Energy Technology Data Exchange (ETDEWEB)

    Robert Boehlecke

    2004-04-01

    The six bunkers included in CAU 204 were primarily used to monitor atmospheric testing or store munitions. The ''Corrective Action Investigation Plan (CAIP) for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada'' (NNSA/NV, 2002a) provides information relating to the history, planning, and scope of the investigation; therefore, it will not be repeated in this CADD. This CADD identifies potential corrective action alternatives and provides a rationale for the selection of a recommended corrective action alternative for each CAS within CAU 204. The evaluation of corrective action alternatives is based on process knowledge and the results of investigative activities conducted in accordance with the CAIP (NNSA/NV, 2002a) that was approved prior to the start of the Corrective Action Investigation (CAI). Record of Technical Change (ROTC) No. 1 to the CAIP (approval pending) documents changes to the preliminary action levels (PALs) agreed to by the Nevada Division of Environmental Protection (NDEP) and DOE, National Nuclear Security Administration Nevada Site Office (NNSA/NSO). This ROTC specifically discusses the radiological PALs and their application to the findings of the CAU 204 corrective action investigation. The scope of this CADD consists of the following: (1) Develop corrective action objectives; (2) Identify corrective action alternative screening criteria; (3) Develop corrective action alternatives; (4) Perform detailed and comparative evaluations of corrective action alternatives in relation to corrective action objectives and screening criteria; and (5) Recommend and justify a preferred corrective action alternative for each CAS within CAU 204.

  9. Analysis of test result for 204 brucellosis cases%204例布氏杆菌病实验室检测结果分析

    Institute of Scientific and Technical Information of China (English)

    宋耀丽; 张俊杰; 牛国永; 刘伟伟

    2015-01-01

    Objective Based on the result of laboratory test, the diagnosis for brucelosis was determined, in order to sup-port of trend prediction and making control measures for brucelosis.Methods According to the experimental diagnostic criteria for brucellosis, the combined detection of tiger red plate agglutination test ( RBPT) and serum agglutination test ( SAT) was performed in detection of brucella antibody on infected cases, suspected cases and related conective individu-als.Results The brucella antibody were detected in 204 cases among all of 470 subjects,with a positive rate 43.4%. Among the brucellosis cases, the ratio of male to female was 1.62 ∶1, cases in 40 to 69 years age accounted for 75.49%, farmers accounted for 40.69%, slaughter workers accounted for 32.35%.Conclusions It is to strengthen control brucel-losis measures to the individuals engaged in aquaculture and animal husbandry, and improve their awareness of self-protec-tion.%目的:通过实验室检测,发现布氏杆菌感染者,掌握疫情动态,为预测布氏杆菌病流行趋势、制订防治对策提供依据。方法根据布氏杆菌病实验室诊断标准,利用虎红平板凝集试验(RBPT)和试管凝集试验(SAT)相结合的试验方法,对布氏杆菌病疑似病例和有接触史等的人员进行布氏杆菌抗体检测。结果在470例监测对象中,布氏杆菌抗体阳性病例204例,阳性率43.4%。在阳性病例中,男女性别比为1.62∶1;40~69岁年龄组占75.49%;畜牧养殖人员占40.69%,屠宰作业者占32.35%。结论应加强对养殖业和畜牧业人员的预防控制工作,提高其自我防护意识。

  10. Emergence of ST147 Klebsiella pneumoniae Producing OXA-204 Carbapenemase in a University Hospital, Tunisia.

    Science.gov (United States)

    Grami, Raoudha; Mansour, Wejdene; Ben Haj Khalifa, Anis; Dahmen, Safia; Chatre, Pierre; Haenni, Marisa; Aouni, Mahjoub; Madec, Jean-Yves

    2016-03-01

    Molecular features of the first carbapenem-resistant Klebsiella pneumoniae isolates (KP1 and KP2) from the University Hospital Tahar Sfar, Tunisia, were investigated. Antimicrobial susceptibility testing, multilocus sequence typing, S1 nuclease pulsed-field gel electrophoresis, Southern blot, and polymerase chain reaction (PCR)-based replicon typing were performed. Extended-spectrum β-lactamases and carbapenemase genes were detected by PCR and sequencing. Both isolates were multidrug resistant. KP1 was of sequence type (ST) ST101 and exhibited blaCTX-M-15 and blaTEM-1 on an untypeable plasmid and blaOXA-48 on an IncL/M plasmid. KP2 was genetically unrelated to KP1 (ST147) and harbored an IncA/C plasmid carrying blaCMY-4 and the blaOXA-48 derivative gene: blaOXA-204. This study reports the second case worldwide of an OXA-204-producing K. pneumoniae isolate from the same country, however, in a different genetic background. PMID:26447939

  11. 45-day safety screen results for tank 241-C-204, auger samples 95-Aug-022 and 95-Aug-023

    International Nuclear Information System (INIS)

    Two auger samples from tank 241-C-204 (C-204) were received at the 222-S Laboratories and underwent safety screening analysis, consisting of differential scanning calorimetry (DSC), thermogravimetric analysis (TGA), and total alpha activity. The three samples submitted to energetics determination by DSC exceeded the notification limit. As required by the Tank Characterization Plan, the appropriate notifications were made within 24 hours of official confirmation that the limit was exceeded. Secondary analyses have been initiated. Results from secondary analyses will be included in a revision to this report

  12. 41 CFR 302-4.204 - If my spouse does not accompany me but travels unaccompanied at a different time, what per diem...

    Science.gov (United States)

    2010-07-01

    ... accompany me but travels unaccompanied at a different time, what per diem rate will he/she receive? 302-4.204 Section 302-4.204 Public Contracts and Property Management Federal Travel Regulation System... my spouse does not accompany me but travels unaccompanied at a different time, what per diem...

  13. MicroRNA-204 modulates colorectal cancer cell sensitivity in response to 5-fluorouracil-based treatment by targeting high mobility group protein A2.

    Science.gov (United States)

    Wu, Haijun; Liang, Yu; Shen, Lin; Shen, Liangfang

    2016-01-01

    MicroRNAs (miRNAs) are a conserved class of ∼22 nucleotide RNAs that playing important roles in various biological processes including chemoresistance. Recently, many studies have revealed that miR-204 is significantly attenuated in colorectal cancer (CRC), suggesting that this miRNA may have a function in CRC. However, whether miR-204 modulates chemosensitivity to 5-fluorouracil (5-Fu) in colorectal cancer is still unclear. In our present study, we discuss this possibility and the potential mechanism exerting this effect. We identified high mobility group protein A2 (HMGA2) as a novel direct target of miR-204 and showed that miR-204 expression was decreased while HMGA2 expression was increased in CRC cell lines. Additionally, both MiR-204 overexpression and HMGA2 inhibition attenuated cell proliferation, whereas forced expression of HMGA2 partly restored the inhibitory effect of miR-204 on HCT116 and SW480 cells. Moreover, the miR-204/HMGA2 axis modulated the resistance of tumor cells to 5-Fu in HCT-116 and SW480 colon cancer cells via activation of the PI3K/AKT pathway. These results demonstrate that the miR-204/HMGA2 axis could play a vital role in the 5-Fu resistance of colon cancer cells. Taken together, our present study elucidated that miR-204 upregulated 5-Fu chemosensitivity via the downregulation of HMGA2 in colorectal cancer and provided significant insight into the mechanism of 5-Fu resistance in colorectal cancer patients. More importantly, our present study suggested that miR-204 has potential as a therapeutic strategy for 5-Fu-resistant colorectal cancer. PMID:27095441

  14. MicroRNA-204 modulates colorectal cancer cell sensitivity in response to 5-fluorouracil-based treatment by targeting high mobility group protein A2

    Directory of Open Access Journals (Sweden)

    Haijun Wu

    2016-05-01

    Full Text Available MicroRNAs (miRNAs are a conserved class of ∼22 nucleotide RNAs that playing important roles in various biological processes including chemoresistance. Recently, many studies have revealed that miR-204 is significantly attenuated in colorectal cancer (CRC, suggesting that this miRNA may have a function in CRC. However, whether miR-204 modulates chemosensitivity to 5-fluorouracil (5-Fu in colorectal cancer is still unclear. In our present study, we discuss this possibility and the potential mechanism exerting this effect. We identified high mobility group protein A2 (HMGA2 as a novel direct target of miR-204 and showed that miR-204 expression was decreased while HMGA2 expression was increased in CRC cell lines. Additionally, both MiR-204 overexpression and HMGA2 inhibition attenuated cell proliferation, whereas forced expression of HMGA2 partly restored the inhibitory effect of miR-204 on HCT116 and SW480 cells. Moreover, the miR-204/HMGA2 axis modulated the resistance of tumor cells to 5-Fu in HCT-116 and SW480 colon cancer cells via activation of the PI3K/AKT pathway. These results demonstrate that the miR-204/HMGA2 axis could play a vital role in the 5-Fu resistance of colon cancer cells. Taken together, our present study elucidated that miR-204 upregulated 5-Fu chemosensitivity via the downregulation of HMGA2 in colorectal cancer and provided significant insight into the mechanism of 5-Fu resistance in colorectal cancer patients. More importantly, our present study suggested that miR-204 has potential as a therapeutic strategy for 5-Fu-resistant colorectal cancer.

  15. Breakup mechanisms for 7Li + 197Au, 204Pb systems at sub-barrier energies

    Directory of Open Access Journals (Sweden)

    Luong D.H.

    2013-12-01

    Full Text Available Coincidence measurements of breakup fragments were carried out for the 7Li + 197Au and 204Pb systems at sub-barrier energies. The mechanisms triggering breakup, and time-scales of each process, were identified through the reaction Q-values and the relative energy of the breakup fragments. Binary breakup of 7Li were found to be predominantly triggered by nucleon transfer, with p-pickup leading to 8Be → α + α decay being the preferred breakup mode. From the time-scales of each process, the coincidence yields were separated into prompt and delayed components, allowing the identification of breakup process important in the suppression of complete fusion of 7Li at above-barrier energies.

  16. 20 CFR 718.204 - Total disability and disability causation defined; criteria for determining total disability and...

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Total disability and disability causation defined; criteria for determining total disability and total disability due to pneumoconiosis. 718.204... MINE HEALTH AND SAFETY ACT OF 1969, AS AMENDED STANDARDS FOR DETERMINING COAL MINERS' TOTAL...

  17. 14 CFR 204.6 - Certificated and commuter air carriers proposing a change in operations, ownership, or management...

    Science.gov (United States)

    2010-01-01

    ... carriers proposing a change in operations, ownership, or management which is not substantial. Carriers proposing to make a change which would not substantially affect their operations, management, or ownership... proposing a change in operations, ownership, or management which is not substantial. 204.6 Section...

  18. Distinction of [220] and [204] textures of Cu(In,Ga)Se{sub 2} film and their growth behaviors depending on substrate nature and Na incorporation

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Dae-Hyung, E-mail: dhcho@etri.re.kr [IT Components and Materials Industry Technology Research Department, Electronics and Telecommunications Research Institute (ETRI), 218 Gajeongno, Yuseong-gu, Daejeon 305-700 (Korea, Republic of); Kim, Jeha [Department of Solar & Energy Engineering, Cheongju University, 298 Daeseongro, Sangdang-gu, Cheongju, Chungbuk 360-764 (Korea, Republic of); Chung, Yong-Duck [IT Components and Materials Industry Technology Research Department, Electronics and Telecommunications Research Institute (ETRI), 218 Gajeongno, Yuseong-gu, Daejeon 305-700 (Korea, Republic of); Korea University of Science and Technology (UST), 217 Gajeongno, Yuseong-gu, Daejeon 305-350 (Korea, Republic of)

    2015-08-31

    For better understanding of the structural property of polycrystalline tetragonal Cu(In,Ga)Se{sub 2} (CIGS) thin films grown on soda-lime glass, it is necessary to characterize the [220]- and [204]-oriented textures clearly that are related to the different physical properties. However, the distinction between the [220]- and [204]-oriented textures is very difficult because of their nearly identical plane spacings and atomic arrangements. Using X-ray diffraction techniques of high resolution θ–2θ scanning and reciprocal space mapping, we distinguished the [220]- and [204]-oriented textures of CIGS films and observed that the behaviors of [220] and [204] textures independently depended on both substrate nature and Na presence. We report the Na- and substrate-related dependence of the physical properties of the CIGS film was attributed to the independent growth behaviors of the [220] and [204] textures in the CIGS. - Highlights: • We investigated [220]- and [204]-oriented textures of Cu(In,Ga)Se{sub 2} (CIGS) films. • X-ray diffraction methods distinguished two textures. • The growth behaviors were influenced by underlying substrate and Na. • The [220] and [204] textures in CIGS should be differentially observed.

  19. Distinction of [220] and [204] textures of Cu(In,Ga)Se2 film and their growth behaviors depending on substrate nature and Na incorporation

    International Nuclear Information System (INIS)

    For better understanding of the structural property of polycrystalline tetragonal Cu(In,Ga)Se2 (CIGS) thin films grown on soda-lime glass, it is necessary to characterize the [220]- and [204]-oriented textures clearly that are related to the different physical properties. However, the distinction between the [220]- and [204]-oriented textures is very difficult because of their nearly identical plane spacings and atomic arrangements. Using X-ray diffraction techniques of high resolution θ–2θ scanning and reciprocal space mapping, we distinguished the [220]- and [204]-oriented textures of CIGS films and observed that the behaviors of [220] and [204] textures independently depended on both substrate nature and Na presence. We report the Na- and substrate-related dependence of the physical properties of the CIGS film was attributed to the independent growth behaviors of the [220] and [204] textures in the CIGS. - Highlights: • We investigated [220]- and [204]-oriented textures of Cu(In,Ga)Se2 (CIGS) films. • X-ray diffraction methods distinguished two textures. • The growth behaviors were influenced by underlying substrate and Na. • The [220] and [204] textures in CIGS should be differentially observed

  20. Neutron total cross sections of 204Pb, 206Pb, 207Pb and 208Pb and the neutron electric polarizability

    International Nuclear Information System (INIS)

    The neutron total cross sections have been measured for lead isotopes 208Pb, 206Pb and 207Pb in the range from 1 eV to 20 keV and for 204Pb in the range from 1 eV to 100 eV using the time-of-flight facility GNEIS in Gatchina. An accuracy of the measured neutron total cross section (Δσ/σ) is about 10-3 for 208Pb, 10-2 for 206Pb and 207Pb, 5·10-2 for 204Pb. An estimated value of the neutron electric polarizability from analysis of total cross section of 208Pb is αn=(2.4 ± 1.1)·10-3fm3. (author)

  1. Neutron metrology in the HFR. Irradiation of vanadium alloys. Experiment R204-7/8/9 (VABONA)

    International Nuclear Information System (INIS)

    The irradiation experiment R204-7/8/9 is part of a material research program VABONA in which the radiation damage is investigated of different vanadium alloys. The experiment deals with the irradiation of vanadium specimens α-implanted at the cyclotron in Ispra. The irradiation has been performed in a SIENA capsule in the HFR Petten at three different temperatures (873, 973 and 1073 K). The irradiation took place in position C5 during seven HFR operating cycles. The target damage level was 5 dpa (displacements per atom). This report presents the final neutron metrology results obtained from activation monitors in the three specimen holders, coded as R204-7/8/9. Data about the number of displacements per atom are also included. The main results of the thermal and fast neutron fluence measurements are presented. (orig.)

  2. Standardization of radionuclides 45Ca, 137Cs, 204Tl by tracing method using 4πβ-γ coincidence system

    International Nuclear Information System (INIS)

    The procedure followed for the standardization of 45Ca, 137Cs and 204Tl is described. The activity measurements was carried out in a 4πβ-γ coincidence system by the tracing method. The radionuclides chosen as the P-y emitting tracer nuclide were 60Co for the 45Ca and 134Cs for 137Cs and 204TL because their end-point beta-ray energy are close to the respective beta emitters. The radioactive sources were prepared using two different techniques: one was the drops technique and the other was the solution technique. In the drop technique the sources were prepared by dropping directly on the subtract both solutions (tracer and beta pure). In the other technique a solution of tracer plus beta pure was mixed previously before making the radioactive sources. The activities of the radionuclides obtained with these technique were compared and the values are in agreement within the experimental uncertainties. (author)

  3. Evaluation of Energy-Related Inventions Program: An Empirical Analysis of 204 Inventions; TOPICAL

    International Nuclear Information System (INIS)

    This report is an evaluation of the Energy-Related Inventions Program (ERIP). It assess the program's effectiveness and impacts, characterizes participating inventions and inventors, and identifies correlates of successful commercialization in order to suggest possible improvements. Seventy of the 204 ERIP inventions that were studied were successfully introduced into the market, accounting for more than$200M in sales from 1976 through 1984. During 1984, 921 full-time equivalent employees were supported directly by ERIP inventors or their licensees. (Estimates of indirect economic impacts are also contained in the report.) Data on patterns of fund raising clearly show a need for assistance by programs like ERIP. Commercially successful inventors shared several traits. They had less formal education, fewer patents, more work experience in small firms, more outside funding early in their work, more shared responsibility with others for invention development, more management experience, and greater previous experience with starting new businesses. Recommendations are made regarding: (1) priorities for allocating ERIP grants; (2) improved efficiency of the NBS/DOE operations; (3) delivery of technical and commercialization assistance to grant recipients; and (4) further evaluation research

  4. Deep Ly-alpha imaging of two z=2.04 GRB host galaxy fields

    CERN Document Server

    Fynbo, J P U; Thomsen, B; Hjorth, J; Gorosabel, J; Andersen, M I; Egholm, M P; Holland, S; Jensen, B L; Pedersen, H; Weidinger, M

    2002-01-01

    We report on the results of deep narrow-band Ly-alpha, U and I imaging of the fields of two GRBs at z=2.04 (GRB 000301C and GRB 000926). We find that the host galaxy of GRB 000926 is an extended, strong Ly-alpha emitter with a rest-frame equivalent width of 71+20-15 AA. The galaxy consists of two main components and several fainter knots. GRB 000926 occurred in the western component, whereas most of the Ly-alpha luminosity (about 65%) originates in the eastern component. Using archival HST images of the host galaxy we measure the spectral slopes (f_lambda prop. to lambda^beta) of the two components to beta = -2.4+-0.3 (east) and -1.4+-0.2 (west). This implies that both components contain at most small amounts of dust, consistent with the observed strong Ly-alpha emission. The western component has a slightly redder V-I colour than the eastern component, suggesting the presence of at least some dust. We do not detect the host galaxy of GRB 000301C in neither Ly-alpha emission nor in U and I-band images. We inf...

  5. Evaluation of Energy-Related Inventions Program: An Empirical Analysis of 204 Inventions

    Energy Technology Data Exchange (ETDEWEB)

    Brown, M.A.

    1987-01-01

    This report is an evaluation of the Energy-Related Inventions Program (ERIP). It assesses the program's effectiveness and impacts, characterizes participating inventions and inventors, and identifies correlates of successful commercialization in order to suggest possible improvements. Seventy of the 204 ERIP inventions that were studied were successfully introduced into the market, accounting for more than $200M in sales from 1976 through 1984. During 1984, 921 full-time equivalent employees were supported directly by ERIP inventors or their licensees. (Estimates of indirect economic impacts are also contained in the report.) Data on patterns of fund raising clearly show a need for assistance by programs like ERIP. Commercially successful inventors shared several traits. They had less formal education, fewer patents, more work experience in small firms, more outside funding early in their work, more shared responsibility with others for invention development, more management experience, and greater previous experience with starting new businesses. Recommendations are made regarding: (1) priorities for allocating ERIP grants; (2) improved efficiency of the NBS/DOE operations; (3) delivery of technical and commercialization assistance to grant recipients; and (4) further evaluation research.

  6. Ultrasonic examination of the PVRC plates Nos. 50/52, 51/53 and 204

    International Nuclear Information System (INIS)

    The imposed procedure for the ultrasonic examination of the three PVRC plates given to Europe is based on the ASME Boiler and Pressure Vessel Code, Section XI as it applies to a vessel in service and accessible from the outer surface only. This procedure is referred to as the PISC procedure. After one year of use it was modified and remained, until the end of the exercise, characterized by a 50% DAC cut-off. The three plates (50/52, 51/53 and 204) were examined following this procedure by several teams. Results were furnished: - as raw data given by the instrumentation, - as data interpreted by the team. Inspection teams also were allowed to use other procedures which in the report are called alternative procedures. The results of the examination by teams using alternative procedures were given as interpreted data by the team. Those data were corrected and arranged in a data bank on tape and on cards. Full drawings of the teams findings were also produced by the computer for easy understanding and verification of the data. Besides many defects in the welded zones, relevant base-material defects were declared by the teams

  7. A theoretical study of energy spectra and transition probabilities of 200–204Hg isotopes in transitional region of IBM

    International Nuclear Information System (INIS)

    In this paper, by using the SO(6) representation of eigenstates and transitional Interacting Boson Model (IBM) Hamiltonian, the evolution from prolate to oblate shapes along the chain of Hg isotopes is studied. Parameter-free (up to overall scale factors) predictions for spectra and B(E2) transition rates are found to be in good agreement with experimental data for 200–204Hg isotopes which are supported to be located in this transitional region. (author)

  8. Fabry-Perot Kinematics of HH 202, 203-204 in the Orion Nebula Are they part of a Big Bipolar Outflow?

    CERN Document Server

    Rosado, M; Arias, L; Le Coarer, E; Rosado, Margarita; Fuente, Eduardo de la; Arias, Lorena

    2001-01-01

    We present a kinematic study of the Herbig-Haro objects HH 202, 203 and 204 using Halpha and [NII] Fabry-Perot velocity maps. For HH 202 we find new features that could belong to this HH object or that perhaps are associated with an outflow different from HH 202. Because of its high velocity (up to 100 km/seg) this outflow probably can be a HH flow not catalogued previously. Large internal motions are found in the fainter regions of HH 203-204, as well as evidence of transverse density gradients. We show that the apex of HH 204 is the zone of maximum velocity in agreement with bow shock models. From our studies, we find kinematic evidence that suggests that HH 203-204 and HH 202 are part of a single and large (approx 0.55 pc) HH flow.

  9. Corrective Action Decision Document for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada: Revision 0, Including Errata Sheet

    Energy Technology Data Exchange (ETDEWEB)

    U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office

    2004-04-01

    This Corrective Action Decision Document identifies the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office's corrective action alternative recommendation for each of the corrective action sites (CASs) within Corrective Action Unit (CAU) 204: Storage Bunkers, Nevada Test Site (NTS), Nevada, under the Federal Facility Agreement and Consent Order. An evaluation of analytical data from the corrective action investigation, review of current and future operations at each CAS, and a detailed comparative analysis of potential corrective action alternatives were used to determine the appropriate corrective action for each CAS. There are six CASs in CAU 204, which are all located between Areas 1, 2, 3, and 5 on the NTS. The No Further Action alternative was recommended for CASs 01-34-01, 02-34-01, 03-34-01, and 05-99-02; and a Closure in Place with Administrative Controls recommendation was the preferred corrective action for CASs 05-18-02 and 05-33-01. These alternatives were judged to meet all requirements for the technical components evaluated as well as applicable state and federal regulations for closure of the sites and will eliminate potential future exposure pathways to the contaminated media at CAU 204.

  10. Hanford Tanks 241-C-203 and 241-C-204: Residual Waste Contaminant Release Model and Supporting Data

    International Nuclear Information System (INIS)

    This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy

  11. Hanford Tanks 241-C-203 and 241 C 204: Residual Waste Contaminant Release Model and Supporting Data

    International Nuclear Information System (INIS)

    This report was revised in May 2007 to correct 90Sr values in Chapter 3. The changes were made on page 3.9, paragraph two and Table 3.10; page 3.16, last paragraph on the page; and Tables 3.21 and 3.31. The rest of the text remains unchanged from the original report issued in October 2004. This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy.

  12. Hanford Tanks 241-C-203 and 241-C-204: Residual Waste Contaminant Release Model and Supporting Data

    Energy Technology Data Exchange (ETDEWEB)

    Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.

    2004-10-28

    This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy.

  13. Hanford Tanks 241-C-203 and 241 C 204: Residual Waste Contaminant Release Model and Supporting Data

    Energy Technology Data Exchange (ETDEWEB)

    Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.

    2007-05-23

    This report was revised in May 2007 to correct 90Sr values in Chapter 3. The changes were made on page 3.9, paragraph two and Table 3.10; page 3.16, last paragraph on the page; and Tables 3.21 and 3.31. The rest of the text remains unchanged from the original report issued in October 2004. This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy.

  14. Vascular microRNA-204 is remotely governed by the microbiome and impairs endothelium-dependent vasorelaxation by downregulating Sirtuin1.

    Science.gov (United States)

    Vikram, Ajit; Kim, Young-Rae; Kumar, Santosh; Li, Qiuxia; Kassan, Modar; Jacobs, Julia S; Irani, Kaikobad

    2016-01-01

    Gut microbiota promotes atherosclerosis, and vascular endothelial dysfunction, signalled by impaired endothelium-dependent vasorelaxation, is an early marker of atherosclerosis. Here we show that vascular microRNA-204 (miR-204) expression is remotely regulated by the microbiome, and impairs endothelial function by targeting the Sirtuin1 lysine deacetylase (Sirt1). MiR-204 is downregulated, while Sirt1 is upregulated, in aortas of germ-free mice. Suppression of gut microbiome with broad-spectrum antibiotics decreases miR-204, increases Sirt1 and bioavailable vascular nitric oxide, and improves endothelium-dependent vasorelaxation in mouse aortas. Antibiotics curtail aortic miR-204 upregulation, and rescue decline of aortic Sirt1 and endothelium-dependent vasorelaxation, triggered by high-fat diet feeding. Improvement of endothelium-dependent vasorelaxation by antibiotics is lost in mice lacking endothelial Sirt1. Systemic antagonism of miR-204 rescues impaired endothelium-dependent vasorelaxation and vascular Sirt1, and decreases vascular inflammation induced by high-fat diet. These findings reveal a gut microbe-vascular microRNA-Sirtuin1 nexus that leads to endothelial dysfunction. PMID:27586459

  15. Network modeling identifies molecular functions targeted by miR-204 to suppress head and neck tumor metastasis.

    Science.gov (United States)

    Lee, Younghee; Yang, Xinan; Huang, Yong; Fan, Hanli; Zhang, Qingbei; Wu, Youngfei; Li, Jianrong; Hasina, Rifat; Cheng, Chao; Lingen, Mark W; Gerstein, Mark B; Weichselbaum, Ralph R; Xing, H Rosie; Lussier, Yves A

    2010-04-01

    Due to the large number of putative microRNA gene targets predicted by sequence-alignment databases and the relative low accuracy of such predictions which are conducted independently of biological context by design, systematic experimental identification and validation of every functional microRNA target is currently challenging. Consequently, biological studies have yet to identify, on a genome scale, key regulatory networks perturbed by altered microRNA functions in the context of cancer. In this report, we demonstrate for the first time how phenotypic knowledge of inheritable cancer traits and of risk factor loci can be utilized jointly with gene expression analysis to efficiently prioritize deregulated microRNAs for biological characterization. Using this approach we characterize miR-204 as a tumor suppressor microRNA and uncover previously unknown connections between microRNA regulation, network topology, and expression dynamics. Specifically, we validate 18 gene targets of miR-204 that show elevated mRNA expression and are enriched in biological processes associated with tumor progression in squamous cell carcinoma of the head and neck (HNSCC). We further demonstrate the enrichment of bottleneckness, a key molecular network topology, among miR-204 gene targets. Restoration of miR-204 function in HNSCC cell lines inhibits the expression of its functionally related gene targets, leads to the reduced adhesion, migration and invasion in vitro and attenuates experimental lung metastasis in vivo. As importantly, our investigation also provides experimental evidence linking the function of microRNAs that are located in the cancer-associated genomic regions (CAGRs) to the observed predisposition to human cancers. Specifically, we show miR-204 may serve as a tumor suppressor gene at the 9q21.1-22.3 CAGR locus, a well established risk factor locus in head and neck cancers for which tumor suppressor genes have not been identified. This new strategy that integrates

  16. Network modeling identifies molecular functions targeted by miR-204 to suppress head and neck tumor metastasis.

    Directory of Open Access Journals (Sweden)

    Younghee Lee

    2010-04-01

    Full Text Available Due to the large number of putative microRNA gene targets predicted by sequence-alignment databases and the relative low accuracy of such predictions which are conducted independently of biological context by design, systematic experimental identification and validation of every functional microRNA target is currently challenging. Consequently, biological studies have yet to identify, on a genome scale, key regulatory networks perturbed by altered microRNA functions in the context of cancer. In this report, we demonstrate for the first time how phenotypic knowledge of inheritable cancer traits and of risk factor loci can be utilized jointly with gene expression analysis to efficiently prioritize deregulated microRNAs for biological characterization. Using this approach we characterize miR-204 as a tumor suppressor microRNA and uncover previously unknown connections between microRNA regulation, network topology, and expression dynamics. Specifically, we validate 18 gene targets of miR-204 that show elevated mRNA expression and are enriched in biological processes associated with tumor progression in squamous cell carcinoma of the head and neck (HNSCC. We further demonstrate the enrichment of bottleneckness, a key molecular network topology, among miR-204 gene targets. Restoration of miR-204 function in HNSCC cell lines inhibits the expression of its functionally related gene targets, leads to the reduced adhesion, migration and invasion in vitro and attenuates experimental lung metastasis in vivo. As importantly, our investigation also provides experimental evidence linking the function of microRNAs that are located in the cancer-associated genomic regions (CAGRs to the observed predisposition to human cancers. Specifically, we show miR-204 may serve as a tumor suppressor gene at the 9q21.1-22.3 CAGR locus, a well established risk factor locus in head and neck cancers for which tumor suppressor genes have not been identified. This new strategy

  17. 干扰素诱导蛋白p204表达变化对大鼠血管平滑肌细胞增殖及p21表达的影响%Effects of p204 expression on expression of p21 and proliferation of vascular smooth muscle cells in rats

    Institute of Scientific and Technical Information of China (English)

    龙向淑; 吴强; 宋方

    2012-01-01

    目的:观察干扰素诱导蛋白p204对鼠血管平滑肌细胞(VSMCs)增殖及p21表达的影响,探讨p204在VSMCs增殖调控中的作用及可能机制.方法:应用干扰素α(IFN-α)处理和p204基因(Ifi204)的小干扰RNA(siRNA)瞬时干预体外培养的VSMCs,用MTT法测定细胞活力反映细胞增殖,流式细胞仪分析细胞周期,用半定量RT-PCR 法和Western blotting 分别检测p204和p21的mRNA和蛋白表达.结果:IFN-α可诱导鼠VSMCs p204 mRNA和蛋白表达上调,降低VSMCs细胞活力和细胞周期G1/S转换,伴p21 mRNA和蛋白表达上调.转染Ifi204 siRNA可抑制p204和p21表达,提高VSMCs细胞活力和促进细胞周期G1/S转换.结论:p204表达可抑制鼠VSMCs的增殖,该效应可能与激活p21表达有关.%AIM: To observe the effect of interferon - inducible protein 204 ( p204 ) on the expression of p21 and proliferation of vascular smooth muscle cells ( VSMCs ) in rats. METHODS: Interferon alpha ( IFN - a ) and small interference RNA ( siRNA ) targeting p204 gene ( Ifi204 ) was used to intervene cultured VSMCs in vitro instantaneously, then the cell vitality was determined by MTT assay to reflect the cell proliferation. The cell cycle was analyzed by flow cy-tometry. The expression of p204 and p21 at mRNA and protein levels was determined by semi - quantitative RT - PCR and Western blotting. RESULTS: In rat VSMCs, IFN - a. Induced the increase in the expression of p204 at mRNA and protein levels, reduced the cell vitality and the G,/S phase transition, and up - regulated the expression of p21 at mRNA and protein levels. Transfection of Ifi204 siRNA restrained the expression of p204 and p21, increased the cell vitality and promoted the G1 /S phase transition. CONCLUSION: The expression of p204 restrains the proliferation of rat VSMCs, probably by activating the expression of p21.

  18. The effects of a single intravenous injection of novel activin A/BMP-2 (AB204) on toxicity and the respiratory and central nervous systems.

    Science.gov (United States)

    Yoon, Byung-Hak; Lee, Jae Hyup; Na, Kyuheum; Ahn, Chihoon; Cho, Jongho; Ahn, Hyun Chan; Choi, Jungyoun; Oh, Hyosun; Kim, Byong Moon; Choe, Senyon

    2016-07-01

    The purpose of this study was to determine the effects of a single intravenous injection of a novel osteoinductive material, activin A/BMP-2 (AB204), to rodents on toxicity and their respiratory functions and central nervous system (CNS). A single intravenous injection of AB204 was given to Sprague-Dawley (SD) rats in doses of 0, 0.625, 2.5 and 10 mg/kg to observe the mortality rate, the general symptoms for 14 days. The experimental groups were also given 0.2, 0.4 and 0.8 mg/kg of AB204, respectively, and the respiration rate, the tidal volume and the minute volume were measured for 240 min. The experimental groups of imprinting control region (ICR) mice were given a single intravenous injection of 0.2, 0.4 and 0.8 mg/kg of AB204, respectively. Their body temperature was taken and general behaviors were observed to evaluate the effect of AB204 on the CNS for 240 min. The study on toxicity of a single intravenous injection found no death or abnormal symptoms, abnormal findings from autopsy, or abnormal body weight gain or loss in all the experimental groups. No abnormal variation associated with the test substance was observed in the respiration rate, the tidal volume, the minute volume, body temperature or the general behaviors. On the basis of these results, the approximate lethal dose of AB204 for a single intravenous injection exceeds 10 mg/kg for SD rats and a single intravenous injection of ≤0.8 mg/kg AB204 has no effect on their respiratory system for SD rat and no effect on their CNS for ICR mice. PMID:26446865

  19. Cavity residue leucine 95 and channel residues glutamine 204, aspartic acid 211, and phenylalanine 269 of toluene o-xylene monooxygenase influence catalysis.

    Science.gov (United States)

    Kurt, Cansu; Sönmez, Burcu; Vardar, Nurcan; Yanık-Yıldırım, K Cansu; Vardar-Schara, Gönül

    2016-09-01

    Structural analysis of toluene-o-xylene monooxygenase (ToMO) hydroxylase revealed the presence of three hydrophobic cavities, a channel, and a pore leading from the protein surface to the active site. Here, saturation mutagenesis was used to investigate the catalytic roles of alpha-subunit (TouA) second cavity residue L95 and TouA channel residues Q204, D211, and F269. By testing the substrates toluene, phenol, nitrobenzene, and/or naphthalene, these positions were found to influence the catalytic activity of ToMO. Several regiospecific variants were identified from TouA positions Q204, F269, and L95. For example, TouA variant Q204H had the regiospecificity of nitrobenzene changed significantly from 30 to 61 % p-nitrophenol. Interestingly, a combination of mutations at Q204H and A106V altered the regiospecificity of nitrobenzene back to 27 % p-nitrophenol. TouA variants F269Y, F269P, Q204E, and L95D improved the meta-hydroxylating capability of nitrobenzene by producing 87, 85, 82, and 77 % m-nitrophenol, respectively. For naphthalene oxidation, TouA variants F269V, Q204A, Q204S/S222N, and F269T had the regiospecificity changed from 16 to 9, 10, 23, and 25 % 2-naphthol, respectively. Here, two additional TouA residues, S222 and A106, were also identified that may have important roles in catalysis. Most of the isolated variants from D211 remained active, whereas having a hydrophobic residue at this position appeared to diminish the catalytic activity toward naphthalene. The mutational effects on the ToMO regiospecificity described here suggest that it is possible to further fine tune and engineer the reactivity of multicomponent diiron monooxygenases toward different substrates at positions that are relatively distant from the active site. PMID:27311562

  20. Completion Report for Well ER-20-4 Corrective Action Units 101 and 102: Central and Western Pahute Mesa

    Energy Technology Data Exchange (ETDEWEB)

    NSTec Environmental Management

    2011-04-30

    Well ER-20-4 was drilled for the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office in support of the Nevada Environmental Restoration Project at the Nevada National Security Site, Nye County, Nevada. The well was drilled in August and September 2010 as part of the Pahute Mesa Phase II drilling program. The primary purpose of the well was to investigate the possibility of radionuclide transport from up-gradient underground nuclear tests conducted in central Pahute Mesa. This well also provided detailed hydrogeologic information in the Tertiary volcanic section that will help reduce uncertainties within the Pahute Mesa-Oasis Valley hydrostratigraphic framework model.

  1. Character of HBV (hepatitis B virus) polymerase gene rtM204V/I and rtL180M mutation in patients with lamivudine resistance

    Institute of Scientific and Technical Information of China (English)

    LI Min-wei; HOU Wei; WO Jian-er; LIU Ke-zhou

    2005-01-01

    Objectives: To investigate the relationship between HBV (hepatitis B virus) polymerase gene 180 and 204 sites mutation and lamivudine resistance. Methods: One hundred forty-one patients with lamivudine resistance after lamivudine treatment and 60 chronic hepatitis B patients without lamivudine treatment were enrolled in this study. The serum HBV DNA mutation was analyzed by sequence detection via polymerase chain reaction (PCR). The sequences of the same patient were analyzed before and after lamivudine treatment. Results: One hundred and nine lamivudine resistance patients had HBV YMDD (tyrosine-methionine-aspartate-aspartate) mutation. Among them, 45 patients had rtL 180M/M204V mutation (41.28%), 28patients had rtL180M/M204I mutation (25.70%) and 36 patients had rtM204I mutation (33.02%). There were 6 patients with rtL180M mutation in 32 lamivudine resistance patients. Sixty chronic hepatitis patients without lamivudine treatment had no mutations. Conclusions: HBV mutations, which play an important role in lamivudine resistance usually locate at polymerase gene 204 site; 180 site mutation was also observed in these patients. Evaluation of the anti-virus therapy by surveillance of the two sites mutations is of importance.

  2. 用盐酸及P204回收铅烟灰中铟的生产实践%Production Practice of Recovering Indium from Lead Reverberatory Dust with HCl Leaching -P204 Extraction

    Institute of Scientific and Technical Information of China (English)

    赵玉琴

    2013-01-01

    用盐酸浸取铅烟灰,铟的浸取率大于90%,浸取温度355 K ,浸取时间4 h ,再用P204萃取,用盐酸反萃,萃余液再用铅烟灰沉铟后送氯化锌车间。经一年多的生产实践,工艺技术可行,铟的回收率大于80%,铋的回收率大于90%。%Leaching the lead ash by hydrochloric acid , indium leaching rate is greater than 90% ,leaching temperature is 355 K , Leaching for 4 h , then extracting the lead ash by P204 , and back extracting it by hy-drochloric acid , extraction raffinate is sent to the zinc chloride workshop after precipitating indium . Pro-duction practicing more than one year show s that the technology is available , the recovery rate of indium is greater than 80% , bismuth recovery is more than 90% .

  3. The determination of maximum safe bombarding energies and B(E3) values in re-orientation experiments with 204Pb, 206Pb, 208Pb

    International Nuclear Information System (INIS)

    Data are presented which display the onset of Coulomb-nuclear interference in the inelastic scattering of 4He, 12C and 16O projectiles from 204Pb and 206Pb. These results were used to determine maximum safe bombarding energies in a recent re-orientation effect determination of the quadrupole moments of the first 2+ states in these nuclei. We also present similar data for the excitation by 16O projectiles of the first 3- states in 204Pb, 206Pb and 208Pb. The results are used to determine B(E3;0+ → 3-) values for the first 3- states of 204Pb and 206Pb; these are found to be remarkably similar to each other and to the corresponding value for the first 3- state in 208Pb

  4. Attenuation of bremsstrahlung from 90Sr-90Y, 147Pm and 204Tl in thick target compounds

    Science.gov (United States)

    Manjunatha, H. C.

    2014-11-01

    The external bremsstrahlung (EB) produced by beta particles such as from 90Sr-90Y, 147Pm and 204Tl in PbCl2, PbF2, Pb(NO3)2 and CdO were measured using NaI(Tl) crystal. The beta stopper technique is employed to measure the integral intensities above 100 keV energy in different absorber thicknesses. Attenuation of the external bremsstrahlung, excited by 90Sr-90Y, 147Pm and 204Tl beta-emitters in the same compounds has also been studied. The measured attenuation parameter is not constant with absorber thickness and it increases with increasing Zmod of the absorber. Whereas, the mass attenuation coefficient of gamma rays of equivalent energy is independent of the absorber thickness. This confirms that the attenuation of EB in an absorber does not conform to a single exponential law, unlike the absorption of monoenergetic gamma rays. Rather it may be a combination of a large number of exponential terms.

  5. Attenuation of bremsstrahlung from 90Sr–90Y, 147Pm and 204Tl in thick target compounds

    International Nuclear Information System (INIS)

    The external bremsstrahlung (EB) produced by beta particles such as from 90Sr–90Y, 147Pm and 204Tl in PbCl2, PbF2, Pb(NO3)2 and CdO were measured using NaI(Tl) crystal. The beta stopper technique is employed to measure the integral intensities above 100 keV energy in different absorber thicknesses. Attenuation of the external bremsstrahlung, excited by 90Sr–90Y, 147Pm and 204Tl beta-emitters in the same compounds has also been studied. The measured attenuation parameter is not constant with absorber thickness and it increases with increasing Zmod of the absorber. Whereas, the mass attenuation coefficient of gamma rays of equivalent energy is independent of the absorber thickness. This confirms that the attenuation of EB in an absorber does not conform to a single exponential law, unlike the absorption of monoenergetic gamma rays. Rather it may be a combination of a large number of exponential terms

  6. Transformer 2β and miR-204 regulate apoptosis through competitive binding to 3' UTR of BCL2 mRNA.

    Science.gov (United States)

    Kuwano, Y; Nishida, K; Kajita, K; Satake, Y; Akaike, Y; Fujita, K; Kano, S; Masuda, K; Rokutan, K

    2015-05-01

    RNA-binding proteins and microRNAs are potent post-transcriptional regulators of gene expression. Human transformer 2β (Tra2β) is a serine/arginine-rich-like protein splicing factor and is now implicated to have wide-ranging roles in gene expression as an RNA-binding protein. RNA immunoprecipitation (RIP) with an anti-Tra2β antibody and microarray analysis identified a subset of Tra2β-associated mRNAs in HCT116 human colon cancer cells, many of which encoded cell death-related proteins including Bcl-2 (B-cell CLL/lymphoma 2). Tra2β knockdown in HCT116 cells decreased Bcl-2 expression and induced apoptosis. Tra2β knockdown accelerated the decay of BCL2α mRNA that encodes Bcl-2 and full-length 3' UTR, while it did not affect the stability of BCL2β mRNA having a short, alternatively spliced 3' UTR different from BCL2α 3' UTR. RIP assays with anti-Tra2β and anti-Argonaute 2 antibodies, respectively, showed that Tra2β bound to BCL2α 3' UTR, and that Tra2β knockdown facilitated association of miR-204 with BCL2α 3' UTR. The consensus sequence (GAA) for Tra2β-binding lies within the miR-204-binding site of BCL2 3' UTR. Mutation of the consensus sequence canceled the binding of Tra2β to BCL2 3' UTR without disrupting miR-204-binding to BCL2 3' UTR. Transfection of an anti-miR-204 or introduction of three-point mutations into the miR-204-binding site increased BCL2 mRNA and Bcl-2 protein levels. Inversely, transfection of precursor miR-204 reduced their levels. Experiments with Tra2β-silenced or overexpressed cells revealed that Tra2β antagonized the effects of miR-204 and upregulated Bcl-2 expression. Furthermore, TRA2β mRNA expression was significantly upregulated in 22 colon cancer tissues compared with paired normal tissues and positively correlated with BCL2 mRNA expression. Tra2β knockdown in human lung adenocarcinoma cells (A549) increased their sensitivity to anticancer drugs. Taken together, our findings suggest that Tra2β regulates apoptosis by

  7. Coupled-channel analysis for 20.4 MeV energy of p-^{64}Zn inelastic scattering

    Indian Academy of Sciences (India)

    Harun Yücel; Müşfik Taşan

    2012-02-01

    In this study, a coupled-channel (CC) analysis of the elastic and the inelastic scattering of 20.4 MeV polarized protons from a 64Zn target leading to the deformed 2+, $3^−$, $2^+_2$ states was performed. The CC potential parameters and the deformation parameters of the excited states corresponding to the best fit to the experimental differential cross-sections and the analysing powers data were determined. For $2^+_2$ excited state, a mixed type was used and a good fit to the data was provided. The CC calculation results were compared to the pure distorted wave Born approximation (DWBA) calculation results which were calculated using the new parameters. All calculations were conducted using the computer code ECIS06.

  8. Fabry-perot kinematics of hh 202-204 in the orion nebula: are they part of a big bipolar outflow?

    Directory of Open Access Journals (Sweden)

    M. Rosado

    2002-01-01

    Full Text Available Se presenta un estudio cinem atico de los objetos HH 202, 203 y 204 usando mapas de velocidad Fabry-Perot en H y [N II]. En el caso de HH 202 se encuentran nebulosidades que podr an estar asociadas a este objeto o bien, dada sus altas velocidades (superiores a 100 km s

  9. Aberrant expression of miR-218 and miR-204 in human mesial temporal lobe epilepsy and hippocampal sclerosis-Convergence on axonal guidance

    DEFF Research Database (Denmark)

    Kaalund, Sanne Simone; Venø, Morten T; Bak, Mads;

    2014-01-01

    . Moreover, miR-204 and miR-218 showed strong changes in expression during fetal development of the hippocampus in pigs, and we identified four target genes, involved in axonal guidance and synaptic plasticity, ROBO1, GRM1, SLC1A2, and GNAI2, as bona fide targets of miR-218. GRM1 was also shown to be a...

  10. Corrective Action Decision Document for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada, Revision 0 with ROTC 1, 2, and Errata

    Energy Technology Data Exchange (ETDEWEB)

    Wickline, Alfred

    2004-04-01

    This Corrective Action Decision Document (CADD) has been prepared for Corrective Action Unit (CAU) 204 Storage Bunkers, Nevada Test Site (NTS), Nevada, in accordance with the ''Federal Facility Agreement and Consent Order'' (FFACO) that was agreed to by the State of Nevada; U.S. Department of Energy (DOE); and the U.S. Department of Defense (FFACO, 1996). The NTS is approximately 65 miles (mi) north of Las Vegas, Nevada (Figure 1-1). The Corrective Action Sites (CASs) within CAU 204 are located in Areas 1, 2, 3, and 5 of the NTS, in Nye County, Nevada (Figure 1-2). Corrective Action Unit 204 is comprised of the six CASs identified in Table 1-1. As shown in Table 1-1, the FFACO describes four of these CASs as bunkers one as chemical exchange storage and one as a blockhouse. Subsequent investigations have identified four of these structures as instrumentation bunkers (CASs 01-34-01, 02-34-01, 03-34-01, 05-33-01), one as an explosives storage bunker (CAS 05-99-02), and one as both (CAS 05-18-02). The six bunkers included in CAU 204 were primarily used to monitor atmospheric testing or store munitions. The ''Corrective Action Investigation Plan (CAIP) for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada'' (NNSA/NV, 2002a) provides information relating to the history, planning, and scope of the investigation; therefore, it will not be repeated in this CADD. This CADD identifies potential corrective action alternatives and provides a rationale for the selection of a recommended corrective action alternative for each CAS within CAU 204. The evaluation of corrective action alternatives is based on process knowledge and the results of investigative activities conducted in accordance with the CAIP (NNSA/NV, 2002a) that was approved prior to the start of the Corrective Action Investigation (CAI). Record of Technical Change (ROTC) No. 1 to the CAIP (approval pending) documents changes to the preliminary action levels

  11. Tank Vapor Characterization Project: Headspace vapor characterization of Hanford Waste Tank U-204, Results from samples collected on August 8, 1995

    International Nuclear Information System (INIS)

    This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-U-204 (Tank U-204) at the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank-farm operations. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNL). Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNL. Analyte concentrations were based on analytical results and, where appropriate, sample volumes provided by WHC. A summary of the results is listed. Detailed descriptions of the analytical results appear in the text

  12. Global requirements for DNA sample collections: results of a survey of 204 ethics committees in 40 countries.

    Science.gov (United States)

    Ricci, D S; Broderick, E D; Tchelet, A; Hong, F; Mayevsky, S; Mohr, D M; Schaffer, M E; Warner, A W; Hakkulinen, P; Snapir, A

    2011-04-01

    The Industry Pharmacogenomics Working Group has an interest in attaining a better understanding of global requirements for sample collections intended for pharmacogenetics research. To have adequately powered pharmacogenetics studies representative of the clinical trial population, it is important to collect DNA samples from a majority of consenting study participants under many institutional review board/ethics committee (IRB/EC) jurisdictions. A survey was distributed to gather information from local and central IRBs/ECs. The survey included questions related to the approval of pharmacogenetics studies, collection and banking of samples, and return of data to subjects. A total of 204 responses were received from global IRBs/ECs with pharmacogenetic experience. The data show that requirements for approval of pharmacogenetic research differ between IRBs/ECs within and between countries but not between regions of the United States. A better understanding of differing requirements should facilitate global sample collection of DNA for pharmacogenetics research and may provide the basis for harmonized regulations for collection of genetic samples in the future. PMID:21346753

  13. Safety and efficacy of rhBMP2 in posterior cervical spinal fusion for subaxial degenerative spine disease: Analysis of outcomes in 204 patients

    OpenAIRE

    Xu, Risheng; Bydon, Mohamad; Sciubba, Daniel M.; Witham, Timothy F.; Wolinsky, Jean-Paul; Gokaslan, Ziya L; Bydon, Ali

    2011-01-01

    Background: Many studies offer excellent demonstration of the ability of bone morphogenic protein (BMP) to enhance fusion rates in anterior as well as posterior lumbar surgery. Recently, BMP has also been shown to increase arthrodesis rates in anterior cervical surgery, albeit with concomitant increases in complication rates. To date, however, few studies have investigated the safety and efficacy of BMP in cervical surgeries approached posteriorly. Methods: We retrospectively reviewed 204 con...

  14. FOXC1 in human trabecular meshwork cells is involved in regulatory pathway that includes miR-204, MEIS2, and ITGβ1.

    Science.gov (United States)

    Paylakhi, Seyed Hassan; Moazzeni, Hamidreza; Yazdani, Shahin; Rassouli, Paniz; Arefian, Ehsan; Jaberi, Elham; Arash, Emad Heidari; Gilani, Ahmad Sadighi; Fan, Jian-Bing; April, Craig; Amin, Sadaf; Suri, Fatemeh; Elahi, Elahe

    2013-06-01

    Forkhead box C1 (FOXC1) is a transcription factor that affects eye development. FOXC1 is implicated in the etiology of glaucoma because mutations in the gene are among the causes of Axenfeld-Rieger syndrome which is often accompanied by glaucoma. Glaucoma is the second leading cause of blindness. It is a complex disorder whose genetic basis in most patients remains unknown. Microarrays expression analysis was performed to identify genes in human trabecular meshwork (TM) primary cultures that are affected by FOXC1 and genes that may have roles in glaucoma. This represents the first genome wide analysis of FOXC1 target genes in any tissue. FOXC1 knock down by siRNAs affected the expression of 849 genes. Results on selected genes were confirmed by real time PCR, immunoblotting, and dual luciferase reporter assays. Observation of MEIS2 as a FOXC1 target and consideration of FOXC1 as a potential target of miR-204 prompted testing the effect of this micro RNA on expression of FOXC1 and several genes identified by array analysis as FOXC1 target genes. It was observed that miR-204 caused decreased expression of FOXC1 and the FOXC1 target genes CLOCK, PLEKHG5, ITGβ1, and MEIS2 in the TM cultures. Expression of CLOCK, PLEKHG5, ITGβ1 has not previously been reported to be affected by miR-204. The data suggest existence of a complex regulatory pathway in the TM part of which includes interactions between FOXC1, miR-204, MEIS2, and ITGβ1. All these molecules are known to have TM relevant functions, and the TM is strongly implicated in the etiology of glaucoma. PMID:23541832

  15. Food sources of arachidonic acid (PFA 20:4), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006

    Science.gov (United States)

    Food sources of arachidonic acid (PFA 20:4), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006

  16. Food sources of total omega 6 fatty acids (18:2 + 20:4), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006

    Science.gov (United States)

    Food sources of total omega 6 fatty acids (18:2 + 20:4), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006

  17. Book review: Dominique Brossard, James Shanahan and Clint Nesbitt (eds), The Public, the Media and Agricultural Biotechnology (Wallingford: CABI, 2007). 414pp. ISBN 978 1 84593 204 6, #75.00 / $150.00

    OpenAIRE

    2008-01-01

    Book review: Dominique Brossard, James Shanahan and Clint Nesbitt (eds), The Public, the Media and Agricultural Biotechnology (Wallingford: CABI, 2007). 414pp. ISBN 978 1 84593 204 6, #75.00 / $150.00

  18. Process for producing astatine-211 for radiopharmaceutical use

    International Nuclear Information System (INIS)

    A one-step chemical manipulation is described in combination with a distillation and collection process for producing At-211 comprising; a. providing a target of irradiated Bismuth coated to a predetermined thickness of a backing member, b. providing a vapor-producing still operably connected with a condenser that has a water cooled condensate collector formed of a dry silica gel mesh maintained at a temperature above the freezing point of water, and providing an effluent gas filter that is operably connected to receive effluent gas from the condenser, c. heating the target in the still at a temperature in the range of about 6300-6800C for a time period in the range of 50 to 80 minutes, to evole At-211 vapor from the target, c. providing a dry carrier gas having an oxygen concentration that is sufficient to form Bi/sub 2/O/sub 3/ thereby to essentially preclude vaporization of Bi metal, passing the carrier gas through the still to carry the At-211 vapor to the condenser, and to carry effluent from the condenser to the effluent gas filter, e. eluting At-211 from the condensate collector of the condenser with a controlled volume of eluent containing predetermined solvents that are compatible with a given desired radiopharmaceutical procedure, and f. collecting the At-211 in the controlled volume of eluent for use in the given radiopharmaceutical procedure

  19. 204例孕妇营养知识水平、态度与行为调查%Investigation on nutritional knowledge level, attitude and practice of 204 pregnant women

    Institute of Scientific and Technical Information of China (English)

    闻立芳; 曾亮华; 李秀琼; 秦子惠; 牛晓虎

    2011-01-01

    目的:了解深圳市孕妇营养知识、饮食行为及其影响因素,为开展孕妇营养教育工作提供依据.方法:采用随机抽样方法对204例孕妇进行营养知识、态度、行为问卷调查.结果:孕妇营养KAP水平较差,总合格率为75.5%;30.4%的孕妇营养知识不足,营养态度不端正占26.5%.营养行为三者普遍较好,合格率达83.3%;孕妇的营养知识、态度、行为三者呈明显正相关关系;孕妇获得营养信息的来源主要是网络(88.6%)和专业书籍(69.3%)、报刊杂志和电视广播各占50.0%.教育程度和孕周、年龄、户籍、职业对孕妇营养KAP水平有影响(P<0.000 1).结论:加强医院孕期营养教育,对孕妇开展有针对性的个体化营养教育和干预,提高医务人员的营养知识技能水平,同时应全面提高孕产妇健康素质.%Objective: To understand the nutritional knowledge and dietary behavior of pregnant women in Shenzhen and the effect factors, provide a basis for carrying out nutritional educational work among pregnant women. Methods: Random sampling method was used to survey nutritional knowledge, attitude and practice (KAP) of 204 pregnant women. Results: The nutritional KAP level of pregnant women in Shenzhen was low, the total passing rate was 75. 5% , 30. 4% of the pregnant women lacked nutritional knowledge, the proportion of pregnant women with incorrect nutritional attitude was 26. 5%. The nutritional behavior of pregnant women in Shenzhen was good, the passing rate was 83. 3% ; there was a correlation among nutritional KAP. The sources of nutritional information were from the network (88. 6% ) and books (69. 3% ); newspaper/magazine and TV/radio accounted for 50.0% , respectively. The educational level, gestational weeks, maternal age, household register and occupation had impact on nutritional KAP level of pregnant women in Shenzhen (P < 0. 000 1) . Conclusion : The nutritional education during pregnancy should be

  20. Death from Liver Failure despite Lamivudine Prophylaxis during R-CHOP Chemotherapy due to Rapid Emergence M204 Mutations

    Directory of Open Access Journals (Sweden)

    Lay Lay Win

    2013-01-01

    Full Text Available Background. Rapid and early emergence of clinically significant LAM resistance is thought to be unlikely during the first year of treatment, and as a result LAM is thought to be a reasonable choice as a first line agent for prophylaxis during chemotherapy. Aim. To report fatal HBV reactivation despite appropriate LAM prophylaxis in two previously treatment-naive individuals undergoing R-CHOP chemotherapy. Case Presentation. Case 1 is a 65-year-old man with chronic HBV infection: HBeAg-negative, HBV DNA 6.65E5 IU/mL, ALT 43 IU/L, and Fibroscan 4.4 kPa, consistent with F0, who was diagnosed with lymphoma that was treated with R-CHOP and LAM prophylaxis. HBV DNA fell to 2.18E1 IU/mL within 2 months of starting LAM. Four months after chemotherapy, despite ongoing LAM of 7-month duration with confirmed adherence, severe asymptomatic hepatitis was noted during routine monitoring with ALT 1019 IU/L, HBeAg negative, HBV DNA 1.43E7 IU/mL, and genotyping confirmed L80I and M204I mutations. He died 14 days after flare diagnosis despite a switch to tenofovir (HBV DNA had fallen to 1.94E5 IU/mL 2 weeks after starting tenofovir. Case 2 is a 50-year-old man who was found to have HBeAg-negative hepatitis B, ALT 37 IU/L, and no clinical features of cirrhosis (platelets 283, APRI 0.19 after lymphoma diagnosis. Lymphoma was treated with R-CHOP and LAM prophylaxis. Pretreatment HBV DNA was not done but was 8.90E4 IU/mL 3 weeks after starting LAM and 3.96E3 IU/mL 3 months after starting LAM. Two months after chemotherapy, despite ongoing LAM of 7-month duration with confirmed adherence, severe symptomatic hepatitis presenting with jaundice, abdominal pain, and confusion was noted. ALT 902 IU/L, HBeAg negative, HBV DNA 1.02E8 IU/mL, and genotyping confirmed L80I, M80V, and M204V/S mutations. He died 3 days after flare diagnosis despite the addition of tenofovir. Conclusion. Lamivudine should not be used for prophylaxis of patients with chronic

  1. AMO-miR-204 antisense oligonucleotides enhance the sensitivity of MOLT-4 cells to matrine%Hsa-miR-204反义核酸提高MOLT-4细胞对苦参碱的敏感性研究

    Institute of Scientific and Technical Information of China (English)

    孙文洪; 何金花; 韩泽平; 黄国贤; 朱丽梨; 何琨仪; 陈炳豪

    2014-01-01

    目的 研究miR-204的反义核酸(anti-miR204 oligonucleotides,AMO-miR-204)联合苦参碱观察其对人急性淋巴细胞白血病细胞株(MOLT-4)生长与凋亡的影响及机制.方法 将一定浓度的人工合成的AMO-miR-204经脂质体包裹转染MOLT-4细胞,并联合不同浓度的苦参碱作用于MOLT-4细胞48 h后,采用MTT法检测单用AMO-miR-204、单用苦参碱及AMO-miR-204联合苦参碱对MOLT-4细胞增殖抑制作用,流式细胞术检测细胞早期凋亡率;实时荧光定量RT-PCR检测细胞 Bcl-2mRNA 的表达水平;克隆形成抑制实验检测克隆形成能力.结果单用苦参碱的IC50为0.75 mg·L-1;苦参碱与阴性对照联合使用,IC50为0.29 mg·L-1,表现为相加作用;苦参碱与AMO- miR-204联合使用,IC50为0.07 mg·L-1,增敏倍数为10.7,表现为协同作用.流式细胞术结果显示:联合组比单用组早期凋亡率明显增高,凋亡率达25.4%.单用AMO-miR-204、苦参碱及两者联均能下调 Bcl-2mRNA基因的表达水平,对MOLT-4细胞克隆形成逐渐减小,其中两者联合的克隆数为(28±3.0).结论 AMO- miR-204可提高MOLT-4细胞对苦参碱的敏感性,其机制可能为通过下调Bcl-2 mRNA的表达水平,促进MOLT-4细胞早期凋亡,并抑制其克隆形成有关.

  2. Corrective Action Investigation Plan for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada (December 2002, Revision No.: 0), Including Record of Technical Change No. 1

    Energy Technology Data Exchange (ETDEWEB)

    NNSA/NSO

    2002-12-12

    The Corrective Action Investigation Plan contains the U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office's approach to collect the data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit (CAU) 204 under the Federal Facility Agreement and Consent Order. Corrective Action Unit 204 is located on the Nevada Test Site approximately 65 miles northwest of Las Vegas, Nevada. This CAU is comprised of six Corrective Action Sites (CASs) which include: 01-34-01, Underground Instrument House Bunker; 02-34-01, Instrument Bunker; 03-34-01, Underground Bunker; 05-18-02, Chemical Explosives Storage; 05-33-01, Kay Blockhouse; 05-99-02, Explosive Storage Bunker. Based on site history, process knowledge, and previous field efforts, contaminants of potential concern for Corrective Action Unit 204 collectively include radionuclides, beryllium, high explosives, lead, polychlorinated biphenyls, total petroleum hydrocarbons, silver, warfarin, and zinc phosphide. The primary question for the investigation is: ''Are existing data sufficient to evaluate appropriate corrective actions?'' To address this question, resolution of two decision statements is required. Decision I is to ''Define the nature of contamination'' by identifying any contamination above preliminary action levels (PALs); Decision II is to ''Determine the extent of contamination identified above PALs. If PALs are not exceeded, the investigation is completed. If PALs are exceeded, then Decision II must be resolved. In addition, data will be obtained to support waste management decisions. Field activities will include radiological land area surveys, geophysical surveys to identify any subsurface metallic and nonmetallic debris, field screening for applicable contaminants of potential concern, collection and analysis of surface and subsurface soil samples from biased locations

  3. Validation of expression patterns for nine miRNAs in 204 lymph-node negative breast cancers.

    Directory of Open Access Journals (Sweden)

    Kristin Jonsdottir

    Full Text Available INTRODUCTION: Although lymph node negative (LN- breast cancer patients have a good 10-years survival (∼85%, most of them still receive adjuvant therapy, while only some benefit from this. More accurate prognostication of LN- breast cancer patient may reduce over- and under-treatment. Until now proliferation is the strongest prognostic factor for LN- breast cancer patients. The small molecule microRNA (miRNA has opened a new window for prognostic markers, therapeutic targets and/or therapeutic components. Previously it has been shown that miR-18a/b, miR-25, miR-29c and miR-106b correlate to high proliferation. METHODS: The current study validates nine miRNAs (miR-18a/b miR-25, miR-29c, miR-106b, miR375, miR-424, miR-505 and let-7b significantly correlated with established prognostic breast cancer biomarkers. Total RNA was isolated from 204 formaldehyde-fixed paraffin embedded (FFPE LN- breast cancers and analyzed with quantitative real-time Polymerase Chain Reaction (qPCR. Independent T-test was used to detect significant correlation between miRNA expression level and the different clinicopathological features for breast cancer. RESULTS: Strong and significant associations were observed for high expression of miR-18a/b, miR-106b, miR-25 and miR-505 to high proliferation, oestrogen receptor negativity and cytokeratin 5/6 positivity. High expression of let-7b, miR-29c and miR-375 was detected in more differentiated tumours. Kaplan-Meier survival analysis showed that patients with high miR-106b expression had an 81% survival rate vs. 95% (P = 0.004 for patients with low expression. CONCLUSION: High expression of miR-18a/b are strongly associated with basal-like breast cancer features, while miR-106b can identify a group with higher risk for developing distant metastases in the subgroup of Her2 negatives. Furthermore miR-106b can identify a group of patients with 100% survival within the otherwise considered high risk group of patients with

  4. Systematics of differential photoneutron yields produced from Al, Ti, Cu, Sn, W, and Pb targets by irradiation of 2.04 GeV electrons

    International Nuclear Information System (INIS)

    Differential photoneutron yields produced from Al, Ti, Cu, Sn, W, and Pb targets by an irradiation of 2.04 GeV electrons were measured at the angle of 90deg relative to the incident beam. The neutron energy range measured in this experiments was between 10 and 400 MeV. The systematics of the yields was studied for two target conditions : a target element and a target thickness. The neutron productions by a photonuclear reaction and by a hadron cascade due to secondary particles were considered to develop semi-empirical formula for the application of shielding calculation. (author)

  5. The two mutations, Q204X and nt821, of the myostatin gene affect carcass and meat quality in young heterozygous bulls of French beef breeds

    OpenAIRE

    Levéziel, Hubert; Payet-Duprat, Nathalie; Hocquette, Jean-François; Lepetit, Jacques; Rousset, Sylvie; Denoyelle, Christophe; Bernard-Capel, Carine; Journaux, L.; Bonnot, Aline; Renand, Gilles

    2010-01-01

    The availability of genetic tests to detect different mutations in the myostatin gene allows the identification of heterozygous animals and would warrant the superiority of these animals for slaughter performance if this superiority is confirmed. Thus, 2 mutations of this gene, Q204X and nt821, were studied in 3 French beef breeds in the program Qualvigène. This work was done with 1,114 Charolais, 1,254 Limousin, and 981 Blonde d’Aquitaine young bulls from, respectively, 48, 36, and 30 sires ...

  6. The two mutations, Q204X and nt821, of the myostatin gene affect carcass and meat quality in young heterozygous bulls of French beef breeds.

    Science.gov (United States)

    Allais, S; Levéziel, H; Payet-Duprat, N; Hocquette, J F; Lepetit, J; Rousset, S; Denoyelle, C; Bernard-Capel, C; Journaux, L; Bonnot, A; Renand, G

    2010-02-01

    The availability of genetic tests to detect different mutations in the myostatin gene allows the identification of heterozygous animals and would warrant the superiority of these animals for slaughter performance if this superiority is confirmed. Thus, 2 mutations of this gene, Q204X and nt821, were studied in 3 French beef breeds in the program Qualvigène. This work was done with 1,114 Charolais, 1,254 Limousin, and 981 Blonde d'Aquitaine young bulls from, respectively, 48, 36, and 30 sires and slaughtered from 2004 to 2006. In addition to the usual carcass traits recorded at slaughter (e.g., carcass yield, muscle score), carcass composition was estimated by weighing internal fat and dissecting the 6th rib. The muscle characteristic traits analyzed were lipid and collagen contents, muscle fiber section area, and pH. Regarding meat quality, sensory qualities of meat samples were evaluated by a taste panel, and Warner-Bratzler shear force was measured. Deoxyribonucleic acid was extracted from the blood samples of all calves, the blood samples of 78% of the dams, and the blood or semen samples of all the sires. Genotypes were determined for 2 disruptive mutations, Q204X and nt821. Analyses were conducted by breed. The superiority of carcass traits of calves carrying one copy of the mutated allele (Q204X or nt821) over noncarrier animals was approximately +1 SD in the Charolais and Limousin breeds but was not significant in the Blonde d'Aquitaine. In the Charolais breed, for which the frequency was the greatest (7%), young bulls carrying the Q204X mutation presented a carcass with less fat, less intramuscular fat and collagen contents, and a clearer and more tender meat than those of homozygous-normal cattle. The meat of these animals also had slightly less flavor. Also in the Charolais breed, 13 of 48 sires were heterozygous. For each sire, the substitution effect of the wild allele by the mutant allele was approximately +1 SD for carcass conformation and yield

  7. Desarrollo de un proceso de fermentación sólida para el hongo trichoderma asperellum th204 en un fermentador de lecho fijo

    OpenAIRE

    Cruz Barrera, Fredy Mauricio

    2014-01-01

    Se desarrolló un proceso de fermentación sólida para el hongo Trichoderma asperellum Th204 utilizando un fermentador de lecho fijo PROPHYTA® L05 mediante un diseño fraccionado (1/16) evaluando sobre su productividad (conidios/g.s.h) factores de la operación como la relación C/N, la temperatura de incubación, la relación de inoculación, la altura del lecho, la humedad del aire entrante, el caudal de aire y dos tipos de soporte inerte (espuma de poliuretano y cascarilla de arroz). Los factores ...

  8. 超高效液相色谱-四极杆-飞行时间质谱法快速筛查茶叶中的204种农药残留%Rapid determination of 204 pesticide residues in tea by ultra performance liquid chromatography coupled with quadrupole-time of flight mass spectrometry

    Institute of Scientific and Technical Information of China (English)

    余璐; 宋伟; 吕亚宁; 赵暮雨; 周芳芳; 胡艳云; 郑平

    2015-01-01

    An analytical method was established for the simultaneous determination of 204 pes-ticide residues in tea by ultra performance liquid chromatography coupled with quadrupole-time of flight mass spectrometry( UPLC-Q-TOF/MS). The samples were extracted with acetonitrile, and cleaned-up by solid phase extraction( SPE)with a Carb-PSA cartridge,eluted with aceto-nitrile-toluene(3:1,v/v),determined by UPLC-Q-TOF/MS and quantified by external standard method. A data base of the accurate mass numbers and a library which contains the 204 pesti-cides were established. The automatic retrieval of detection results was carried on according to the characteristics of the compound,such as accurate mass,retention time,isotopic ratio,and so on. Based on the above results,the qualitative identifications of the 204 pesticides were accomplished without the contrast of standard substances. The results indicated that this meth-od can be used to determine the 204 pesticides in tea. At the three spiked levels of 10,20,50μg/kg,mean recoveries for the 204 pesticides in tea were between 68. 1% and 117. 2%,with the relative standard deviations( RSDs)ranging from 3. 1% to 18. 9%. The limits of quantifica-tion for the 204 pesticides were lower than 10 μg/kg. The method has been applied to four posi-tive samples,and the results generally accord with the detection results by the method of GB/T 23205-2008. This method has the characteristics of high efficiency,as well as high sensitivity and accuracy,which can meet the requirement of the determination of the 204 pesticides in tea.%利用超高效液相色谱-四极杆-飞行时间质谱( UPLC-Q-TOF/MS)技术建立了茶叶中204种农药残留的快速筛查和确证检测方法。样品采用乙腈提取,经 Carb-PSA 固相萃取小柱净化,用乙腈-甲苯(3:1,v/v)洗脱,采用UPLC-Q-TOF/MS检测,外标法定量。建立了204种农药的一级精确质量数据库和二级谱图库,通过化合物的精确质量数

  9. Tank Vapor Characterization Project: Headspace vapor characterization of Hanford Waste Tank 241-C-204: Results from samples collected on 07/02/96

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, B.L.; Evans, J.C.; Pool, K.H. [and others

    1997-01-01

    This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-C-204 (Tank C-204) at the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank farm operations. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNNL). Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Analyte concentrations were based on analytical results and, where appropriate, sample volumes provided by WHC. A summary of the inorganic analytes, permanent gases, and total non-methane organic compounds is listed in Table S.1. The three highest concentration analytes detected in SUMMA{trademark} canister and triple sorbent trap samples are also listed in Table S.1. Detailed descriptions of the analytical results appear in the appendices.

  10. Measurement of the neutron capture cross section of the s-only isotope 204Pb from 1 eV to 440 keV

    CERN Document Server

    Domingo-Pardo, C; Aerts, G; Alvarez-Pol, H; Alvarez-Velarde, F; Andriamonje, S; Andrzejewski, J; Assimakopoulos, P; Audouin, L; Badurek, G; Baumann, P; Becvar, F; Berthoumieux, E; Bisterzo, S; Calvino, F; Cano-Ott, D; Capote, R; Carrapico, C; Cennini, P; Chepel, V; Chiaveri, E; Colonna, N; Cortes, G; Couture, A; Cox, J; Dahlfors, M; David, S; Dillmann, I; Dolfini, R; Dridi, W; Duran, I; Eleftheriadis, C; Embid-Segura, M; Ferrant, L; Ferrari, A; Ferreira-Marques, R; Fitzpatrick, L; Frais-Koelbl, H; Fujii, K; Furman, W; Gallino, R; Goncalves, I; Gonzalez-Romero, E; Goverdovski, A; Gramegna, F; Griesmayer, E; Guerrero, C; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martinez, A; Igashira, M; Isaev, S; Jericha, E; Kadi, Y; Kappeler, F; Karamanis, D; Karadimos, D; Kerveno, M; Ketlerov, V; Koehler, P; Konovalov, V; Kossionides, E; Krticka, M; Lamboudis, C; Leeb, H; Lindote, A; Lopes, I; Lozano, M; Lukic, S; Marganiec, J; Marrone, S; Mastinu, P; Mengoni, A; Milazzo, P.M; Moreau, C; Mosconi, M; Neves, F; Oberhummer, H; Oshima, M; O'Brien, S; Pancin, J; Papachristodoulou, C; Papadopoulos, C; Paradela, C; Patronis, N; Pavlik, A; Pavlopoulos, P; Perrot, L; Plag, R; Plompen, A; Plukis, A; Poch, A; Pretel, C; Quesada, J; Rauscher, T; Reifarth, R; Rosetti, M; Rubbia, C; Rudolf, G; Rullhusen, P; Salgado, J; Sarchiapone, L; Savvidis, I; Stephan, C; Tagliente, G; Tain, J.L; Tassan-Got, L; Tavora, L; Terlizzi, R; Vannini, G; Vaz, P; Ventura, A; Villamarin, D; Vincente, M.C; Vlachoudis, V; Vlastou, R; Voss, F; Walter, S; Wendler, H; Wiescher, M; Wisshak, K

    2007-01-01

    The neutron capture cross section of 204Pb has been measured at the CERN n_TOF installation with high resolution in the energy range from 1 eV to 440 keV. An R-matrix analysis of the resolved resonance region, between 1 eV and 100 keV, was carried out using the SAMMY code. In the interval between 100 keV and 440 keV we report the average capture cross section. The background in the entire neutron energy range could be reliably determined from the measurement of a 208Pb sample. Other systematic effects in this measurement could be investigated and precisely corrected by means of detailed Monte Carlo simulations. We obtain a Maxwellian average capture cross section for 204Pb at kT=30 keV of 79(3) mb, in agreement with previous experiments. However our cross section at kT=5 keV is about 35% larger than the values reported so far. The implications of the new cross section for the s-process abundance contributions in the Pb/Bi region are discussed.

  11. Pahute Mesa Well Development and Testing Analyses for Wells ER-20-8 and ER-20-4, Nevada National Security Site, Nye County, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Greg Ruskauff and Sam Marutzky

    2012-09-01

    Wells ER-20-4 and ER-20-8 were drilled during fiscal year (FY) 2009 and FY 2010 (NNSA/NSO, 2011a and b). The closest underground nuclear test detonations to the area of investigation are TYBO (U-20y), BELMONT (U-20as), MOLBO (U-20ag), BENHAM (U-20c), and HOYA (U-20 be) (Figure 1-1). The TYBO, MOLBO, and BENHAM detonations had working points located below the regional water table. The BELMONT and HOYA detonation working points were located just above the water table, and the cavity for these detonations are calculated to extend below the water table (Pawloski et al., 2002). The broad purpose of Wells ER-20-4 and ER-20-8 is to determine the extent of radionuclide-contaminated groundwater, the geologic formations, groundwater geochemistry as an indicator of age and origin, and the water-bearing properties and hydraulic conditions that influence radionuclide migration. Well development and testing is performed to determine the hydraulic properties at the well and between other wells, and to obtain groundwater samples at the well that are representative of the formation at the well. The area location, wells, underground nuclear detonations, and other features are shown in Figure 1-1. Hydrostratigraphic cross sections A-A’, B-B’, C-C’, and D-D’ are shown in Figures 1-2 through 1-5, respectively.

  12. Tank Vapor Characterization Project: Headspace vapor characterization of Hanford Waste Tank 241-C-204: Results from samples collected on 07/02/96

    International Nuclear Information System (INIS)

    This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-C-204 (Tank C-204) at the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank farm operations. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNNL). Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Analyte concentrations were based on analytical results and, where appropriate, sample volumes provided by WHC. A summary of the inorganic analytes, permanent gases, and total non-methane organic compounds is listed in Table S.1. The three highest concentration analytes detected in SUMMA trademark canister and triple sorbent trap samples are also listed in Table S.1. Detailed descriptions of the analytical results appear in the appendices

  13. NEW CATALYTIC SYSTEMS FOR THE FIXATION OF CO2 Ⅲ. INFLUENCE OF ADDITIVES AND REACTION MEDIUM ON THE COPOLYMERIZATION OF CARBON DIOXIDE-EPICHLOROHYDRIN IN THE PRESENCE OF Nd(P204)3-Al(i-Bu)3

    Institute of Scientific and Technical Information of China (English)

    CHEN Xianhai; ZHANG Yifeng; SHEN Zhiquan

    1994-01-01

    Copolymerization of carbon dioxide with epichlorohydrin was successfully carried out by using Nd (P204)3-A1 (i-Bu)3 as catalyst (P204) = (RO)2POO -, R=CH3 (CH2)3CH(C2H5)CH2-). Addition of carbonyl compounds into the catalyst decreased the carbon dioxide content of the copolymer to some extent. Compared to nonpolar solvents, ethereal and moderate polar solvents were favourable to obtaining higher carbon dioxide content copolymer. The coincidence of these results with the assumed copolymerization scheme clearly indicated that the copolymerization proceeds via coordinate anionic mechanism.

  14. High-power 2.04  μm laser in an ultra-compact Ho-doped lead germanate fiber.

    Science.gov (United States)

    Kuan, Pei-Wen; Fan, Xiaokang; Li, Xia; Li, Dahai; Li, Kefeng; Zhang, Lei; Yu, Chunlei; Hu, Lili

    2016-07-01

    A highly Ho-doped single-mode lead germanate glass fiber is developed for compact ∼2  μm lasers. Over 600 mW of laser output operating at 2.04 μm is demonstrated in a 2 cm-long active fiber. The slope efficiency reaches ∼34.9% with respect to the launched 1.94 μm laser pump power. To the best of our knowledge, this is the highest laser output power demonstrated within a few centimeters of a Ho-doped fiber. This result shows that the fiber is highly promising for high-power single-frequency laser applications. PMID:27367060

  15. The rapid analysis of 230Th in uranium ores by CaC2O4 precipitation, P204 extraction and α inner-scintillation

    International Nuclear Information System (INIS)

    The uranium ore was melted and decomposed with Na2O2, then it was leached by water and the residue was dissolved in the acid. The thorium was preconcentrated and separated from the other impurities by CaC2O4 precipitation. The precipitate was dissolved in 3 mol/L HNO3, then was extracted by P204-toluene solution and stripped by 5% H2C2O4. The solution was precipitated by CaC2O4 again and then mixed with ZnS(Ag). The α-activity of this sample could be measured by an inner-scintillation method. The detection limit is 3 x 10-3 Bq, and the analytic cycle is 6 samples (ores)/8 hours

  16. Serine 204 phosphorylation and O-β-GlcNAC interplay of IGFBP-6 as therapeutic indicator to regulate IGF-II functions in viral mediated hepatocellular carcinoma

    Directory of Open Access Journals (Sweden)

    Sarwar Muhammad T

    2011-05-01

    Full Text Available Abstract Hepatocellular carcinoma is mainly associated with viral hepatitis B and C. Activation of cell growth stimulator IGF-II gene is observed in tumor formation especially in viral associated hepatocellular carcinoma. Elevated IGF-II levels are indicator of increased risk for cholangiocellular and hepatocellular carcinomas through over saturation of IGF-II binding capacities with IGF receptors leading to cellular dedifferentiation. In HCV, core protein is believed to trans-activate host IGF-II receptor through PKC pathway and the inhibition of tumor cell growth can be achieved by blocking IGF-II pathway either at transcriptional level or increasing its binding with IGFBPs (Insulin like growth factor proteins at C-terminal, so that it is not available in free form. IGFBP-6 is a specific inhibitor of IGF-II actions. Affinity of IGFBPs with IGFs is controlled by post-translational modifications. Phosphorylation of IGFBPs inhibits IGFs action on target cells while O-glycosylation prevents binding of IGFBP-6 to glycosaminoglycans and cell membranes and resulting in a 10-fold higher affinity for IGF-II. O-glycosylation and phosphorylation operate the functional expression of cellular proteins, this switching on and off the protein expression is difficult to monitor in vivo. By using neural network based prediction methods, we propose that alternate O-β-GlcNAc modification and phosphorylation on Ser 204 control the binding of IGFBP-6 with IGF-II. This information may be used for developing new therapies by regulating IGFBP-6 assembly with IGF-II to minimize the risk of viral associated hepatocellular carcinoma. We can conclude that during HCV/HBV infection, O-β-GlcNAc of IGFBP-6 at Ser 204 diminish their binding with IGF-II, increase IGF-II cellular expression and promote cancer progression which can lead to hepatocellular carcinoma. Furthermore, this site can be used for developing new therapies to control the IGF-II actions during viral

  17. CD5 expression is regulated during human T-cell activation by alternative polyadenylation, PTBP1, and miR-204.

    Science.gov (United States)

    Domingues, Rita G; Lago-Baldaia, Inês; Pereira-Castro, Isabel; Fachini, Joseph M; Oliveira, Liliana; Drpic, Danica; Lopes, Nair; Henriques, Telmo; Neilson, Joel R; Carmo, Alexandre M; Moreira, Alexandra

    2016-06-01

    T lymphocytes stimulated through their antigen receptor (TCR) preferentially express mRNA isoforms with shorter 3´ untranslated regions (3´-UTRs) derived from alternative pre-mRNA cleavage and polyadenylation (APA). However, the physiological relevance of APA programs remains poorly understood. CD5 is a T-cell surface glycoprotein that negatively regulates TCR signaling from the onset of T-cell activation. CD5 plays a pivotal role in mediating outcomes of cell survival or apoptosis, and may prevent both autoimmunity and cancer. In human primary T lymphocytes and Jurkat cells we found three distinct mRNA isoforms encoding CD5, each derived from distinct poly(A) signals (PASs). Upon T-cell activation, there is an overall increase in CD5 mRNAs with a specific increase in the relative expression of the shorter isoforms. 3´-UTRs derived from these shorter isoforms confer higher reporter expression in activated T cells relative to the longer isoform. We further show that polypyrimidine tract binding protein (PTB/PTBP1) directly binds to the proximal PAS and PTB siRNA depletion causes a decrease in mRNA derived from this PAS, suggesting an effect on stability or poly(A) site selection to circumvent targeting of the longer CD5 mRNA isoform by miR-204. These mechanisms fine-tune CD5 expression levels and thus ultimately T-cell responses. PMID:27005442

  18. Exploring the effects of high-velocity flows in abundance determinations in H II regions. Bidimensional spectroscopy of HH 204 in the Orion Nebula

    CERN Document Server

    Núñez-Díaz, M; Esteban, C; López-Martín, L; García-Rojas, J; Luridiana, V

    2012-01-01

    We present results from integral field optical spectroscopy with the Potsdam Multi-Aperture Spectrograph of the Herbig-Haro (HH) object HH 204, with a spatial sampling of 1 x 1 arcsec^2. We have obtained maps of different emission lines, physical conditions and ionic abundances from collisionally excited lines. The ionization structure of the object indicates that the head of the bow shock is optically thick and has developed a trapped ionization front. The density at the head is at least five times larger than in the background ionized gas. We discover a narrow arc of high T_e([N II]) values delineating the southeast edge of the head. The temperature in this zone is about 1,000 K higher than in the rest of the field and should correspond to a shock-heated zone at the leading working surface of the gas flow. This is the first time this kind of feature is observed in a photoionized HH object. We find that the O^+ and O abundance maps show anomalous values at separate areas of the bow shock probably due to: a) ...

  19. Exploring the effects of high-velocity flows in abundance determinations in H II regions: bidimensional spectroscopy of HH 204 in the Orion nebula

    Science.gov (United States)

    Núñez-Díaz, M.; Mesa-Delgado, A.; Esteban, C.; López-Martín, L.; García-Rojas, J.; Luridiana, V.

    2012-04-01

    We present results from integral field optical spectroscopy with the Potsdam Multi-Aperture Spectrograph of the Herbig-Haro (HH) object HH 204, with a spatial sampling of 1 × 1 arcsec2. We have obtained maps of different emission lines, physical conditions and ionic abundances from collisionally excited lines. The ionization structure of the object indicates that the head of the bow shock is optically thick and has developed a trapped ionization front. The density at the head is at least five times larger than in the background ionized gas. We discover a narrow arc of high Te([N II]) values delineating the southeast edge of the head. The temperature in this zone is about 1000 K higher than in the rest of the field and should correspond to a shock-heated zone at the leading working surface of the gas flow. This is the first time this kind of feature is observed in a photoionized HH object. We find that the O+ and O abundance maps show anomalous values at separate areas of the bow shock probably due to: (a) overestimation of the collisional de-excitation effects of the [O II] lines in the compressed gas at the head of the bow shock, and (b) the use of a too high Te([N II]) at the area of the leading working surface of the flow.

  20. $^{204m}$Pb: A new Probe for TDPAC Experiments in Biology Complementing the Well Established Probes $^{111}$Cd and $^{199m}$Hg

    CERN Multimedia

    2002-01-01

    The short-lived nuclear probes $\\,^{111m}$Cd( t$_{1/2}$ = 49 min) , $^{199m}$Hg ( t$_{1/2}$ = 43 min) , and $^{204m}$Pb( t$_{1/2}$ = 43 min) supplied by ISOLDE are used to study the interaction of metals with biological macromolecules like, e.g., DNA and proteins. The structure and dynamics of metal sites in biomolecules are important in determining the functional efficiency of these macromolecules. Many life processes are based on such interactions. In order to study those metal sites close to physiological conditions a highly sensitive spectroscopic method is required, like Time Differential Perturbed Angular Correlation (TDPAC). Here, a radioactive atom is placed at the site of interest and by correlating the emitted $\\gamma$-quanta in space and on a nanosecond time scale local structural information is provided via the Nuclear Quadrupole Interaction. These investigations will allow a deeper insight into the adaptivity and rigidity of metal sites in the blue copper proteins (electron transfer proteins), th...

  1. Characterization of the ground X1 state of 204Pb19F, 206Pb19F, 207Pb19F, and 208Pb19F

    International Nuclear Information System (INIS)

    Pure rotational spectra of the ground electronic-vibrational X1 state of 204Pb19F, 206Pb19F, 207Pb19F, and 208Pb19F are measured with a resonator pulsed supersonic jet Fourier-transform microwave spectrometer. Also reported is a new measurement of the Stark effect on the optical spectra of A(leftarrow)X1 transitions. These spectra are combined with published high-resolution infrared spectra of X2↔X1 transitions in order to create a complete picture of the ground state of lead monofluoride. For the microwave data, molecules are prepared by laser ablation of lead target rods and stabilized in a supersonic jet of neon mixed with sulfur hexafluoride. For the optical Stark spectra, a continuous source of molecules is created in a nozzle heated to 1000 deg. C. The microwave spectra confirm, improve, and extend previously reported constants that describe the rotational, spin-orbit, and hyperfine interactions of the ground electronic state of the PbF molecule. A discrepancy concerning the sign of the hyperfine constant describing the 207Pb nucleus is discussed. Magnetic-field-dependent microwave spectra are used to characterize the Zeeman interaction in terms of two g factors of the body-fixed electronic wave function. The optical Stark spectra are used to characterize the electric dipole moment of the X1 and A states.

  2. In vivo detection of somatostatin receptors in patients with functionless pituitary adenomas by means of a radioiodinated analog of somatostatin ([123I]SDZ 204-090)

    International Nuclear Information System (INIS)

    The recent availability of a Tyr3-substituted octreotide (SDZ 204-090) for radioiodination has allowed somatostatin (SRIH) receptor binding to be studied in vivo, and receptor-positive tumors of different origins to be visualized with a gamma-camera. This prompted us to investigate whether this compound could be used for external imaging of functionless pituitary adenomas displaying SRIH receptors. Eight patients with functionless pituitary adenomas, three patients with acromegaly, and three with macroprolactinoma were injected iv with 123I-labeled Tyr3-octreotide and then scanned with a gamma-camera. Positive scans were obtained in the three acromegalics and in two of the eight patients with functionless pituitary tumors. The patients with macroprolactinoma had negative scans. The diagnosis of functionless pituitary adenomas was confirmed by light and electron microscopic examination as well as immunocytochemical studies. In vitro binding of [125I]Tyr11-SRIH to cell membranes was evaluated in four functionless and three GH-secreting adenomas removed from seven of the patients. All of the GH-secreting as well as one of the four functionless adenomas had high affinity SRIH-binding sites, without differences in number or affinity, whereas SRIH-binding sites were not detected in the others. Positive scans were observed only in patients bearing tumors with high affinity SRIH-binding sites. In conclusion, [123I]Tyr3-octreotide appears to be a promising tool for singling out, in vivo, patients with functionless pituitary tumors displaying SRIH receptors who might potentially benefit from octreotide treatment

  3. ECO 204 NEW Tutorial / Uoptutorial

    OpenAIRE

    Armugam

    2015-01-01

    For more course tutorials visit www.uoptutorial.com   Circular Flow Diagram. Explain how the circular flow diagram relates to the current economic situation. Using the circular flow diagram, explain a way that your family interacts in the factor market and a way that it interacts in the products market. Supply and Demand. Analyze how the law of demand applies to a recent purchase that you made. Describe how the product has changed in price and explain whether the price ch...

  4. MO-E-17A-08: Attenuation-Based Size Adjusted, Scanner-Independent Organ Dose Estimates for Head CT Exams: TG 204 for Head CT

    International Nuclear Information System (INIS)

    Purpose: AAPM Task Group 204 described size specific dose estimates (SSDE) for body scans. The purpose of this work is to use a similar approach to develop patient-specific, scanner-independent organ dose estimates for head CT exams using an attenuation-based size metric. Methods: For eight patient models from the GSF family of voxelized phantoms, dose to brain and lens of the eye was estimated using Monte Carlo simulations of contiguous axial scans for 64-slice MDCT scanners from four major manufacturers. Organ doses were normalized by scannerspecific 16 cm CTDIvol values and averaged across all scanners to obtain scanner-independent CTDIvol-to-organ-dose conversion coefficients for each patient model. Head size was measured at the first slice superior to the eyes; patient perimeter and effective diameter (ED) were measured directly from the GSF data. Because the GSF models use organ identification codes instead of Hounsfield units, water equivalent diameter (WED) was estimated indirectly. Using the image data from 42 patients ranging from 2 weeks old to adult, the perimeter, ED and WED size metrics were obtained and correlations between each metric were established. Applying these correlations to the GSF perimeter and ED measurements, WED was calculated for each model. The relationship between the various patient size metrics and CTDIvol-to-organ-dose conversion coefficients was then described. Results: The analysis of patient images demonstrated the correlation between WED and ED across a wide range of patient sizes. When applied to the GSF patient models, an exponential relationship between CTDIvol-to-organ-dose conversion coefficients and the WED size metric was observed with correlation coefficients of 0.93 and 0.77 for the brain and lens of the eye, respectively. Conclusion: Strong correlation exists between CTDIvol normalized brain dose and WED. For the lens of the eye, a lower correlation is observed, primarily due to surface dose variations. Funding

  5. Measurements of Neutron-Induced Fission Cross Sections of 205Tl, 204, 206, 207, 208Pb, and 209Bi using Quasi-Monoenergetic Neutrons in the Energy Range 35 - 174 MeV

    Science.gov (United States)

    Tutin, Gennady A.; Ryzhov, Igor V.; Eismont, Vilen P.; Mitryukhin, Andrey G.; Oplavin, Valery S.; Soloviev, Sergey M.; Blomgren, Jan; Condè, Henri; Olsson, Nils; Renberg, Per-Ulf

    2005-05-01

    Cross sections for neutron-induced fission of 205Tl, 204, 206, 207, 208Pb, and 209Bi were measured in the energy range from 35 MeV to 174 MeV. The experiments were done at the neutron beam facility of The Svedberg Laboratory, using a multi-section Frisch-gridded ionization chamber for detection of the fission fragments. The neutron-induced fission cross section of 238U was employed as a reference. The results of the measurements are compared with existing experimental data.

  6. Measurements of neutron-induced fission cross-sections of 205Tl, 204,206,207,208Pb and 209Bi with a multi-section Frisch-gridded ionization chamber

    Science.gov (United States)

    Ryzhov, I. V.; Tutin, G. A.; Mitryukhin, A. G.; Oplavin, V. S.; Soloviev, S. M.; Blomgren, J.; Renberg, P.-U.; Meulders, J. P.; El Masri, Y.; Keutgen, Th.; Prieels, R.; Nolte, R.

    2006-06-01

    Neutron-induced fission cross-sections of 205Tl, 204,206,207,208Pb and 209Bi have been measured in the energy range from 30 to 180 MeV. The measurements were performed with quasi-monoenergetic neutron beams using a multi-section Frisch-gridded ionization chamber. The neutron-induced fission cross-sections of 238U were used as reference data. The experimental techniques are described in detail as well as the data processing. The results are compared with existing experimental data.

  7. Pb(II) and Hg(II) binding to $\\textit{de novo}$ designed proteins studied by $^{204m}$Pb- and $^{199m}$Hg-Perturbed Angular Correlation of $\\gamma$-rays (PAC) spectroscopy : Clues to heavy metal toxicity

    CERN Multimedia

    2002-01-01

    $\\textit{De novo}$ design of proteins combined with PAC spectroscopy offers a unique and powerful approach to the study of fundamental chemistry of heavy metal-protein interactions, and thus of the mechanisms underlying heavy metal toxicity. In this project we focus on Pb(II) and Hg(II) binding to designed three stranded coiled coil proteins with one or two binding sites, mimicking a variety of naturally occurring thiolate-rich metal ion binding sites in proteins. The $^{204m}$Pb- and $^{199m}$Hg-PAC experiments will complement data already recorded with EXAFS, NMR, UV-Vis and CD spectroscopies.

  8. Measurements of neutron-induced fission cross-sections of 205Tl, 204,206,207,208Pb and 209Bi with a multi-section Frisch-gridded ionization chamber

    International Nuclear Information System (INIS)

    Neutron-induced fission cross-sections of 205Tl, 204,206,207,208Pb and 209Bi have been measured in the energy range from 30 to 180 MeV. The measurements were performed with quasi-monoenergetic neutron beams using a multi-section Frisch-gridded ionization chamber. The neutron-induced fission cross-sections of 238U were used as reference data. The experimental techniques are described in detail as well as the data processing. The results are compared with existing experimental data

  9. Lamivudine-resistant rtL180M and rtM204I/V are persistently dominant during combination rescue therapy with entecavir and adefovir for hepatitis B

    Science.gov (United States)

    WANG, YANG; LIU, SHUANG; CHEN, YU; ZHENG, SUJUN; ZHOU, LI; LU, FENGMIN; DUAN, ZHONGPING

    2016-01-01

    Adefovir (ADV) sequential monotherapy was included in the 2005 Asia-Pacific guidelines for the management of patients with lamivudine (LAM) resistance. However, following the development of ADV resistance, the proportion of resistant variants during combined rescue therapy with ADV and entecavir (ETV) were unknown. The present study characterized the dynamics of resistant variants in patients with chronic hepatitis B (CHB) and LAM-resistant variants during antiviral therapy consisting of ADV monotherapy followed by ADV-ETV combination therapy. A total of 3 patients were selected from a cohort of 55 patients with CHB due to developing ADV resistance. The patients had been previously treated with LAM (100 mg daily) for 21–24 months. At the initiation of sequential monotherapy with ADV, LAM-resistant variants (rtM204V/I and rtL180M) were detected in the three patients. These patients developed ADV resistance during 19–30 months of ADV sequential monotherapy, and then switched their antiviral regimen to ADV-ETV combination therapy. During ADV monotherapy and ADV-ETV combination therapy, the patients were monitored every 3 months for the first year of therapy, and then every 6 months thereafter. A total of 30 serum samples were collected from the patients throughout the monitoring period. In total, 10 mutants that were associated with commonly-used antiviral drugs were detected by pyrosequencing. During ADV sequential monotherapy, LAM-resistant variants were gradually decreased, whereas ADV-resistant rtA181V/T and rtN236T variants gradually increased in the viral population. During 30–41 months of ADV-ETV combination therapy, viral load reduction was 2.59–3.28 log10 copies/ml; ADV-resistant variants rtA181T/V and rtN236T were undetectable following 11–24 months of combination therapy; and rtL180M and rtM204I/V remained dominant in the viral population. In conclusion, the results of the present study suggested that, in patients with LAM and ADV

  10. Influence of Zr/Ti Ratio on the Microwave Dielectric Behavior of xZrO2-0.4(Zn1/3Nb2/3)O2- yTiO2 Ceramics

    Science.gov (United States)

    Cui, Zhiyuan; Shen, Chunying; Qiu, Tai

    2015-01-01

    xZrO2-0.4(Zn1/3Nb2/3)O2- yTiO2 ( x + y + 0.4 = 2, x/ y = 7/9, 8/8, 9/7, and 10/6, denoted as Z7T9, Z8T8, Z9T7, and Z10T6, respectively) ceramics were prepared by the conventional solid-state ceramic route. The objective of the present work is to determine an excellent Zr/Ti ratio for the xZrO2-0.4(Zn1/3Nb2/3)O2- yTiO2 system. The microstructure and microwave dielectric properties have been investigated as functions of the Zr/Ti ratio and sintering temperature. The crystalline phases of the (Zn1/3Nb2/3)4+-doped ZrO2-TiO2 ceramics depended greatly on the Zr/Ti ratio. The samples with Zr/Ti ratio of 7/9 and 8/8 crystallized as columbite-type-structured ZrTi2O6 phase, while the samples with Zr/Ti ratio of 9/7 and 10/6 crystallized in orthorhombic α-PbO2 ZrTiO4 structure. Secondary phase of monoclinic ZrO2 appeared when the Zr/Ti ratio was high at 10/6. Scanning electron microscopy (SEM) analysis demonstrated that dense ceramics were obtained, with increasing average grain size as the Zr/Ti ratio was increased. The microwave dielectric properties, especially the quality factor ( Q× f) and temperature coefficient of resonance frequency( τ f ) values, were sensitive to the Zr/Ti ratio. The 0.8ZrO2-0.4(Zn1/3Nb2/3)O2-0.8TiO2 ceramic sintered at 1320°C for 3 h exhibited an excellent combination of microwave dielectric properties with dielectric constant ( ɛ r) of 40.89, Q× f of 43,300 GHz, and τ f of -3.8 ppm/°C.

  11. Evaluation of a Wet Chemistry Method for Isolation of Cyclotron Produced [211At]Astatine

    Directory of Open Access Journals (Sweden)

    Shigeki Watanabe

    2013-09-01

    Full Text Available A “wet chemistry” approach for isolation of 211At from an irradiated bismuth target is described. The approach involves five steps: (1 dissolution of bismuth target in conc. HNO3; (2 removal of the HNO3 by distillation; (3 dissolution of residue in 8 M HCl; (4 extraction of 211At from 8 M HCl into DIPE; and (5 extraction of 211At from DIPE into NaOH. Results from 55 “optimized” 211At isolation runs gave recovery yields of approximately 78% after decay and attenuation corrections. An attenuation-corrected average of 26 ± 3 mCi in the target provided isolated (actual yields of 16 ± 3 mCi of 211At. A sixth step, used for purification of 211At from trace metals, was evaluated in seven runs. In those runs, isolated 211At was distilled under reductive conditions to provide an average 71 ± 8% recovery. RadioHPLC analyses of the isolated 211At solutions, both initial and after distillation, were obtained to examine the 211At species present. The primary species of 211At present was astatide, but astatate and unidentified species were also observed. Studies to determine the effect of bismuth attenuation on 211At were conducted to estimate an attenuation factor (~1.33 for adjustment of 211At readings in the bismuth target.

  12. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  13. Astatination of nanoparticles containing silver as possible carriers of 211At

    Czech Academy of Sciences Publication Activity Database

    Lebeda, Ondřej; Kučka, Jan; Hrubý, Martin; Koňák, Čestmír; Kozempel, Ján

    2006-01-01

    Roč. 64, - (2006), s. 201-206. ISSN 0969-8043 R&D Projects: GA AV ČR KJB4048302; GA AV ČR KJB4050408 Institutional research plan: CEZ:AV0Z1048901 Keywords : nanoparticles * 211AT * Atalpha particle therapy Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.924, year: 2006

  14. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  15. Irradiation performance and post-irradiation examinations of the instrumented sphere-pac UO2 assembly IFA-204, irradiated up to 1.7% FIMA in the Halden Boiling Water Reactor

    International Nuclear Information System (INIS)

    Fuel assembly IFA-204 consisted of four pins filled with a blend of three sizes of UO2 spheres. This blend was compacted in the zircaloy-4 cladding tube by vibration to achieve a 87-88% T.D. smear density of the 1500 mm long sphere-pac fuel column. IFA-204 was irradiated during 597 days, equivalent to 436 full power days, in the Halden BWR from November 1971 to April 1974 when the achieved assembly average burnup amounted to 13.7 MWd/kg UO2. Two of the four pins were equipped with fuel column length and pin length extensometers. The measurements showed that at average pin powers less than about 25 kW.m-1 only fuel-clad-thermal-interaction, FCTI, occurred. The clad thermal expansion coefficient was 4.8 ppm/kW.m-1. For calculations of the irradiation behaviour of sphere-pac LWR pins, filled with 0.1 MPa helium, with the Gapcon-Thermal-2 code a new thermal conductivity-temperature relationship has been developed. The calculated data agreed reasonably well with the measured data when taking into account a restructured fuel density of 90% T.D., a fuel surface roughness of 1 μm, the absence of a fuel-cladding gap and an effective full power fuel restructuring time of 40 days. It is concluded that the porous structure of the sphere-pac fuel column, whether restructured or not, has the inherent disadvantage of a high mobility of gaseous fission products and the inherent advantage of a practically stress free operation of the cladding

  16. Characterization of the ground X{sub 1} state of {sup 204}Pb{sup 19}F, {sup 206}Pb{sup 19}F, {sup 207}Pb{sup 19}F, and {sup 208}Pb{sup 19}F

    Energy Technology Data Exchange (ETDEWEB)

    Mawhorter, Richard J.; Murphy, Benjamin S.; Baum, Alexander L.; Sears, Trevor J.; Yang, T.; Rupasinghe, P. M; McRaven, C. P.; Shafer-Ray, N. E.; Alphei, Lukas D.; Grabow, Jens-Uwe [Department of Physics and Astronomy, Pomona College, Claremont, California 91711-6327 (United States); Chemistry Department, Brookhaven National Laboratory, Upton, New York 11973-5000 (United States); Homer L. Dodge Department of Physics and Astronomy, University of Oklahoma, Norman, Oklahoma (United States); Gottfried-Wilhelm-Leibniz-Universitaet, Institut fuer Physikalische Chemie and Elektrochemie, Lehrgebiet A, D-30167 Hannover (Germany)

    2011-08-15

    Pure rotational spectra of the ground electronic-vibrational X{sub 1} state of {sup 204}Pb{sup 19}F, {sup 206}Pb{sup 19}F, {sup 207}Pb{sup 19}F, and {sup 208}Pb{sup 19}F are measured with a resonator pulsed supersonic jet Fourier-transform microwave spectrometer. Also reported is a new measurement of the Stark effect on the optical spectra of A(leftarrow)X{sub 1} transitions. These spectra are combined with published high-resolution infrared spectra of X{sub 2}{r_reversible}X{sub 1} transitions in order to create a complete picture of the ground state of lead monofluoride. For the microwave data, molecules are prepared by laser ablation of lead target rods and stabilized in a supersonic jet of neon mixed with sulfur hexafluoride. For the optical Stark spectra, a continuous source of molecules is created in a nozzle heated to 1000 deg. C. The microwave spectra confirm, improve, and extend previously reported constants that describe the rotational, spin-orbit, and hyperfine interactions of the ground electronic state of the PbF molecule. A discrepancy concerning the sign of the hyperfine constant describing the {sup 207}Pb nucleus is discussed. Magnetic-field-dependent microwave spectra are used to characterize the Zeeman interaction in terms of two g factors of the body-fixed electronic wave function. The optical Stark spectra are used to characterize the electric dipole moment of the X{sub 1} and A states.

  17. 40 CFR 204.51 - Definitions.

    Science.gov (United States)

    2010-07-01

    .... Also included are all cooling, lubricating, regulating, starting, and fuel systems, and all equipment... line and is comprised of compressor lines, models or series which are identical in all material..., equipment designed to activate pneumatic tools. This consists of an air compressor (air end), and...

  18. 40 CFR 204.54 - Test procedures.

    Science.gov (United States)

    2010-07-01

    ... operated at the design full speed with the compressor on load, delivering its rated flow and output... microphone location, 10 dB or greater than the background sound level, (5) The machine shall have been warmed... International Electrotechnical Commission (IEC) Publication No. 179, “Precision Sound Level Meters.” (2)...

  19. 23 CFR 646.204 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS RAILROADS Railroad...: Active warning devices means those traffic control devices activated by the approach or presence of a... the use of which is governed by block signals or by centralized traffic control. Passive...

  20. 48 CFR 952.204-2 - Security.

    Science.gov (United States)

    2010-10-01

    ... review, as defined at 48 CFR 904.401, of an uncleared applicant or uncleared employee, and must test the... drug, as defined in 10 CFR Part 707.4. All positions requiring access authorizations are deemed testing designated positions in accordance with 10 CFR Part 707. All employees possessing access authorizations...

  1. 7 CFR 1901.204 - Compliance reviews.

    Science.gov (United States)

    2010-01-01

    ... Review Officer will: (i) Observe the recipient's records, including records on the present membership by race, the handling of applications for use of the facility, the user rates and membership fees or...

  2. 46 CFR 197.204 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... Institute “Code for Pressure Piping, Power Piping.” ASME Code means the American Society of Mechanical... diving operations. Bottom time means the total elapsed time measured in minutes from the time the diver leaves the surface in descent to the time to the next whole minute that the diver begins...

  3. QTL Information Table: 204 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available pl9 Morphological trait Panicle/flower panicle length Mixture C)Interval RIL Zhenshan 97 Minghui ... ment interaction for rice panicle characteristics. Yi ... Chuan Xue Bao 28, 439-446. ...

  4. 19 CFR 201.204 - Salary offset.

    Science.gov (United States)

    2010-04-01

    ... the employee with a written Notice of Intent to Offset a minimum of 30 calendar days before salary... appropriate under 5 U.S.C. Chapter 75, 5 CFR part 752, or any other applicable statutes or regulations; (ii... official from an agent of the paying agency, as designated in 5 CFR part 581, appendix A, or as...

  5. 10 CFR 1015.204 - Reporting debts.

    Science.gov (United States)

    2010-01-01

    ... reporting agencies in accordance with 31 U.S.C. 3711(e), the DCIA, the revised Federal Claims Collection Standards (31 CFR parts 900-904) published November 22, 2000, and other applicable authorities. DOE will...,” revised October 2001. (b) As described in § 1015.201(e), under the DCIA (31 U.S.C. 3711(g)), DOE...

  6. 7 CFR 1205.204 - Voting.

    Science.gov (United States)

    2010-01-01

    .... Forms obtained via the Internet will be located at http://www.ams.usda.gov/Cotton. Upon request by... 20026-3704. Forms obtained via the Internet will be located at http://www.ams.usda.gov/Cotton. (d... through the Internet during the voting period. A completed and signed CN-100 and supporting...

  7. 29 CFR 541.204 - Educational establishments.

    Science.gov (United States)

    2010-07-01

    ..., an institution of higher education or other educational institution. Sections 3(v) and 3(w) of the...; department heads in institutions of higher education responsible for the administration of the mathematics... academic staff such as social workers, psychologists, lunch room managers or dietitians do not...

  8. 50 CFR 217.204 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... SPECIFIED ACTIVITIES Taking Of Marine Mammals Incidental To The Port of Anchorage Marine Terminal... cease and vessels will reduce to the slowest speed practicable while still maintaining control of...

  9. 5 CFR 2635.204 - Exceptions.

    Science.gov (United States)

    2010-01-01

    ... on official travel to, a foreign area as defined in 41 CFR 301-7.3(c) may accept food, refreshments... travel expenses and conference fees for an employee of its Office of Radiation Programs to attend an... a business relationship that is the motivation behind the partners' gift. (c) Discounts and...

  10. 5 CFR 950.204 - Local eligibility.

    Science.gov (United States)

    2010-01-01

    ... electronic technology that allows removal of the need for geographic restrictions on giving as determined by... its funds on an accrual basis in accordance with generally accepted accounting principles and that an... have accounting procedures acceptable to an installation auditor and the inspector general. (5) Have...

  11. 45 CFR 204.4 - Grant appeals.

    Science.gov (United States)

    2010-10-01

    ... material necessary. (3) If the response to the grantee is adverse to the grantee's position, the response...) Section 222(a) and (b) of the Social Security Amendments of 1972 (Pub. L. 92-603). (2) Section 426 of the Social Security Act (42 U.S.C. 262). (3) Section 707 of the Social Security Act (42 U.S.C. 907)....

  12. 42 CFR 66.204 - Application.

    Science.gov (United States)

    2010-10-01

    ... PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES FELLOWSHIPS, INTERNSHIPS, TRAINING... subject area or areas in which the proposed research or training will be conducted; (2) The resources and facilities available for use by recipients of Awards in carrying out this research or training; (3) The...

  13. 44 CFR 204.42 - Eligible costs.

    Science.gov (United States)

    2010-10-01

    ... under State law and procedure and complying with 44 CFR part 13. (b) Equipment and supplies. Eligible... the firefighting effort or activities. This includes minimal repairs to bulldozer lines, camps,...

  14. 31 CFR 539.204 - Exempt transactions.

    Science.gov (United States)

    2010-07-01

    ... of services to market, produce or co-produce, create, or assist in the creation of information or... not involve the transfer of anything of value. (b) Information or informational materials. (1)...

  15. Inclusive measurement of (p,πsup(-)xn) double charge exchange reactions on bismuth from threshold to 800 MeV

    International Nuclear Information System (INIS)

    The energy dependence of the total angle-integrated cross section for the production of astatine isotopes from (p,πsup(-)xn) double charge exchange reactions on bismuth (sup(209)Bi) was measured from 120 to 800 MeV using activation and radiochemical techniques. Chemical yields were estimated by direct radioassaying of sup(211)At activity in thin (approximately 1 mg/cmsup(2)), irradiated bismuth targets. Calculations of the contributions of secondary (2-step) reactions to these measured astatine yields were performed, based partially upon the observed sup(211)At activity although even at the highest energies, the contribution to products lighter than sup(207)At was negligible. These data for products with as many as 7 neutrons removed from the doubly coherent product (sup(210)At) display nearby gaussian shapes for the mass distributions of the astatine residues with the maximum occurring for about sup(204)At. The most probable momentum transfer deduced from these distributions for the initial πsup(-) production step was 335 MeV/c. The observed excitation functions display a behaviour similar to that observed for the yield of sup(210)Po from a (p,πsup(O)) reaction on sup(209)Bi, but radically different from that observed for inclusive πsup(-) reactions on a heavy nucleus. These data are discussed in terms of recent theoretical approaches to negative pion production from bismuth. In addition, a simple, schematic model is developed to treat the rapidly decreasing percentage of the total inclusive πsup(-) emission which is observed for this double charge exchange reaction. This model reflects the capacity of a nucleus to a source of internal energetic protons

  16. 40 CFR Appendix I to Part 204 - Appendix I to Part 204

    Science.gov (United States)

    2010-07-01

    ....: Serial No.: Other and Manufacturer: Model No.: Serial No.: Data: Sound levels (decibels) Background sound level at location 1 (decibels) Location 1 2 3 4 5 Average sound level (decibels) A-Weighted Tested...

  17. УПРАВЛЕНИЕ СЕТЕВЫМ ПИТАНИЕМ С ПОМОЩЬЮ PIC10F204 И СИМИСТОРА

    OpenAIRE

    Сафронов, Алексей

    2005-01-01

    В статье рассматривается вариант замены механического термостата на электронныйрегулятор на новом микроконтроллере от Microchip — PIC10F204. Управление током через нагревательный элемент осуществляется с помощью симистора, основы управления которым также рассмотрены в статье....

  18. Measurement of dose speed absorbed in depth imparted by sources external secondary patterns of beta radiation. Part 1 Measurement of dose speed absorbed in the surface of soft fabric for isotopes of 90Sr/90Y, 147Pm and 204TI

    International Nuclear Information System (INIS)

    The dose speed was measured absorbed for depth zero, (superficial) in soft equivalent fabric, for the secondary patterns four sources of beta radiation, (Nr. 86): 90Sr/90Y, (1850 MBq and 74 MBq respectively); 147Pm, (518 MBq) and 204TI, (18.5 MBq). The measurement is carried out to different distances of source-detecting separation, (11.0, 30.0 and 50.0 cm for the source of 1850 MBq, 30.0 cm for that of 74 MBq; 11.00 cm for the source of 147Pmand to contact for all the sources); maintaining the radiation sheaf aligned the one axis of symmetry of the detector, (α 0 degrees). The detector employed was a extrapolation chambers of variable electrodes and electrode fixed collector, (30 mm of diameter). In accordance with the principle of Bragg-Gray the volume of the chambers is varied and they register the variations of the current of collected ionization, correcting until for a maximum of thirteen correction factors that take into account the deviation to the suppositions that it establishes this principle. The certain values of the speed of superficial absorbed dose are in the following intervals: 90Sr/90Y, (1850 MBq, 0.0, 11.0, 30.0 and 50.0 cm): 43.164 mGy S-t, 0.544 mGy s-1 ,0.075 mGy s-1 and 0.027 mGy s-1, respectively, with a Global Analysis of the order of 1.17%, 1.17%, 1.14% and 1.66%, K J; 90Sr / 90Y, (74 MBq, 0.0 and 30 cm): 1.536 mGy s-1 and 0.002 mGy s-1, with Global Analysis of 1.19.0% and 5.22%, (K = 1) respectively, for the 147Pm, (0.0 and 11.0 in the interval of: 0.36 μGy s-1 and 0.43 μGy s-1, with one Global Analysis of 1 .42% and 4.28%, (K = 1), respectively; and finally for the 204TI, (0.0 cm) in the interval of 0.10 μGy s-1 with a Global Analysis of 1.27%. He calculates of the Global Analysis one carries out of agreement with those recommendations of the BIPM. In all the cases of source-detecting arrangement with separations different from zero, models of simple lineal regression were used. However for the case of the determination of the speed

  19. 17 CFR 275.204-3 - Written disclosure statements.

    Science.gov (United States)

    2010-04-01

    ... hours prior to entering into any written or oral investment advisory contract with such client or... solely to the provision of investment advisory services (i) by means of written material or oral...) through the issuance of statistical information containing no expression of opinion as to the...

  20. 20.4.Intoxication and drug-related disease

    Institute of Scientific and Technical Information of China (English)

    1992-01-01

    920183 Continuous observation of the elec-trocardiogram following experimental cere-bral hemorrhage.HAN Xiaoyu (韩筱玉),et al.Lanzhou Milit General Hosp.730050,Chin JNeurol & Psvchiat 1991; 24 (5): 295-296.Model of experimental cerebral bemorrage was

  1. 5 CFR 870.204 - Annual rates of pay.

    Science.gov (United States)

    2010-01-01

    ...) Premium pay for standby duty under 5 U.S.C. 5545(c)(1); (iii) Premium pay for overtime inspectional... officer as defined under 5 U.S.C. 8331(20) and §§ 831.902 and 842.802 of this title, premium pay for..., multiply the pay rate by the number of pay units in a 52-week work year. (c) The annual pay for a...

  2. Weld solidification cracking in 304 to 204L stainless steel

    Energy Technology Data Exchange (ETDEWEB)

    Hochanadel, Patrick W [Los Alamos National Laboratory; Lienert, Thomas J [Los Alamos National Laboratory; Martinez, Jesse N [Los Alamos National Laboratory; Johnson, Matthew Q [Los Alamos National Laboratory

    2010-09-15

    A series of annulus welds were made between 304 and 304L stainless steel coaxial tubes using both pulsed laser beam welding (LBW) and pulsed gas tungsten arc welding (GTAW). In this application, a change in process from pulsed LBW to pulsed gas tungsten arc welding was proposed to limit the possibility of weld solidification cracking since weldability diagrams developed for GTAW display a greater range of compositions that are not crack susceptible relative to those developed for pulsed LBW. Contrary to the predictions of the GTAW weldability diagram, cracking was found.This result was rationalized in terms of the more rapid solidification rate of the pulsed gas tungsten arc welds. In addition, for the pulsed LBW conditions, the material compositions were predicted to be, by themselves, 'weldable' according to the pulsed LBW weldability diagram. However, the composition range along the tie line connecting the two compositions passed through the crack susceptible range. Microstructurally, the primary solidification mode (PSM) of the material processed with higher power LBW was determined to be austenite (A), while solidification mode of the materials processed with lower power LBW apparently exhibited a dual PSM of both austenite (A) and ferrite-austenite (FA) within the same weld. The materials processed by pulsed GTAW showed mostly primary austenite solidification, with some regions of either primary austenite-second phase ferrite (AF) solidification or primary ferrite-second phase austenite (FA) solidification. This work demonstrates that variations in crack susceptibility may be realized when welding different heats of 'weldable' materials together, and that slight variations in processing can also contribute to crack susceptibility.

  3. 42 CFR 37.204 - Procedure for obtaining payment.

    Science.gov (United States)

    2010-10-01

    ... ______, (Month, Day, Year) _________ (City, County, State). 4. Place of Last Mining Employment: Name of Mine Name of Mining Company Mine Address 5. Last Job Title at Mine of Last Employment (e.g., Continuous Miner Operator, motorman, foreman, etc.) 6. Job Title of Principal Mining Occupation (that job to which...

  4. 38 CFR 3.204 - Evidence of dependents and age.

    Science.gov (United States)

    2010-07-01

    ... statement of a claimant as proof of marriage, dissolution of a marriage, birth of a child, or death of a... name and relationship of the other person to the claimant; and, where the claimant's dependent child does not reside with the claimant, the name and address of the person who has custody of the child....

  5. 48 CFR 952.204-72 - Disclosure of information.

    Science.gov (United States)

    2010-10-01

    ... educational institutions for research involving nuclear technology which could but is not expected to produce... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Disclosure of information... of information. As prescribed in 904.404(d)(4) this clause may be used in place of the...

  6. 40 CFR 6.204 - Categorical exclusions and extraordinary circumstances.

    Science.gov (United States)

    2010-07-01

    ... procedures for sustainable or “green” procurement) and contracting actions necessary to support the normal... to the public upon request. The categorical exclusions requiring this documentation are listed in... governments, or public or private entities. (viii) Actions involving approval of EPA participation...

  7. 27 CFR 27.204 - Distinctive liquor bottles.

    Science.gov (United States)

    2010-04-01

    ... such bottles are found by the appropriate TTB officer to— (1) Meet the requirements of 27 CFR part 5... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Distinctive liquor bottles..., DEPARTMENT OF THE TREASURY LIQUORS IMPORTATION OF DISTILLED SPIRITS, WINES, AND BEER Requirements for...

  8. 27 CFR 70.204 - Discharge of liens; nonjudicial sales.

    Science.gov (United States)

    2010-04-01

    ... divest the tax lien, even though notice of the nonjudicial sale is given to the appropriate TTB officer... are divested or the title to the property is transferred. (2) In the case of divestment of junior... title to the property is transferred, regardless of the date junior liens on the property are...

  9. 14 CFR 1274.204 - Costs and payments.

    Science.gov (United States)

    2010-01-01

    ... Financial Management Manual (FMM 9000). (1) There must always be sufficient funds obligated to cover the... agreements awarded to commercial firms are subject to the cost accounting standards and principles of 48 CFR... costs incurred by hospitals is determined in accordance with the provisions of Appendix E of 45 CFR...

  10. 15 CFR 904.204 - Duties and powers of Judge.

    Science.gov (United States)

    2010-01-01

    ... during the proceeding to state his or her position concerning any issue or his or her theory in support... findings; (v) Precluding the party from making a late filing or conditioning a late filing on any terms... conferences, to conduct the hearing, and to render decisions in accordance with these regulations and 5...

  11. 48 CFR 1303.204 - Treatment of violations.

    Science.gov (United States)

    2010-10-01

    ..., the information in the reply must be considered before making a decision on the appropriate action to... presentation and the information must be considered when making a decision. A decision shall be made on the... by the contractor. All mitigating factors shall be considered prior to making a final...

  12. 5 CFR 362.204 - Development, evaluation, promotion, and certification.

    Science.gov (United States)

    2010-01-01

    ... be placed, with full-time management and/or technical responsibilities consistent with the Fellow's... each Fellow and Senior Fellow with at least one rotational or developmental assignment with full-time management and/or technical responsibilities consistent with the Fellow's or Senior Fellow's IDP....

  13. Dicty_cDB: VHC204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lis mRNA for huntin... 72 4e-11 ( P51112 ) RecName: Full=Huntingtin; AltName: Full=Huntington... dise... 72 6e-11 L28827_1( L28827 |pid:none) Mouse Huntington's Disease gene homolo... 71 9e-11... ( P42859 ) RecName: Full=Huntingtin; AltName: Full=Huntington dise... 71 9e-11 AX460946_1( AX460946 |pid:no

  14. 7 CFR 25.204 - Evaluation of the strategic plan.

    Science.gov (United States)

    2010-01-01

    ... directly or through contractual or other arrangements subject a person to discrimination on the basis of race, color, creed, national origin, gender, handicap or age in its employment practices, including... Discrimination Act of 1975....

  15. 48 CFR 204.7202-1 - CAGE codes.

    Science.gov (United States)

    2010-10-01

    ...)(1) If a prospective contractor located in the United States must register in the Central Contractor... registrants must obtain a North Atlantic Treaty Organization CAGE (NCAGE) code in order to register in the CCR... dial-up capability; or (D) The Internet to access the CAGE Lookup Server at...

  16. 17 CFR 242.204 - Close-out requirement.

    Science.gov (United States)

    2010-04-01

    ... 600(b)(64) of Regulation NMS (17 CFR 242.600(b)(64)). Regulation ATS—Alternative Trading Systems...) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Regulation...

  17. 40 CFR 92.204 - Designation of engine families.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) CONTROL OF AIR POLLUTION FROM LOCOMOTIVES AND LOCOMOTIVE ENGINES Certification Provisions § 92... exhaust aftertreatment system (oxidation catalyst, particulate trap), and characteristics of...

  18. 48 CFR 803.204 - Treatment of violations.

    Science.gov (United States)

    2010-10-01

    ... receipt. In the case of a business, the D&S Committee may send the notice to any partner, principal, officer, director, owner or co-owner, or joint venture. (c) If VA does not receive a reply from...

  19. 28 CFR 2.204 - Conditions of supervised release.

    Science.gov (United States)

    2010-07-01

    ... with drug testing, possessed a firearm, or tested positive for illegal controlled substances more than... not possess a firearm, other dangerous weapon, or ammunition. (iii) The releasee shall not drink... releasee shall not enter into an agreement to act as an informer or special agent for a...

  20. Dicty_cDB: SSK204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 57 2e-07 AF466200_15( AF466200 |pid:none) Sorghum bicolor putative protein ... 57 2e-07 AY087355_1( AY087355 |pid:none) Arabidopsi.../VFO346Q.Seq.d/ 36 0.35 own update 2003.10.30 Homology vs DNA Score E Sequences producing significant alignm...FKKFLSNSNISNNLVYFKRKRVF FKIFFFILFFFFHFYFPFFFSSQ*fihyssnqiykiynlsi**lkkkikkkikkctleq Homology vs CSM-cDNA Sco...mplete sequence. 351 e-126 5 AP001118 |AP001118.1 Buchnera aphidicola str. APS (Acyrthosi...3372 |AC013372.6 Homo sapiens clone RP11-12E16, WORKING DRAFT SEQUENCE, 1 ordered pieces. 38 0.099 4 dna update 2004. 2.17 Homolog

  1. 48 CFR 31.204 - Application of principles and procedures.

    Science.gov (United States)

    2010-10-01

    ... REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT COST PRINCIPLES AND PROCEDURES Contracts With Commercial... certain items for emphasis or clarity. (b)(1) For the following subcontract types, costs incurred...

  2. 48 CFR 52.204-8 - Annual Representations and Certifications.

    Science.gov (United States)

    2010-10-01

    .... This provision applies to— (A) Solicitations for research, studies, supplies, or services of the type...) Alternate I. ___(x) 52.227-15, Representation of Limited Rights Data and Restricted Computer Software. (d... Business Operations in Sudan—Certification. This provision applies to all solicitations. (xix)...

  3. Dicty_cDB: CHF204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fhsrrydscngvtkshsiyds*sqetl*sr*ewsitlgrsy*sles*tnflwfcwyl yfimerrfrfnr*ts*s*kd*ss*vshveleerfrket...grenastqgiprattattttatttkakr*rvvi tkeetiinaik*ketcrqrrf*nirdnhw*reeggci*s*tilfscnsssnhggifnley fllciscrldne*nrlyhillf--- ---sfssv*fl...*wcyqesfni*fleprdlmkpvrvvhhfg*kllifgelnklslvllvli fhhgekvplqslnflklerlvvis*pcgigreis...AF163835 |AF163835.1 Dictyostelium discoideum cellulose synthase (dcsA) mRNA, complete cds. 1289 0.0 2 AC006...-190F19 on chromosome 10. 54 0.006 1 AC093323 |AC093323.3 Homo sapiens BAC clone RP11-539L10 from 4, complet

  4. 14 CFR 415.204-415.400 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... Schedule (§ 415.121) 7.1Launch Processing Schedule 8.0Computing Systems and Software (§ 415.123) 8... Descriptions 8.4Operator User Manuals and Documentation 8.5Software Hazard Analyses 8.6Software Test Plans, Test Procedures, and Test Results 8.7Software Development Plan 9.0Unique Safety Policies,...

  5. 48 CFR 52.204-7 - Central Contractor Registration.

    Science.gov (United States)

    2010-10-01

    ... final payment of any contract, basic agreement, basic ordering agreement, or blanket purchasing... obtain one. (1) An offeror may obtain a DUNS number— (i) Via the Internet at http://fedgov.dnb.comwebform or if the offeror does not have internet access, it may call Dun and Bradstreet at 1-866-705-5711...

  6. 48 CFR 3052.204-71 - Contractor employee access.

    Science.gov (United States)

    2010-10-01

    ... CFR 3004.470-3(b), insert a clause substantially the same as follows with appropriate alternates...) “Information Technology Resources” include, but are not limited to, computer equipment, networking equipment, telecommunications equipment, cabling, network drives, computer drives, network software, computer software,...

  7. Dicty_cDB: CHM204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 length of database: 80,480,566 effective HSP length: 17 effective length of query: 123 effective length of database: 78,821,179 eff...ective search space: 9695005017 effective search space u...ences better than 10.0: 0 length of query: 140 length of database: _,673,055,985 effective HSP length: 21 effective... length of query: 119 effective length of database: ^,756,834,679 effective search space: 5564063326801 effective

  8. Dicty_cDB: VSA204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BPLI12M7 5' end, mRNA sequence. 54 0.002 1 AW429242 |AW429242.1 EST306698 tomato flower buds 0-3 mm, Cornell...EST256982 tomato resistant, Cornell Lycopersicon esculentum cDNA clone cLER16J4,

  9. 基于聚亚甲基蓝和磁性/多孔壳纳米CoFe2O4/SiO2固定酶的葡萄糖生物传感器%Glucose biosensor based on a poly( methlene blue) and CoFe204/SiO2colloid modified platinum electrode

    Institute of Scientific and Technical Information of China (English)

    娄方明; 盛云云; 李群芳

    2011-01-01

    用循环伏安法将电子媒介体亚甲蓝电聚合在铂电极表面上,使其表面形成均匀的聚亚甲蓝膜,通过磁铁对磁性纳米材料的吸附作用将磁性纳米CoFe2O4/SiO2 吸附在聚亚甲蓝表面,接着先后吸附葡萄糖氧化酶和磁性纳米CoFe2O4/SiO2,最后用亚甲蓝包埋电极,从而制得葡萄糖氧化酶生物传感器.实验结果表明,该葡萄糖传感器的循环伏安图中氧化峰电流与葡萄糖的浓度在1.2×10-7~6.5×10-5 mol/L 范围内呈良好线性关系,相关系数r=0.9962,检出限为6.2×10-8 mol/L(S/N=3).%A good glucose biosensor was constructed based on a poly (methlene blue) and CoFe2O4/SiO2 nanoparticles modified Pt electrode. Poly (Methlene blue), CoFe204/SiO2 nanoparticles and glucose oxidase (GOD) was absorbed on electrode surface in succession. Finally, GOD and CoFe2O4/SiO2 nanoparticles were firmly immobilized on the electrode surface by the entrapment of poly (methlene blue). The biosensor has a linear responce over the concentraction of glucose in the range of 1.2 × 10-7 ~6. 5 × 10-5 moL/L with a detection limit of 6. 2 × 10-8 moL/L and a correlation coefficient of 0. 9962 ( S/N = 3 ). The biosensor exhibited high sensitivity, good repeatability and long-time stability.

  10. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  11. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE,CERN

    OpenAIRE

    Rothe, Sebastian

    2012-01-01

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spec...

  12. Inactivation of human osteosarcoma cells in vitro by {sup 211}At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, R.H. [Univ. of Oslo (Norway)]|[Institute for Cancer Research, Oslo (Norway); Bruland, O.S. [Institute for Cancer Research, Oslo (Norway); Hoff, P.; Alstad, J. [Univ. of Oslo (Norway); Lindmo, T. [Institute for Cancer Research, Oslo (Norway); Rofstad, E.K. [Norwegian Institute of Technology, Trondheim (Norway)

    1994-08-01

    The potential usefulness of {alpha}-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) {sup 211}At-TP-3 of different specific activities, (b) {sup 211}At-labeled bovine serum albumin (BSA), (c) free {sup 211}At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, {sup 211}At-BSA or free {sup 211}At. The D{sub o}`s were lower for free {sup 211}At than for {sup 211}At-BSA. The survival curves for {sup 211}At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to {sup 211}At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to {sup 211}At-TP-3 treatment was the antigen expression. Cell inactivation after {sup 211}At-TP-3 treatment increased substantially with increasing specific activity of the {sup 211}At-TP-3. At high specific activities, the cytotoxic effect of {sup 211}At-TP-3 was significantly higher than that of {sup 211}At-BSA. In conclusion, {sup 211}At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs.

  13. 14 CFR 204.3 - Applicants for new certificate or commuter air carrier authority.

    Science.gov (United States)

    2010-01-01

    ... Transportation Safety Board Regulations, 49 CFR 830.2) experienced by the applicant, its personnel, or any... held; (4) The citizenship of each; and (5) A description of the officerships, directorships, shares...

  14. Lung Collagens Perpetuate Pulmonary Fibrosis via CD204 and M2 Macrophage Activation

    OpenAIRE

    Stahl, Mirjam; Schupp, Jonas; Jäger, Benedikt; Schmid, Michael; Zissel, Gernot; Müller-Quernheim, Joachim; Prasse, Antje

    2013-01-01

    Idiopathic pulmonary fibrosis is characterized by abundant collagen production and accumulation of alternatively activated macrophages (M2) in the lower respiratory tract. Mechanisms as to how alveolar macrophages are activated by collagen breakdown products are unknown. Alveolar macrophages were obtained by bronchoalveolar lavage from 30 patients with idiopathic pulmonary fibrosis (IPF) and 37 healthy donors (HD). Alveolar macrophages were cultured in the presence of collagen type I, III, IV...

  15. 29 CFR 778.204 - “Clock pattern” premium pay.

    Science.gov (United States)

    2010-07-01

    ... pursuance of an applicable employment contract or collective bargaining agreement,” and the rates of pay and the daily and weekly work periods referred to must be established in good faith by such contract or.... (a) Overtime premiums under section 7(e)(7). Where a collective bargaining agreement or...

  16. 49 CFR 24.204 - Availability of comparable replacement dwelling before displacement.

    Science.gov (United States)

    2010-10-01

    ... requires immediate vacation of the real property, such as when continued occupancy of the displacement dwelling constitutes a substantial danger to the health or safety of the occupants or the public. (c)...

  17. 48 CFR 1852.204-76 - Security requirements for unclassified information technolocgy resources.

    Science.gov (United States)

    2010-10-01

    ... NASA approval an IT Security Plan, Risk Assessment, and FIPS 199, Standards for Security Categorization...-Assessment Guide for Information Technology Systems, and FIPS 200, on a yearly basis. (ii) The risk assessment shall be prepared consistent, in form and content, with NIST SP 800-30, Risk Management Guide...

  18. 25 CFR 162.204 - Must notice of applicable tribal laws and leasing policies be provided?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Must notice of applicable tribal laws and leasing... applicable tribal laws and leasing policies be provided? (a) A tribe must provide us with an official copy of any tribal law or leasing policy that supersedes or modifies these regulations under §§ 162.109 or...

  19. 8 CFR 204.5 - Petitions for employment-based immigrants.

    Science.gov (United States)

    2010-01-01

    ..., the fee specified in 8 CFR 103.7(b)(1), and supporting evidence filed as provided by this part.... Upon debarment by the Department of Labor pursuant to 20 CFR 655.31, USCIS may deny any employment... members of the religion. Examples of individuals practicing religious vocations include nuns, monks,...

  20. Setting up and Running a School Library. Information Collection and Exchange Publication No. ED204

    Science.gov (United States)

    Baird, Nicola

    2012-01-01

    This book explains how teachers can set up and run a successful school library. In it you will find advice and information on how to: (1) set up a small library and build bookshelves; (2) select books for your library; (3) make a written record of your school's books, pamphlets and other library stock such as newspapers, magazines, audio tapes and…

  1. 31 CFR 500.204 - Importation of and dealings in certain merchandise.

    Science.gov (United States)

    2010-07-01

    ..., North Viet-Nam, Cambodia, or South Viet-Nam. Articles which are the growth, produce or manufacture of... is North Korea, North Viet-Nam, Cambodia, or South Viet-Nam, notwithstanding that they may have been... merchandise whose country of origin is North Korea, North Viet-Nam, Cambodia, or South Viet-Nam, if......

  2. Tank 241-U-204 headspace gas and vapor characterization results for samples collected in August 1995

    International Nuclear Information System (INIS)

    Significant changes have been made to all of the original vapor characterization reports. This report documents specific headspace gas and vapor characterization results for all vapor sampling events to date. In addition, changes have been made to the original vapor reports to qualify the data based on quality assurance issues associated with the performing laboratories

  3. 38 CFR 1.204 - Information to be reported to the Office of Inspector General.

    Science.gov (United States)

    2010-07-01

    ... Government property over $1000, false claims, false statements, drug offenses, crimes involving information technology systems and serious crimes against the person, i.e., homicides, armed robbery, rape,...

  4. 8 CFR 204.4 - Amerasian child of a United States citizen.

    Science.gov (United States)

    2010-01-01

    ... ID card must be submitted, if available. If it is not available, the petitioner must submit an affidavit explaining why the beneficiary's ID card is not available. Evidence that the beneficiary was... emigration must be received from the beneficiary's mother or legal guardian. The mother or legal...

  5. Modified Precipitation Route for Preparation of Nanocrystalline NiFe204

    Czech Academy of Sciences Publication Activity Database

    Ćosović, V.; Ćosović, A.; Živković, D.; Žák, Tomáš; David, Bohumil; Talijan, N.

    Belgrade : Serbian Ceramic Society, 2013 - (Mitić, V.; Obradović, N.; Mančić, L.). s. 30-30 ISBN 978-86-915627-1-7. [Advanced Ceramics And Application. 30.09.2013-01.10.2013, Belgrade] Institutional support: RVO:68081723 Keywords : nanocrystalline NiFe2O4 * precipitation method * structural analysis * magnetic properties Subject RIV: BM - Solid Matter Physics ; Magnetism

  6. 48 CFR 9.204 - Responsibilities for establishment of a qualification requirement.

    Science.gov (United States)

    2010-10-01

    ... establish qualification requirements include the following: (a) Arranging publicity for the qualification... advertising or publicity is permitted. However, it must not be stated or implied that a particular product or... when— (1) The manufacturer has modified its product, or changed the material or the...

  7. 7 CFR 205.204 - Seeds and planting stock practice standard.

    Science.gov (United States)

    2010-01-01

    ... and planting stock may be used to produce an organic crop when an equivalent organically produced...) Nonorganically produced planting stock to be used to produce a perennial crop may be sold, labeled, or... stock treated with prohibited substances may be used to produce an organic crop when the application...

  8. Herman Paul. (2011. Hayden White: The Historical Imagination. Cambridge: Polity Press [204 pp.

    Directory of Open Access Journals (Sweden)

    Ariel C. Lopez

    2011-12-01

    Full Text Available Ang akdang ito ni Herman Paul ay isang kritikal na pagsasakasaysayan(historicization ng mga ideya ni Hayden White na maibibilang sapinakamahahalagang pilosopo ng kasaysayan ng kontemporaryong panahon.Si White ay tanyag bilang simbolo par excellence ng postmodernistang kasaysayan na reaksyon laban sa noo’y, at hanggang ngayo’y, namamayaning positibistang pananaw (na inuugat sa Alemang historyador ng ika-19 na dantaon na si Leopold von Ranke. Noong Dekada ’50 pa lang, masusulyapan na ang pagsalungat ni White sa tradisyong positibista nang tawagin niya si Ranke bilang “kawawang nilalang na nagkandabulag sa paghahanap ng ‘kung ano ang tunay na nangyari’”(Paul, 2011, p.105. Para kay White, ang nakaraan per se (bilang nakaraan ay isang “walang-kahulugang katotohanan” (meaningless reality lamang. Binibigyang kahulugan ng mga historyador ang nakaraan sa pamamagitan ng mga naratibo na siyang humuhugis at nagtatakda sa kahulugan. Sa magnum opus ni White na pinamagatang Metahistory: The Historical Imagination in Nineteenth-Century Europe (1973, inilalatag niya ang ibat-ibang pagbabanghay (emplotment at tropos (tropesna implisitong sinusundan at sinasandigan ng mga (positibistang historyador upang magkaroon ng makatotohanang naratibo.

  9. Decree No. 80-204 of 11 March 1980 concerning mining rights

    International Nuclear Information System (INIS)

    This Decree repeals a Decree of 29 October 1970 on the same subject. However, it does not amend the Mining Code presently in Force, which contains provisions of substance governing mining resarch and exploitation. In connection with substances of use for atomic energy, any projects for taking out, modifying or suppressing mining rights must, as in the past, be submitted to the Committee for Atomic Energy before the file is forwarded to the General Council for Mines. It is now laid down that the Committee for Atomic Energy must take its decision within one month. The previous text contained no provision concerning a time-limit in this respect. (NEA)

  10. CLOSURE REPORT FOR CORRECTIVE ACTION UNIT 204: STORAGE BUNKERS, NEVADA TEST SITE, NEVADA

    International Nuclear Information System (INIS)

    Corrective Action Unit (CAU) 330 consists of four Corrective Action Sites (CASs) located in Areas 6, 22, and 23 of the Nevada Test Site (NTS). The unit is listed in the Federal Facility Agreement and Consent Order (FFACO, 1996) as CAU 330: Areas 6, 22, and 23 Tanks and Spill Sites. CAU 330 consists of the following CASs: CAS 06-02-04, Underground Storage Tank (UST) and Piping CAS 22-99-06, Fuel Spill CAS 23-01-02, Large Aboveground Storage Tank (AST) Farm CAS 23-25-05, Asphalt Oil Spill/Tar Release

  11. CWSP Certified Wireless Security Professional Official Study Guide, Exam PW0-204

    CERN Document Server

    Coleman, David D; Harkins, Bryan E

    2010-01-01

    Sybex is now the official publisher for Certified Wireless Network Professional, the certifying vendor for the CWSP program. This guide covers all exam objectives, including WLAN discovery techniques, intrusion and attack techniques, 802.11 protocol analysis. Wireless intrusion-prevention systems implementation, layer 2 and 3 VPNs used over 802.11 networks, and managed endpoint security systems. It also covers enterprise/SMB/SOHO/Public-Network Security design models and security solution implementation, building robust security networks, wireless LAN management systems, and much more.

  12. 42 CFR 411.204 - Medicare benefits secondary to LGHP benefits.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Medicare benefits secondary to LGHP benefits. 411... benefits secondary to LGHP benefits. (a) Medicare benefits are secondary to benefits payable by an LGHP for services furnished during any month in which the individual— (1) Is entitled to Medicare Part A...

  13. 17 CFR 275.204-2 - Books and records to be maintained by investment advisers.

    Science.gov (United States)

    2010-04-01

    ... defined in § 275.203(b)(3)-1), and the adviser or any related person (as defined in Form ADV (17 CFR 279.1..., see the List of CFR Sections Affected, which appears in the Finding Aids section of the printed volume... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Books and records to...

  14. Deep Ly alpha imaging of two z=2.04 GRB host galaxy fields

    DEFF Research Database (Denmark)

    Fynbo, J.P.U.; Møller, Per; Thomsen, Bente; Hjorth, J.; Gorosabel, J.; Andersen, M.I.; Egholm, M.P.; Jensen, B.L.; Pedersen, H.; Weidinger, M.

    2002-01-01

    spectral slopes (f(lambda) proportional to lambda(beta)) of the two components to beta = 2.4 +/- 0.3 (east)and -1.4 +/- 0.2 (west). This implies that both components contain at most small amounts of dust, consistent with the observed strong Lyalpha emission. The western component has a slightly redder V...... - I colour than the eastern component, suggesting the presence of at least some dust. We do not detect the host galaxy of GRB 000301C in neither Lyalpha emission nor in U and I broad-band images. The strongest limit comes from combining the narrow and U-band imaging where we infer a limit of U...... are candidate Lyalpha emitting galaxies in the environment of the host galaxies. Based on these detections we conclude that GRB 000926 occurred in one of the strongest centres of star formation within several Mpc, whereas GRB 000301C occurred in an intrinsically very faint galaxy far from being the...

  15. 23 CFR 636.204 - What items may be included in a phase-one solicitation?

    Science.gov (United States)

    2010-04-01

    ... in any phase-one solicitation: (a) The scope of work; (b) The phase-one evaluation factors and their... price related factors, which are not permitted in phase-one); (c) Phase-two evaluation factors; and...

  16. 8 CFR 204.2 - Petitions for relatives, widows and widowers, and abused spouses and children.

    Science.gov (United States)

    2010-01-01

    ... appeal in accordance with the provisions of 8 CFR 3.3. (4) Derivative beneficiaries. No alien may be... right to appeal in accordance with the provisions of 8 CFR 3.3. (4) Derivative beneficiaries. A child of...: money order receipts or cancelled checks showing the father's financial support of the beneficiary;...

  17. CLOSURE REPORT FOR CORRECTIVE ACTION UNIT 204: STORAGE BUNKERS, NEVADA TEST SITE, NEVADA

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-04-01

    Corrective Action Unit (CAU) 330 consists of four Corrective Action Sites (CASs) located in Areas 6, 22, and 23 of the Nevada Test Site (NTS). The unit is listed in the Federal Facility Agreement and Consent Order (FFACO, 1996) as CAU 330: Areas 6, 22, and 23 Tanks and Spill Sites. CAU 330 consists of the following CASs: CAS 06-02-04, Underground Storage Tank (UST) and Piping CAS 22-99-06, Fuel Spill CAS 23-01-02, Large Aboveground Storage Tank (AST) Farm CAS 23-25-05, Asphalt Oil Spill/Tar Release

  18. 48 CFR 52.204-6 - Data Universal Numbering System (DUNS) Number.

    Science.gov (United States)

    2010-10-01

    ...) Via the Internet at http://fedgov.dnb.com/webform or if the offeror does not have internet access, it... business name. (ii) Tradestyle, doing business, or other name by which your entity is commonly recognized... of business (industry). (x) Company Headquarters name and address (reporting relationship within...

  19. Working Paper 204 - Skills and Youth Entrepreneurship in Africa: Analysis with Evidence from Swaziland

    OpenAIRE

    Zuzana Brixiova; Mthuli Ncube

    2014-01-01

    The shortages of entrepreneurial skillshave lowered search effectiveness of potential young entrepreneurs and the rate of youth start-ups. Our paper contributes to closing a gap in the entrepreneurship and development literature with a model of costly firm creation and skill differences between young and adult entrepreneurs. The model shows that for young entrepreneurs facing high cost of searching for business opportunities, support for training is more effective in stimulating productive st...

  20. 42 CFR 51b.204 - What information is required in the application?

    Science.gov (United States)

    2010-10-01

    ... within 48 hours. (v) A system for monitoring vaccine-associated reactions including a mechanism for responding to persons with vaccine-related complaints. (vi) A plan to systematically immunize susceptible... clinics. (iii) A plan for surveillance of vaccine-preventable diseases that includes morbidity...

  1. People and things. CERN Courier, June 1980, v. 20(4)

    International Nuclear Information System (INIS)

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events: On 25th April at a specially convened session of the CERN Council delegates of the twelve CERN Member States unanimously appointed Professor Herwig Schopper as Director General of CERN for the five years 1981-85; On 1 April, His Royal Highness Prince Charles went on a short tour of the TRIUMF site during a visit to Vancouver; An International Symposium on the History of Particle Physics was held at Fermilab from 28-31 May. It concentrated on the origins of particle physics back in the 1930s and 40s before the advent of the big particle accelerators; The Regents of the University of California have approved the formation of a new Institute for Particle Physics on its Santa Cruz Campus. Acronymed SCIPP (the Santa Cruz Institute for Particle Physics I it builds on the strength of existing groups of theoretical and experimental particle physicists; On 18 April, Fermilab brought into operation the world's largest helium liquefier plant; During a few shifts devoted to machine developments on 20 April, the stored beam of PETRA reached the design energy of 19 GeV. ; Earlier this year, a high energy physics meeting, organized by the Academia Sinica, was held in the pleasant winter climate of Guangzhou, Canton.; At a Physics Congress in Ulm the Chancellor of the Federal Republic of Germany, Helmut Schmidt, voiced his unambiguous support for fundamental research

  2. 48 CFR 51.204 - Use of interagency fleet management system (IFMS) vehicles and related services.

    Science.gov (United States)

    2010-10-01

    ... system (IFMS) vehicles and related services shall comply with the requirements of 41 CFR 101-39 and 41 CFR 101-38.301-1 and the operator's packet furnished with each vehicle. See 41 CFR 101-6.4 for... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Use of interagency...

  3. 48 CFR 52.204-10 - Reporting Executive Compensation and First-Tier Subcontract Awards.

    Science.gov (United States)

    2010-10-01

    ... 17 CFR 229.402(c)(2)): (1) Salary and bonus. (2) Awards of stock, stock options, and stock... performance of a prime contract, but excludes supplier agreements with vendors, such as long-term arrangements... plans. (5) Above-market earnings on deferred compensation which is not tax-qualified. (6)...

  4. 7 CFR 1744.204 - Rural development investments that do not meet the ratio requirements.

    Science.gov (United States)

    2010-01-01

    ...: (1) A description of the rural development project and the type of investment to be made, such as a... RUS's approval, the portion of any investment of funds or commitment to invest funds for any rural development investment that will exceed the borrower's maximum investment ratio or cause the borrower to...

  5. Orthodontic and dysfunctional abnormalities of stomatognatic apparatus: radiographic analysis of 204 subjects

    International Nuclear Information System (INIS)

    Two hundred and four subjects (86 males and 118 females), aged 8 to 35 years, with different types of malocclusion, underwent panoramic dental radiography and skull teleradiography. This study was aimed at investigating advantages and limitations of the two radiographic techniques, in view of their use as screening methods. On orthopan-tomography, inferior interincisive point, menthon (Me), and, bilaterally, gonion (Go) and condilion (Co), were localized so as to allow a model of the right and left jaws to be made. On teleradiography of the skull, in lateral view, Steiner's cephalometric analysis allowed skeletal classes to be evaluated according to ANB angle values. More-over, major postural parameters relative to the relationship between skull and cervical spine were analyzed: atlanto-occipital distance, cranio-vertebral angle, cervical lordosis, and hyoid triangle. Orthopan-tomography, though not a reproducible technique, can be considered as a valuable screening method for it allows right and left hemi-jaws to be comparatively measured. Cephalometric analysis of postural data confirmed the frequency of wrong postures in orthodontic patients. From the correlation of mandibular asymmetries and cranio-cervical parameters, the authors observed that asymmetrical patients have many postural problems, just like class II skeletal and dolico-facial types. This findings seems to confirm the mixed (functional and skeletal) etiopathogenesis of mandibular asymmetries

  6. 41 CFR 50-204.21 - Exposure of individuals to radiation in restricted areas.

    Science.gov (United States)

    2010-07-01

    ... January: Provided, That the second, third, and fourth periods accordingly begin on the same date in April..., shall not exceed 5 (N-18) rems, where “N” equals the individual's age in years at his last birthday; and... who is under 18 years of age to receive in any period of one calendar quarter a dose in excess of...

  7. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (204b-0613-272217)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National OceanService, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  8. 20 CFR 703.204 - Decision on insurance carrier's application; minimum amount of deposit.

    Science.gov (United States)

    2010-04-01

    ... carrier must deposit to fully secure payment of its unsecured obligations. The Branch will transmit its... exposure for LHWCA coverage; and (6) Carrier's payment history in satisfying its LHWCA obligations. (c) In... on the Internet at http://www.dol.gov/esa/owcp/dlhwc/lstable.htm for both the current rating year...

  9. 40 CFR 141.204 - Tier 3 Public Notice-Form, manner, and frequency of notice.

    Science.gov (United States)

    2010-07-01

    ... copies in central locations (e.g., community centers). (d) In what situations may the Consumer Confidence Report be used to meet the Tier 3 public notice requirements? For community water systems, the Consumer Confidence Report (CCR) required under Subpart O of this part may be used as a vehicle for the initial Tier...

  10. Operations and maintenance manual, atmospheric contaminant sensor. Addendum 1: Carbon monoxide monitor model 204

    Science.gov (United States)

    1972-01-01

    An instrument for monitoring the carbon monoxide content of the ambient atmosphere is described. The subjects discussed are: (1) theory of operation, (2) system features, (3) controls and monitors, (4) operational procedures, and (5) maintenance and troubleshooting. Block drawings and circuit diagrams are included to clarify the text.

  11. 24 CFR 203.204 - Requirements and limitations of a plan.

    Science.gov (United States)

    2010-04-01

    ... structural defect claim, Plans must, unless prohibited by applicable law, provide for binding arbitration... time of settlement. In the case of optional coverage beyond the coverage required under § 203.205, the... protection measures. (f) Unless prohibited by applicable law, Plans must, at a minimum, stipulate that...

  12. 40 CFR 204.59 - Recall of non-complying compressors.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recall of non-complying compressors... Recall of non-complying compressors. (a) Pursuant to section 11(d)(1) of the Act, the Administrator may issue an order to the manufacturer to recall and repair or modify any compressor distributed in...

  13. Business and Office Education: Accounting, Clerk. Instructor's Manual [and] Student Learning Activity Guide. Kit No. 204.

    Science.gov (United States)

    Cliatt, Katherine H.

    This learning activity guide and instructor's manual provide information and exercises for an exploratory activity in accounting. Instructional objectives covered in the guide are for the students to learn (1) reasons for studying accounting and related job descriptions, (2) definitions for accounting terms, (3) the accounting equation, (4) how to…

  14. 48 CFR 1315.204-570 - Part IV representations and instructions.

    Science.gov (United States)

    2010-10-01

    ... officer shall insert the provision similar to 1352.215-74, Best Value Evaluation, for competitive, best..., Cost or Pricing Data, in all solicitations when cost or pricing data is required under FAR subpart 15.4....

  15. Shelf-Life of ɛ-Lysyl-3-(Trimethylstannyl)Benzamide Immunoconjugates, Precursors for 211At Labeling of Antibodies

    OpenAIRE

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per; Jensen, Holger; Holgersson, Stellan; Lindegren, Sture

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity and the complex radiochemistry of 211At are major obstacles for research and prospective clinical applications. In the present study, astatination of immunoconjugates, already prepared well in advance...

  16. Study on 204 birth defects of the prenatal in the city of Taiyuan from 1997 to 2008%1997年-2008年太原地区204例出生缺陷回顾性分析

    Institute of Scientific and Technical Information of China (English)

    闫惠娜; 张月莲; 郑梅玲

    2012-01-01

    目的 了解1997年-2008年间太原市出生缺陷发生情况,为进一步制定干预措施提供依据.方法 将1997年-2008年12年中在我院妇产科终止妊娠的出生缺陷忠儿按年限分为1997年-2002年(前六年)组和2003年-2008年(后六年),并对其种类、发生率及城乡分布进行回顾性分析.结果 (1) 12年中神经管畸形的发生率为56.11/万,居于首位,占全部出生缺陷的32.35%,虽然后六年的神经管畸形的发生率低于前6年,但无统计学差异(x2=3.70,P>0.05).(2)后6年中28W前B超诊断率(1.12%)比前六年(0.41%)显著提高(x2=7.49,P<0.05).(3)前6年中城市与农村出生缺陷发生率分别为133.94/万、545.45/万,后6年城市与农村出生缺陷发生率分别为129.64/万、436.50/万,(x2=42.27,P<0.05; x2 =44.47,P<0.05)农村的平均发生率为城市的3.7倍,明显高于城市.结论 神经管畸形的发生在我省仍较为突出,只有加强对神经管畸形的预防,加强优生优育知识的宣传,改善农村生活环境,提高产前诊断率水平,才有可能有效性地降低出生缺陷的发生.%Objective: In order to formulate for further interventions, investigated the types, time of making a definite diagnosis, incidence of prenatal death defects in the city of Taiyuan, from 1997 to 2008. Methods; made two different groups, the first group form the year of 1997 to 2002 and the second group form the year of 2003 to 2008. Results: (1) The most of birth defects were Neural Tube defects and the percentage was 32. 35. (2) Morbidity by B ultrasound before 28w compare to after 28w were different between 1997 - 2002 and 2003 - 2008. (x2 = 7.49, P < 0.05 ) , the later six years' diagnostic rate of type - B ultrasonic before 28w was higher than the one of former six years. (3) Incidence of death defects were relate to the gravidas's place of residence, the gravidas' s birth defect rate form countries was higher than who form the cities whatever the first group or the second group, (x2 =42. 27 , P < 0.05 ;x2 = 44.47, P < 0.05 ). Conclusion: The most of birth defects were Neural Tube defects in Shanxi, to improve consciousness of maternal health care, to improve are effective measures to decrease the birth defect rate.

  17. SU-C-204-07: The Production of Short-Lived Positron Emitters in Proton Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Buitenhuis, H J T; Dendooven, P; Biegun, A K; Goethem, M-J van; Graaf, E R van der; Brandenburg, S [University of Groningen, Groningen (Netherlands); Diblen, F [University of Groningen, Groningen (Netherlands); Ghent University, Ghent (Belgium)

    2015-06-15

    Purpose: To investigate the production and effect of short-lived positron emitters when using PET for in-vivo range verification during a proton therapy irradiation. Methods: The integrated production of short-lived positron emitters in the stopping of 55 MeV protons was measured in water, carbon, phosphorus and calcium targets. The experimental production rates are used to calculate the production on PMMA and a representative set of 4 tissue materials. The number of decays integrated over an irradiation in these materials is calculated as function of the duration of the irradiation, considering irradiations with the same total number of protons. Results: The most copiously produced short-lived nuclides and their production rates relative to the relevant long-lived nuclides are: 12-N (T1/2 = 11 ms) on carbon (9.5% of the 11-C production), 29-P (T1/2 = 4.1 s) on phosphorus (20% of the 30-P production) and 38m-K (T1/2 = 0.92 s) on calcium (113% of the 38g-K production). No short-lived nuclides are produced on water. The most noticeable Result is that for an irradiation in (carbon-rich) adipose tissue, 12-N will dominate the PET image up to an irradiation duration of 70 s. On bone tissue, 15-O dominates over 12-N after 7–15 s (depending on the carbon-to-oxygen ratio). Conclusions: The presence of 12-N needs to be considered in PET imaging during proton beam irradiations as, depending on tissue composition and PET scanning protocol, it may noticeably deteriorate image quality due to the large positron range blurring. The results presented warrant investigations into the energy-dependent production of 12-N, 29-P and 38m-K and their effect on PET imaging during proton irradiations.

  18. SU-D-204-01: Dual-Energy Calibration for Breast Density Measurement Using Spectral Mammography

    Energy Technology Data Exchange (ETDEWEB)

    Ding, H; Cho, H; Kumar, N; Sennung, D; Molloi, S [Department of Radiological Sciences, University of California, Irvine, CA (United States)

    2015-06-15

    Purpose: To investigate the feasibility of minimizing the systematic errors in dual-energy breast density quantification induced by the use of tissue-equivalent plastic phantoms as the calibration basis materials. Methods: Dual-energy calibration using tissue-equivalent plastic phantoms was performed on a spectral mammography system based on scanning multi-slit Si strip photon-counting detectors. The plastic phantom calibration used plastic water and adipose-equivalent phantoms as the basis materials, which have different x-ray attenuation properties compared to water and lipid in actual breast tissue. Two methods were used to convert the dual-energy decomposition measurements in plastic phantom thicknesses into true water and lipid basis. The first method was based entirely on the theoretical x-ray attenuation coefficients of the investigated materials in the mammographic energy range. The conversion matrix was determined from least-squares fitting of the target material using the reported attenuation coefficients of water and lipid. The second method was developed based on experimental calibrations, which measured the low-and high-energy signals of pure water and lipid of known thicknesses. A non-linear rational function was used to correlate the decomposed thicknesses to the known values, so that the conversion coefficients can be determined. Both methods were validated using independent measurements of water and lipid mixture phantoms. The correlation of the dual-energy decomposition measurements and the known values were studied with linear regression analysis. Results: There was an excellent linear correlation between the converted water thicknesses and the known values. The slopes of the linear fits were determined to be 0.63 and 1.03 for the simulation and experimental results, respectively. The non-linear fitting in the experimental approach reduced the root-mean-square (RMS) errors from approximately 3.4 mm to 1.5 mm. Conclusion: The results suggested that conversion of the dual-energy measurements into water and lipid thicknesses minimized the systematic errors in tissue decomposition studies.

  19. 8 CFR 204.309 - Factors requiring denial of a Form I-800A or Form I-800.

    Science.gov (United States)

    2010-01-01

    ... arrest, conviction, or history of substance abuse, sexual abuse or child abuse, and/or family violence... additional member of the household concerning the arrest, conviction, or history of substance abuse, sexual abuse, child abuse, and/or family violence, or any other criminal history as an offender; the fact...

  20. SU-C-204-07: The Production of Short-Lived Positron Emitters in Proton Therapy

    International Nuclear Information System (INIS)

    Purpose: To investigate the production and effect of short-lived positron emitters when using PET for in-vivo range verification during a proton therapy irradiation. Methods: The integrated production of short-lived positron emitters in the stopping of 55 MeV protons was measured in water, carbon, phosphorus and calcium targets. The experimental production rates are used to calculate the production on PMMA and a representative set of 4 tissue materials. The number of decays integrated over an irradiation in these materials is calculated as function of the duration of the irradiation, considering irradiations with the same total number of protons. Results: The most copiously produced short-lived nuclides and their production rates relative to the relevant long-lived nuclides are: 12-N (T1/2 = 11 ms) on carbon (9.5% of the 11-C production), 29-P (T1/2 = 4.1 s) on phosphorus (20% of the 30-P production) and 38m-K (T1/2 = 0.92 s) on calcium (113% of the 38g-K production). No short-lived nuclides are produced on water. The most noticeable Result is that for an irradiation in (carbon-rich) adipose tissue, 12-N will dominate the PET image up to an irradiation duration of 70 s. On bone tissue, 15-O dominates over 12-N after 7–15 s (depending on the carbon-to-oxygen ratio). Conclusions: The presence of 12-N needs to be considered in PET imaging during proton beam irradiations as, depending on tissue composition and PET scanning protocol, it may noticeably deteriorate image quality due to the large positron range blurring. The results presented warrant investigations into the energy-dependent production of 12-N, 29-P and 38m-K and their effect on PET imaging during proton irradiations

  1. 8 CFR 204.13 - How can the International Broadcasting Bureau of the United States Broadcasting Board of...

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false How can the International Broadcasting Bureau of the United States Broadcasting Board of Governors petition for a fourth preference special... Broadcasting Bureau of the United States Broadcasting Board of Governors petition for a fourth...

  2. LOSCAR: Long-term Ocean-atmosphere-Sediment CArbon cycle Reservoir Model v2.0.4

    Directory of Open Access Journals (Sweden)

    R. E. Zeebe

    2012-01-01

    Full Text Available The LOSCAR model is designed to efficiently compute the partitioning of carbon between ocean, atmosphere, and sediments on time scales ranging from centuries to millions of years. While a variety of computationally inexpensive carbon cycle models are already available, many are missing a critical sediment component, which is indispensable for long-term integrations. One of LOSCAR's strengths is the coupling of ocean-atmosphere routines to a computationally efficient sediment module. This allows, for instance, adequate computation of CaCO3 dissolution, calcite compensation, and long-term carbon cycle fluxes, including weathering of carbonate and silicate rocks. The ocean component includes various biogeochemical tracers such as total carbon, alkalinity, phosphate, oxygen, and stable carbon isotopes. LOSCAR's configuration of ocean geometry is flexible and allows for easy switching between modern and paleo-versions. We have previously published applications of the model tackling future projections of ocean chemistry and weathering, pCO2 sensitivity to carbon cycle perturbations throughout the Cenozoic, and carbon/calcium cycling during the Paleocene-Eocene Thermal Maximum. The focus of the present contribution is the detailed description of the model including numerical architecture, processes and parameterizations, tuning, and examples of input and output. Typical CPU integration times of LOSCAR are of order seconds for several thousand model years on current standard desktop machines. The LOSCAR source code in C can be obtained from the author by sending a request to loscar.model@gmail.com.

  3. 5 CFR 2641.204 - One-year restriction on any former senior employee's representations to former agency concerning...

    Science.gov (United States)

    2010-01-01

    ... accepts a senior employee position at the Export-Import Bank of the United States (Ex-Im Bank) where she... Schedule, within the meaning of the definition of senior employee in § 2641.104, the employee's hourly...

  4. Network Modeling Identifies Molecular Functions Targeted by miR-204 to Suppress Head and Neck Tumor Metastasis

    OpenAIRE

    Lee, Younghee; Yang, Xinan; Huang, Yong; FAN, HANLI; Zhang, Qingbei; Wu, Youngfei; Li, Jianrong; Hasina, Rifat; Cheng, Chao; Lingen, Mark W.; Gerstein, Mark B.; Weichselbaum, Ralph R.; Xing, H. Rosie; Lussier, Yves A.

    2010-01-01

    Due to the large number of putative microRNA gene targets predicted by sequence-alignment databases and the relative low accuracy of such predictions which are conducted independently of biological context by design, systematic experimental identification and validation of every functional microRNA target is currently challenging. Consequently, biological studies have yet to identify, on a genome scale, key regulatory networks perturbed by altered microRNA functions in the context of cancer. ...

  5. [Radiodiagnosis of orthodontic and dysfunctional anomalies of the stomatognathic system: analysis of a sample of 204 patients].

    Science.gov (United States)

    Scutellari, P N; Capurso, U; Orzincolo, C; Rotolo, L; Calura, G

    1990-12-01

    Two hundred and four subjects (86 males and 118 females), aged 8 to 35 years, with different types of malocclusion, underwent panoramic dental radiography and skull teleradiography. This study was aimed at investigating advantages and limitations of the two radiographic techniques, in view of their use as screening methods. On orthopantomography, inferior interincisive point, menthon (Me), and, bilaterally, gonion (Go) and condilion (Co), were localized so as to allow a model of the right and left jaws to be made. On teleradiography of the skull, in lateral view, Steiner's cephalometric analysis allowed skeletal classes to be evaluated according to ANB angle values. Moreover, major postural parameters relative to the relationship between skull and cervical spine were analyzed: atlanto-occipital distance, cranio-vertebral angle, cervical lordosis, and hyoid triangle. Orthopantomography, though not a reproducible technique, can be considered as a valuable screening method for it allows right and left hemi-jaws to be comparatively measured. Cephalometric analysis of postural data confirmed the frequency of wrong postures in orthodontic patients. From the correlation of mandibular asymmetries and cranio-cervical parameters, the authors observed that asymmetrical patients have many postural problems, just like class II skeletal and dolico-facial types. This finding seems to confirm the mixed (functional and skeletal) etiopathogenesis of mandibular asymmetries. PMID:2281163

  6. Multifrequency Radio Observations of a SNR in the LMC. The Case of SNR J0527-6549 (DEM L204

    Directory of Open Access Journals (Sweden)

    Bozzetto, L. M.

    2010-12-01

    Full Text Available We present a detailed study and results of new Australia Telescope Compact Array (ATCA observations of supernova remnant SNR J0527-6549. This Large Magellanic Cloud (LMC object follows a typical supernova remnant (SNR horseshoe morphology with a diameter of D=(66$imes$58$pm$1~pc which is among the largest SNRs in the LMC. Its relatively large size indicates older age while a steeper than expected radio spectral index of $alpha$=-0.92$pm$0.11 is more typical of younger and energetic SNRs. Also, we report detections of regions with a high order of polarization at a peak value of $sim$ 54 per cent $pm$ 17 per cent at 6~cm.

  7. Oahu Hyperspectral Imagery 2000 (204b-0613-272217)- Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  8. Oahu Hyperspectral Imagery 2000 (204a-0613-332211) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  9. 9 CFR 93.204 - Import permits for poultry and for poultry test specimens for diagnostic purposes; and...

    Science.gov (United States)

    2010-01-01

    ... name and address of the importer; the species, breed, number or quantity of poultry or poultry test... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Import permits for poultry and for poultry test specimens for diagnostic purposes; and reservation fees for space at quarantine...

  10. 78 FR 1299 - Waiver and Certification of Statutory Provisions of Section 1003 of Public Law 100-204 Regarding...

    Science.gov (United States)

    2013-01-08

    ... between Israel and the Palestinians, and waive the provisions of section 1003 of the Anti-Terrorism Act of... Programs Appropriations Act, 2012 (Pub. L. 112-74, Div. I), as carried forward by the Continuing Appropriations Act, 2013, the Delegation of Authority in the President's Memorandum of July 21, 2010,...

  11. SU-C-204-05: Simulations of a Portal Imaging System for Conformal and Intensity Modulated Fast Neutron Therapy

    International Nuclear Information System (INIS)

    Purpose: The University of Washington Medical Center offers neutron therapy for the palliative and definitive treatment of selected cancers. In vivo field verification has the potential to improve the safe and effective delivery of neutron therapy. We propose a portal imaging method that relies on the creation of positron emitting isotopes (11C and 15O) through (n, 2n) reactions with a PMMA plate placed below the patient. After field delivery, the plate is retrieved from the vault and imaged using a reader that detects annihilation photons. The spatial pattern of activity produced in the PMMA plate provides information to reconstruct the neutron fluence map needed to confirm treatment delivery. Methods: We used MCNP to simulate the accumulation of 11C activity in a slab of PMMA 2 mm thick, and GATE was used to simulate the sensitivity and spatial resolution of a prototype imaging system. BGO crystal thicknesses of 1 cm, 2 cm and 3 cm were simulated with detector separations of 2 cm. Crystal pitches of 2 mm and 4 mm were evaluated. Back-projection of the events was used to create a planar image. The spatial resolution was taken to be the FWHM of the reconstructed point source image. Results: The system sensitivity for a point source in the center of the field of view was found to range from 58% for 1 cm thick BGO with 2 mm crystal pitch to 74% for the 3 cm thick BGO crystals with 4 mm crystal pitch. The spatial resolution at the center of the field of view was found to be 1.5 mm for the system with 2 mm crystal pitch and 2.8 mm for the system with the 4 mm crystal pitch. Conclusion: BGO crystals with 4 mm crystal pitch and 3 cm length would offer the best sensitivity reader

  12. Andrés Barba, Versiones de Teresa : Anagrama, Barcelona, 2006, 204 pp.

    OpenAIRE

    Pellicer, Gemma

    2008-01-01

    Andrés Barba (Madrid, 1975) se dio a conocer como escritor con la novela corta El hueso que más duele (Premio Ramón J. Sender 1997), a la que siguieron La hermana de Katia (finalista del Premio Herralde 2001), Ahora tocad música de baile (2004) y Versiones de Teresa (Premio Torrente Ballester 2005), la novela que aquí nos ocupa. También cuenta en su haber con un libro de relatos, La recta intención (2002) y otro infantil, Historia de nadas (2006). Licenciado en Filología Hispánica por la Univ...

  13. Shelf-life of ɛ-lysyl-3-(trimethylstannyl)benzamide immunoconjugates, precursors for 211At labeling of antibodies

    DEFF Research Database (Denmark)

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per;

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity ...

  14. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  15. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    International Nuclear Information System (INIS)

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons

  16. Separation of 211At from irradiated bismuth target and labelling of a model protein

    International Nuclear Information System (INIS)

    Astatine-211 is a promising radionuclide for therapeutic use in nuclear medicine. An efficient method (70%) for radiochemical separation from the irradiated Bi-target has been described. The level of Bi contamination in the purified 2'11At-solution was estimated. Finally labelling of a model protein has been tried. (author). 14 refs

  17. SU-C-204-06: Surface Imaging for the Set-Up of Proton Post-Mastectomy Chestwall Irradiation: Gated Images Vs Non Gated Images

    Energy Technology Data Exchange (ETDEWEB)

    Batin, E; Depauw, N; MacDonald, S; Lu, H [Massachusetts General Hospital, Boston, MA (United States)

    2015-06-15

    Purpose: Historically, the set-up for proton post-mastectomy chestwall irradiation at our institution started with positioning the patient using tattoos and lasers. One or more rounds of orthogonal X-rays at gantry 0° and beamline X-ray at treatment gantry angle were then taken to finalize the set-up position. As chestwall targets are shallow and superficial, surface imaging is a promising tool for set-up and needs to be investigated Methods: The orthogonal imaging was entirely replaced by AlignRT™ (ART) images. The beamline X-Ray image is kept as a confirmation, based primarily on three opaque markers placed on skin surface instead of bony anatomy. In the first phase of the process, ART gated images were used to set-up the patient and the same specific point of the breathing curve was used every day. The moves (translations and rotations) computed for each point of the breathing curve during the first five fractions were analyzed for ten patients. During a second phase of the study, ART gated images were replaced by ART non-gated images combined with real-time monitoring. In both cases, ART images were acquired just before treatment to access the patient position compare to the non-gated CT. Results: The average difference between the maximum move and the minimum move depending on the chosen breathing curve point was less than 1.7 mm for all translations and less than 0.7° for all rotations. The average position discrepancy over the course of treatment obtained by ART non gated images combined to real-time monitoring taken before treatment to the planning CT were smaller than the average position discrepancy obtained using ART gated images. The X-Ray validation images show similar results with both ART imaging process. Conclusion: The use of ART non gated images combined with real time imaging allows positioning post-mastectomy chestwall patients in less than 3 mm / 1°.

  18. A novel c. 204 Ile68Met germline variant in exon 2 of the mutL homolog 1 gene in a colorectal cancer patient

    Czech Academy of Sciences Publication Activity Database

    Vodička, Pavel; Caja, F.; Vymetálková, Veronika; Procházka, Pavel; Vodičková, Ludmila; Schwarzová, L.; Slyšková, Jana; Kumar, R.; Schneiderová, M.

    2015-01-01

    Roč. 9, č. 1 (2015), s. 183-186. ISSN 1792-1074 R&D Projects: GA ČR GPP304/11/P715; GA ČR(CZ) GAP304/12/1585 Institutional support: RVO:68378041 Keywords : mutL homolog 1 * germline mutation * colorectal cancer Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.554, year: 2014

  19. SU-C-204-02: Improved Patient-Specific Optimization of the Stopping Power Calibration for Proton Therapy Planning Using a Single Proton Radiography

    Energy Technology Data Exchange (ETDEWEB)

    Rinaldi, I [Lyon 1 University and CNRS/IN2P3, UMR 5822, Villeurbanne (France); Ludwig Maximilian University, Garching, DE (Germany); Heidelberg University Hospital, Heidelberg, DE (Germany); Parodi, K [Ludwig Maximilian University, Garching, DE (Germany); Heidelberg University Hospital, Heidelberg, DE (Germany); Krah, N [Heidelberg Collaboratory for Image Processing, Heidelberg, DE (Germany)

    2015-06-15

    Purpose: We present an improved method to calculate patient-specific calibration curves to convert X-ray computed tomography (CT) Hounsfield Unit (HU) to relative stopping powers (RSP) for proton therapy treatment planning. Methods: By optimizing the HU-RSP calibration curve, the difference between a proton radiographic image and a digitally reconstructed X-ray radiography (DRR) is minimized. The feasibility of this approach has previously been demonstrated. This scenario assumes that all discrepancies between proton radiography and DRR originate from uncertainties in the HU-RSP curve. In reality, external factors cause imperfections in the proton radiography, such as misalignment compared to the DRR and unfaithful representation of geometric structures (“blurring”). We analyze these effects based on synthetic datasets of anthropomorphic phantoms and suggest an extended optimization scheme which explicitly accounts for these effects. Performance of the method is been tested for various simulated irradiation parameters. The ultimate purpose of the optimization is to minimize uncertainties in the HU-RSP calibration curve. We therefore suggest and perform a thorough statistical treatment to quantify the accuracy of the optimized HU-RSP curve. Results: We demonstrate that without extending the optimization scheme, spatial blurring (equivalent to FWHM=3mm convolution) in the proton radiographies can cause up to 10% deviation between the optimized and the ground truth HU-RSP calibration curve. Instead, results obtained with our extended method reach 1% or better correspondence. We have further calculated gamma index maps for different acceptance levels. With DTA=0.5mm and RD=0.5%, a passing ratio of 100% is obtained with the extended method, while an optimization neglecting effects of spatial blurring only reach ∼90%. Conclusion: Our contribution underlines the potential of a single proton radiography to generate a patient-specific calibration curve and to improve dose delivery by optimizing the HU-RSP calibration curve as long as all sources of systematic incongruence are properly modeled.

  20. 41 CFR 302-3.204 - When an employed immediate family member and I are transferring in the interest of the Government...

    Science.gov (United States)

    2010-07-01

    ... of the names of which non-employee member(s) will receive allowances under your TA; if you select to... immediate family member and I are transferring in the interest of the Government, what information must we... Regulation System RELOCATION ALLOWANCES RELOCATION ALLOWANCES 3-RELOCATION ALLOWANCE BY SPECIFIC TYPE...

  1. SU-D-204-07: Comparison of AAPM TG150 Draft Image Receptor Tests with Vendor Automated QC Tests for Five Mobile DR Units

    Energy Technology Data Exchange (ETDEWEB)

    Li, G; Nishino, T [UT MD Anderson Cancer Center, Houston, TX (United States); Greene, T [Radiation Services, Inc., Dover, FL (United States); Willis, C [MD Anderson Cancer Center, Bellaire, TX (United States)

    2015-06-15

    Purpose: To determine the consistency of digital detector (DR) tests recommended by AAPM TG150 and tests provided by commercially available DirectView Total Quality Tool (TQT). Methods: The DR tests recommended by the TG150 Detector Subgroup[1] were performed on 4 new Carestream DRX-Revolution and one Carestream DRX1C retrofit of a GE AMX-4 that had been in service for three years. After detector calibration, flat-field images plus images of two bar patterns oriented parallel and perpendicular to the A-C axis, were acquired at conditions recommended by TG150. Raw images were harvested and then analyzed using a MATLAB software previously validated[2,3,4]. Data were analyzed using ROIs of two different dimensions: 1) 128 x 128 ROIs matching the detector electronics; and 2) 256 x 256 ROIs, each including 4 adjacent smaller ROIs. TG150 metrics from 128 x 128 ROIs were compared to TQT metrics, which are also obtained from 128 x 128 ROIs[5]. Results: The results show that both TG150 and TQT measurements were consistent among these detectors. Differences between TG150 and TQT values appear systematic. Compared with 128 x 128 ROIs, noise and SNR non-uniformity were lower with 256 x 256 ROIs, although signal non-uniformity was similar, indicating detectors were appropriately calibrated for gain and offset. MTF of the retrofit unit remained essentially the same between 2012 and 2015, but was inferior to the new units. The older generator focal spot is smaller (0.75mm vs. 1.2mm), and the SID for acquisition is 182cm as well, so focal spot dimensions cannot explain the difference. The difference in MTF may be secondary to differences in generator X-ray spectrum or by unannounced changes in detector architecture. Further investigation is needed. Conclusion: The study shows that both TG150 and TQT tests are consistent. The numerical value of some metrics are dependent on ROI size.

  2. SU-E-J-204: Can a Commercial System for MR-IGRT Be Used to Treat Patients Without Acquiring a CT Scan?

    International Nuclear Information System (INIS)

    Patients treated using a magnetic-resonance image guided radiation therapy (MR-IGRT) system received both CT and MR simulations. During planning, the CT is used to determine relative electron density (RED) using a calibration table. This study aims to investigate the feasibility of MR-only treatments by comparing CT-computed dose distributions to those computed with combinations of water (1.0), lung (0.26), tissue (1.02), and bone (1.12) bulk RED overrides, and to identify the effects of the magnetic field on the RED-overridden doses. Methods: Four patients who received treatment using a commercial MR-IGRT system were analyzed (1 lung, 2 abdomen, and 1 pelvis). The clinical plans were computed using the first fraction MRI as primary, and the simulation CT as secondary for REDs. Plans were reoptimized using default bulk RED overrides (water/lung and tissue/lung for the lung patient, water/bone, tissue/bone, water only, and tissue only for the abdomen and pelvis patients). Additionally, each plan was re-optimized to include the static magnetic field. All plans were normalized to the same PTV coverage as the clinical plan. Dose-difference volumes and DVHs were computed for bulk density override plans, and 3D gamma analyses between each plan and its accompanying magnetic field plan were performed using 3%/3 mm dose difference and distance-to-agreement criteria using the PTV and Skin as masking structures. Results: The average differences in PTV and organs-at-risk mean dose for all RED combinations tested were −0.19 Gy (−0.62 – 0.06 Gy) and −0.34 Gy (−1.76 – 0.33 Gy), respectively. The average PTV and Skin gamma pass rates for all RED combinations tested were 99.88% (99.5% – 100%) and 98. 35% (96.3% – 99.6%). No systematic differences in DVHs or isodoses were observed. Conclusions: It is likely that that a commercial MR-IGRT system may produce high quality treatment plans without the need for CT scans. Authors of this abstract are members of the Washington University Radiation Oncology department, which has a research agreement with ViewRay, Inc

  3. The afterglow of the short/intermediate-duration gamma-ray burst GRB 000301C: A jet at z=2.04

    DEFF Research Database (Denmark)

    Jensen, B.L.; Fynbo, J.U.; Gorosabel, J.;

    2001-01-01

    We present Ulysses and NEAR data from the detection of the short or intermediate duration (2 s) gamma-ray burst GRB 000301C (2000 March 1.41 UT). The gamma-ray burst (GRB) was localised by the Inter Planetary Network (IPN) and RXTE to an area of similar to 50 arcmin(2). A fading optical counterpart...

  4. SU-C-204-02: Improved Patient-Specific Optimization of the Stopping Power Calibration for Proton Therapy Planning Using a Single Proton Radiography

    International Nuclear Information System (INIS)

    Purpose: We present an improved method to calculate patient-specific calibration curves to convert X-ray computed tomography (CT) Hounsfield Unit (HU) to relative stopping powers (RSP) for proton therapy treatment planning. Methods: By optimizing the HU-RSP calibration curve, the difference between a proton radiographic image and a digitally reconstructed X-ray radiography (DRR) is minimized. The feasibility of this approach has previously been demonstrated. This scenario assumes that all discrepancies between proton radiography and DRR originate from uncertainties in the HU-RSP curve. In reality, external factors cause imperfections in the proton radiography, such as misalignment compared to the DRR and unfaithful representation of geometric structures (“blurring”). We analyze these effects based on synthetic datasets of anthropomorphic phantoms and suggest an extended optimization scheme which explicitly accounts for these effects. Performance of the method is been tested for various simulated irradiation parameters. The ultimate purpose of the optimization is to minimize uncertainties in the HU-RSP calibration curve. We therefore suggest and perform a thorough statistical treatment to quantify the accuracy of the optimized HU-RSP curve. Results: We demonstrate that without extending the optimization scheme, spatial blurring (equivalent to FWHM=3mm convolution) in the proton radiographies can cause up to 10% deviation between the optimized and the ground truth HU-RSP calibration curve. Instead, results obtained with our extended method reach 1% or better correspondence. We have further calculated gamma index maps for different acceptance levels. With DTA=0.5mm and RD=0.5%, a passing ratio of 100% is obtained with the extended method, while an optimization neglecting effects of spatial blurring only reach ∼90%. Conclusion: Our contribution underlines the potential of a single proton radiography to generate a patient-specific calibration curve and to improve dose delivery by optimizing the HU-RSP calibration curve as long as all sources of systematic incongruence are properly modeled

  5. 20 CFR 408.204 - What conditions will prevent you from qualifying for SVB or being entitled to receive SVB payments?

    Science.gov (United States)

    2010-04-01

    ... to section 237(a) or 212(a)(6)(A) of the Immigration and Nationality Act and before the month in... from which you fled, for a crime or an attempt to commit a crime that is a felony under the laws of...

  6. TU-EF-204-01: Accurate Prediction of CT Tube Current Modulation: Estimating Tube Current Modulation Schemes for Voxelized Patient Models Used in Monte Carlo Simulations.

    OpenAIRE

    McMillan, K; Bostani, M; McCollough, C; McNitt-Gray, M

    2015-01-01

    PURPOSE: Most patient models used in Monte Carlo-based estimates of CT dose, including computational phantoms, do not have tube current modulation (TCM) data associated with them. While not a problem for fixed tube current simulations, this is a limitation when modeling the effects of TCM. Therefore, the purpose of this work was to develop and validate methods to estimate TCM schemes for any voxelized patient model. METHODS: For 10 patients who received clinically-indicated chest (n=5) and ab...

  7. SU-C-204-04: Patient Specific Proton Stopping Powers Estimation by Combining Proton Radiography and Prior-Knowledge X-Ray CT Information

    International Nuclear Information System (INIS)

    Purpose: The material relative stopping power (RSP) uncertainty is the highest contributor to the range uncertainty in proton therapy. The purpose of this work is to develop a robust and systematic method that yields accurate, patient specific, RSP by combining 1) pre-treatment x-ray CT and 2) daily proton radiograph of the patient. Methods: The method is formulated as a linear least-square optimization problem (min||Ax-B||2). The parameter A represents the pathlength crossed by the proton in each material. The RSPs for the materials (water equivalent thickness (WET)/physical thickness) are denoted by x. B is the proton radiograph expressed as WET crossed. The problem is minimized using a convex-conic optimization algorithm with xi

  8. SU-C-204-06: Surface Imaging for the Set-Up of Proton Post-Mastectomy Chestwall Irradiation: Gated Images Vs Non Gated Images

    International Nuclear Information System (INIS)

    Purpose: Historically, the set-up for proton post-mastectomy chestwall irradiation at our institution started with positioning the patient using tattoos and lasers. One or more rounds of orthogonal X-rays at gantry 0° and beamline X-ray at treatment gantry angle were then taken to finalize the set-up position. As chestwall targets are shallow and superficial, surface imaging is a promising tool for set-up and needs to be investigated Methods: The orthogonal imaging was entirely replaced by AlignRT™ (ART) images. The beamline X-Ray image is kept as a confirmation, based primarily on three opaque markers placed on skin surface instead of bony anatomy. In the first phase of the process, ART gated images were used to set-up the patient and the same specific point of the breathing curve was used every day. The moves (translations and rotations) computed for each point of the breathing curve during the first five fractions were analyzed for ten patients. During a second phase of the study, ART gated images were replaced by ART non-gated images combined with real-time monitoring. In both cases, ART images were acquired just before treatment to access the patient position compare to the non-gated CT. Results: The average difference between the maximum move and the minimum move depending on the chosen breathing curve point was less than 1.7 mm for all translations and less than 0.7° for all rotations. The average position discrepancy over the course of treatment obtained by ART non gated images combined to real-time monitoring taken before treatment to the planning CT were smaller than the average position discrepancy obtained using ART gated images. The X-Ray validation images show similar results with both ART imaging process. Conclusion: The use of ART non gated images combined with real time imaging allows positioning post-mastectomy chestwall patients in less than 3 mm / 1°

  9. SU-C-204-03: In-Vivo Range Verification and Tissue Response to Proton Radiotherapy Using Prompt Gamma Volume Histograms

    Energy Technology Data Exchange (ETDEWEB)

    Polf, J; Lin, M [University of Maryland School of Medicine, Baltimore, MD (United States)

    2015-06-15

    Purpose: To study if prompt gamma (PG) volume histograms created from PG images acquired during treatment delivery can be used to identify changes to beam range and tissue composition in response to proton radiotherapy. Methods: Monte Carlo simulations of a single field from a single treatment fraction (100 cGy) for prostate cancer were performed for the cases of: 1) an ideal patient setup, 1) a setup shift in the superior direction and 2) a reduction in oxygen concentration in the tumor. For each case, the 3 -Dimsional dose delivery and elemental PG emission in the patient for the treatment fraction were recorded and imported into a commercial treatment planning system. Changes in the dose volume histograms (DVH), as well as the PG volume histograms (PG-VH) for the PG emission from oxygen and for the total PG emission (from all elements) were analyzed. Results: For the 1 cm superior shift, the prostate DVH and total PG-VH both shifted toward lower doses with the shape of the curves remaining nearly unchanged, resulting in the DVH V95 dropping from 100 cGy to 90 cGy. For the total PG-VH, the V95 fell from 50 to 38. For the reduced oxygen case, both the DVH and PG-VH had a much different shape than for the ideal case, with a significant downward slope in the curves as a function of dose. Conclusions: The shift in the prostate PG-VH for a superior shift in the patient setup correlated well with the DVH indicating it is possible to detect setup errors by analyzing the PG-VH from prompt gamma images obtained during daily proton treatment delivery. Additionally, it may be possible to detect changes in the elemental concentrations of irradiated tissues by analyzing the shape of the PG-VH.

  10. SU-D-204-06: Dose and Image Quality Evaluation of a Low-Dose Slot-Scanning X-Ray System for Pediatric Orthopedic Studies

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Z; Hoerner, M; Lamoureux, R; Rill, L; Arreola, M [Univ Florida, Jacksonville Beach, FL (United States)

    2015-06-15

    Purpose: Children in early teens with scoliosis require repeated radiographic exams over a number of years. The EOS (EOS imaging S.A., Paris, France) is a novel low-dose slot-scanning digital radiographic system designed to produce full-spine images of a free-standing patient. The radiation dose and image quality characteristics of the EOS were evaluated relative to those of a Computed Radiography (CR) system for scoliosis imaging. Methods: For dose evaluation, a full-torso anthropomorphic phantom was scanned five times using the default standard clinical protocols for both the EOS and a CR system, which include both posteroanterior and lateral full-spine views. Optically stimulated luminescent dosimeters (OSLDs), also known as nanoDots™ (Landauer, Inc., Glenwood, IL), were placed on the phantom’s surface to measure entrance skin dose. To assess image quality, MTF curves were generated from sampling the noise levels within the high-contrast regions of a line-pair phantom. Vertical and horizontal distortions were measured for the square line-pair phantom with the EOS system to evaluate the effects of geometric magnification and misalignment with the indicated imaging plane. Results: The entrance skin dose was measured to be 0.4 to 1.1 mGy for the EOS, and 0.7 to 3.6 mGy for the CR study. MTF comparison shows that CR greatly outperforms the EOS, despite both systems having a limiting resolution at 1.8 line-pairs per mm. Vertical distortion was unaffected by phantom positioning, because of the EOS slot-scanning geometry. Horizontal distortion increased linearly with miscentering distance. Conclusion: The EOS system resulted in approximately 70% lower radiation dose than CR for full-spine images. Image quality was found to be inferior to CR. Further investigation is required to see if EOS system is an acceptable modality for performing clinically diagnostic scoliosis examinations.

  11. CALiPER Report 20.4: Lumen and Chromaticity Maintenance of LED PAR38 Lamps Operated in Steady-State Conditions

    Energy Technology Data Exchange (ETDEWEB)

    none,

    2014-12-30

    This CALiPER report focuses on lumen maintenance, chromaticity maintenance, and catastrophic failure in 32 of the Series 20 LED PAR38 lamps and 8 benchmark lamps, which were monitored for nearly 14,000 hours at ambient temperatures between 44°C and 45°C.

  12. 41 CFR 301-71.204 - Within how many calendar days after the submission of a proper travel claim must we reimburse the...

    Science.gov (United States)

    2010-07-01

    ... expenses; (f) Relocation income tax allowance; (g) Use of a relocation services company; (h) Home marketing... allowances are exempt from this provision: (a) Transportation and storage of household goods and...

  13. SU-D-204-07: Comparison of AAPM TG150 Draft Image Receptor Tests with Vendor Automated QC Tests for Five Mobile DR Units

    International Nuclear Information System (INIS)

    Purpose: To determine the consistency of digital detector (DR) tests recommended by AAPM TG150 and tests provided by commercially available DirectView Total Quality Tool (TQT). Methods: The DR tests recommended by the TG150 Detector Subgroup[1] were performed on 4 new Carestream DRX-Revolution and one Carestream DRX1C retrofit of a GE AMX-4 that had been in service for three years. After detector calibration, flat-field images plus images of two bar patterns oriented parallel and perpendicular to the A-C axis, were acquired at conditions recommended by TG150. Raw images were harvested and then analyzed using a MATLAB software previously validated[2,3,4]. Data were analyzed using ROIs of two different dimensions: 1) 128 x 128 ROIs matching the detector electronics; and 2) 256 x 256 ROIs, each including 4 adjacent smaller ROIs. TG150 metrics from 128 x 128 ROIs were compared to TQT metrics, which are also obtained from 128 x 128 ROIs[5]. Results: The results show that both TG150 and TQT measurements were consistent among these detectors. Differences between TG150 and TQT values appear systematic. Compared with 128 x 128 ROIs, noise and SNR non-uniformity were lower with 256 x 256 ROIs, although signal non-uniformity was similar, indicating detectors were appropriately calibrated for gain and offset. MTF of the retrofit unit remained essentially the same between 2012 and 2015, but was inferior to the new units. The older generator focal spot is smaller (0.75mm vs. 1.2mm), and the SID for acquisition is 182cm as well, so focal spot dimensions cannot explain the difference. The difference in MTF may be secondary to differences in generator X-ray spectrum or by unannounced changes in detector architecture. Further investigation is needed. Conclusion: The study shows that both TG150 and TQT tests are consistent. The numerical value of some metrics are dependent on ROI size

  14. SU-C-204-01: A Fast Analytical Approach for Prompt Gamma and PET Predictions in a TPS for Proton Range Verification

    International Nuclear Information System (INIS)

    Purpose: We describe and demonstrate a fast analytical tool for prompt-gamma emission prediction based on filter functions applied on the depth dose profile. We present the implementation in a treatment planning system (TPS) of the same algorithm for positron emitter distributions. Methods: The prediction of the desired observable is based on the convolution of filter functions with the depth dose profile. For both prompt-gammas and positron emitters, the results of Monte Carlo simulations (MC) are compared with those of the analytical tool. For prompt-gamma emission from inelastic proton-induced reactions, homogeneous and inhomogeneous phantoms alongside with patient data are used as irradiation targets of mono-energetic proton pencil beams. The accuracy of the tool is assessed in terms of the shape of the analytically calculated depth profiles and their absolute yields, compared to MC. For the positron emitters, the method is implemented in a research RayStation TPS and compared to MC predictions. Digital phantoms and patient data are used and positron emitter spatial density distributions are analyzed. Results: Calculated prompt-gamma profiles agree with MC within 3 % in terms of absolute yield and reproduce the correct shape. Based on an arbitrary reference material and by means of 6 filter functions (one per chemical element), profiles in any other material composed of those elements can be predicted. The TPS implemented algorithm is accurate enough to enable, via the analytically calculated positron emitters profiles, detection of range differences between the TPS and MC with errors of the order of 1–2 mm. Conclusion: The proposed analytical method predicts prompt-gamma and positron emitter profiles which generally agree with the distributions obtained by a full MC. The implementation of the tool in a TPS shows that reliable profiles can be obtained directly from the dose calculated by the TPS, without the need of full MC simulation

  15. In situ vaccination with CD204 gene-silenced dendritic cell, not unmodified dendritic cell, enhances radiation therapy of prostate cancer

    OpenAIRE

    Guo, Chunqing; Yi, Huanfa; YU, XIAOFEI; Zuo, Daming; Qian, Jie; Yang, Gary; Barbara A Foster; Subjeck, John R.; Sun, Xiaolei; Mikkelsen, Ross B.; Fisher, Paul B.; Wang, Xiang-Yang

    2012-01-01

    Given the complexity of prostate cancer progression and metastasis, multimodalities that target different aspects of tumor biology, e.g., radiotherapy (RT) in conjunction with immunotherapy, may provide the best opportunities for promoting clinical benefits in patients with high risk localized prostate cancer. Here we show that intratumoral administration of unmodified dendritic cells (DCs) failed to synergize with fractionated RT. However, ionizing radiation combined with in situ vaccination...

  16. SU-C-204-04: Patient Specific Proton Stopping Powers Estimation by Combining Proton Radiography and Prior-Knowledge X-Ray CT Information

    Energy Technology Data Exchange (ETDEWEB)

    Collins-Fekete, CA [Massachussetts General Hospital, Quebec, Quebec (Canada); Ion Beam Application, Louvain-la-neuve (Belgium); Aarhus University, Aarhus, Aarhus (Denmark); Centre Hospitalier Univ de Quebec, Quebec, QC (Canada); Brousmiche, S [Ion Beam Application, Louvain-la-neuve (Belgium); Hansen, D [Aarhus University, Aarhus, Aarhus (Denmark); Beaulieu, L [Centre Hospitalier Univ de Quebec, Quebec, QC (Canada); Seco, J [Mass General Hospital, Harvard Medical, Boston, MA (United States)

    2015-06-15

    Purpose: The material relative stopping power (RSP) uncertainty is the highest contributor to the range uncertainty in proton therapy. The purpose of this work is to develop a robust and systematic method that yields accurate, patient specific, RSP by combining 1) pre-treatment x-ray CT and 2) daily proton radiograph of the patient. Methods: The method is formulated as a linear least-square optimization problem (min||Ax-B||2). The parameter A represents the pathlength crossed by the proton in each material. The RSPs for the materials (water equivalent thickness (WET)/physical thickness) are denoted by x. B is the proton radiograph expressed as WET crossed. The problem is minimized using a convex-conic optimization algorithm with xi

  17. SU-D-204-06: Dose and Image Quality Evaluation of a Low-Dose Slot-Scanning X-Ray System for Pediatric Orthopedic Studies

    International Nuclear Information System (INIS)

    Purpose: Children in early teens with scoliosis require repeated radiographic exams over a number of years. The EOS (EOS imaging S.A., Paris, France) is a novel low-dose slot-scanning digital radiographic system designed to produce full-spine images of a free-standing patient. The radiation dose and image quality characteristics of the EOS were evaluated relative to those of a Computed Radiography (CR) system for scoliosis imaging. Methods: For dose evaluation, a full-torso anthropomorphic phantom was scanned five times using the default standard clinical protocols for both the EOS and a CR system, which include both posteroanterior and lateral full-spine views. Optically stimulated luminescent dosimeters (OSLDs), also known as nanoDots™ (Landauer, Inc., Glenwood, IL), were placed on the phantom’s surface to measure entrance skin dose. To assess image quality, MTF curves were generated from sampling the noise levels within the high-contrast regions of a line-pair phantom. Vertical and horizontal distortions were measured for the square line-pair phantom with the EOS system to evaluate the effects of geometric magnification and misalignment with the indicated imaging plane. Results: The entrance skin dose was measured to be 0.4 to 1.1 mGy for the EOS, and 0.7 to 3.6 mGy for the CR study. MTF comparison shows that CR greatly outperforms the EOS, despite both systems having a limiting resolution at 1.8 line-pairs per mm. Vertical distortion was unaffected by phantom positioning, because of the EOS slot-scanning geometry. Horizontal distortion increased linearly with miscentering distance. Conclusion: The EOS system resulted in approximately 70% lower radiation dose than CR for full-spine images. Image quality was found to be inferior to CR. Further investigation is required to see if EOS system is an acceptable modality for performing clinically diagnostic scoliosis examinations

  18. Hurdles for a Broader Use of 211At and for the Synthesis of 211At-Labelled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    One of the key impediments to the use of 211At is the very well known deleterious effect of high radiation fields caused by its alpha particles on the synthesis of 211At-labelled radiopharmaceuticals. This is problematic because radiolysis-mediated effects can produce diminishing efficiency of electrophilic astatination reactions due to increasing deposition of radiation dose with increasing activities and with the passage of the time. Astatine-211 has chemical properties that permit complex labelling strategies and a longer half-life than 213Bi that makes it more suitable when the targeting molecule does not gain immediate access to the tumour cells. The first clinical evaluation was published in 2001 [2] in patients with brain tumour. Although this study circumvents many of the challenges to entering clinical studies with 211At and many obstacles had to be surmounted before clinical studies could be initiated, several problems were encountered in maintaining efficient labelling with escalating radiation dose of α-particle even with fresh 211At elution [3]. Astatine-211 also has an additional hurdle to overcome before to its clinical application in labelled radiopharmaceuticals related with its production and distribution. Among the potential group of promising α- emitter it is the only one produced by cyclotrons, but due to the scarcity of cyclotrons equipped with 25−30 MeV α-particle beams, it will of necessity be utilized in distant locations from the site of production. It presents a major chemical challenge because the diminishing efficiency of electrophilic astatination reactions with the passage of the time is well known, a problem likely related to the radiolysis produced by the high LET (linear energy transfer) meaning that large amounts of energy are deposited in a highly localized manner. This problem has been most comprehensively investigated to understand and evaluate the role of the radiolysis effects of astatine alpha particles in the synthesis

  19. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  20. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  1. Radiopharmaceutical Chemistry of Targeted Radiopharmaceutics. Synthesis of 211At-Labeled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    Targeted α-particle radiotherapy is an appealing approach to cancer treatment because of the potential for delivering curative doses of radiation to tumor with minimal damage to normal tissue due to a range equivalent to only a few cell diameters. Compared with β-emitters they have significant advantages from a radiobiological perspective. The LET of 211At α-particles is more than 400 times higher than the β-particles emitted by 90Y, in addition the distance between ionizing events is almost the same as that between the two strands of DNA, yielding a high probability of creating non-repairable DNA damage. It gives the ability to kill cancer cells not compromised by hypoxia, dose rate effects or cell cycle position, enhancing their attractiveness for targeted radiotherapy. However, translation of the concept to the clinic has been slow, many obstacles had to be surmounted before clinical studies could be initiated, the first clinical evaluation of a 211At- labeled mAb was made in 2001. This study circumvents many of the challenges to entering clinical studies with 211At. But several problems were encountered in maintaining efficient labeling with escalating radiation dose of alpha-particle likely related to radiolysis. The impact of the radiolysis produced by the α-particle over the labeling chemistry is much higher in comparison with typical β-emitters due to a deposition of energy in the solvent in a highly localized manner two orders of magnitude per unit volume higher than 90Y or 131I. Due to these difficulties a comprehensive basic science study about the radiolytic effects of astatine alpha-particles over the synthesis of 211At-labeled radiopharmaceuticals was carried out. Its main goal was overcoming the problem of the synthesis of 211At-labeled radiopharmaceuticals at the high activities necessaries for therapy and also to extend the shelf life of astatine elutions. Briefly this study held several steps, the first one was to study the role of solvent

  2. 40 CFR 63.4165 - How do I determine the emission capture system efficiency?

    Science.gov (United States)

    2010-07-01

    ... section are met: (1) The capture system meets the criteria in Method 204 of appendix M to 40 CFR part 51... building enclosure in Method 204 of appendix M to 40 CFR part 51. (2) Use Method 204A or 204F of appendix M to 40 CFR part 51 to determine the mass fraction of TVH liquid input from each coating, thinner,...

  3. 40 CFR 63.4964 - How do I determine the emission capture system efficiency?

    Science.gov (United States)

    2010-07-01

    ... coating operation during the capture efficiency test run. (4) Use Method 204D or E of appendix M to 40 CFR... Method 204 of appendix M to 40 CFR part 51 for a PTE and directs all the exhaust gases from the enclosure... 204 of appendix M to 40 CFR part 51. (2) Use Method 204A or 204F of appendix M to 40 CFR part 51...

  4. 40 CFR 63.4765 - How do I determine the emission capture system efficiency?

    Science.gov (United States)

    2010-07-01

    ... coating operation during the capture efficiency test run. (4) Use Method 204D or E of appendix M to 40 CFR... meets the criteria in Method 204 of appendix M to 40 CFR part 51 for a PTE and directs all the exhaust... enclosure in Method 204 of appendix M to 40 CFR part 51. (2) Use Method 204A or 204F of appendix M to 40...

  5. 78 FR 80379 - Federal Acquisition Regulation; Trade Agreements Thresholds

    Science.gov (United States)

    2013-12-31

    ..., 2014. On December 18, 2013 (78 FR 76700), the United States Trade Representative published new...,000 204,000 10,335,931 Panama FTA 204,000 204,000 7,864,000 Peru FTA 204,000 204,000 7,864,000... changes are in line with inflation and maintain the status quo. List of Subjects in 48 CFR Parts 22,...

  6. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    International Nuclear Information System (INIS)

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211At and 124I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[211At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[211At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [124I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[124I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of macromolecules

  7. 211At production and recovery: first results of a new start

    International Nuclear Information System (INIS)

    Full text: 211At is the only alpha-emitting isotope which can be introduced into organic molecular structures by covalent chemical binding and possesses superior decay characteristics for therapeutic applications when compared with other alpha emitters. However, its production requires a minimum of 27,5 MeV alpha-particles, which are relatively rarely available. In view of the revival of alpha-therapy approaches a production of 211At has been set up at the MHH cyclotron (MC-35). The first aim of this project was to establish a target- and work-up-system for the reliable production of several ten MBq-quantities of 211At for animal- and cell-research. An aluminum-target-system holds a 1.3 cm diameter Bi-disc of 0.25 mm thickness. The disk is pressed onto a the aluminum backing with 2 tons/cm2. The front is covered with a 125 μm Al foil, cooled by a He jet which is separated from the vacuum by a 250 μm Ti foil. Starting with 27.5 MeV alpha-particles the resulting target-energy is 25 MeV. This relatively low energy is chosen to avoid any contamination with 210At and 210Po in the first experimental period. A beam current of 10 μA for 15 min (9 mCoulomb) yields 16.4 MBq 211At theoretically. Astatine is recovered from the target by a dry distillation technique, using various gases as a transport support-medium. The small all-quartz distillation-apparatus is heated up to 900 oC. Astatine is recovered in a small cool able vessel containing various trapping media. Distillation and trapping can be monitored with small radioactivity monitors. The whole system fits in a cubical 0.5 m glove box. Continuous monitoring of the distillation process allowed to optimize the heating rate, the transport support-medium and its flow-rate. Various trapping solutions were tested for their efficiency. Different beam dispersion in the target seems to influence the release and distillation of astatine from the molten bismuth-target. Two different release patterns were observed. The first

  8. « The effect of the Arab Muslim conquest on the administrative division of Sasanian Persis/Fars ». Iran, XLI, (2003), pp. 193-204.

    OpenAIRE

    Gyselen, Rika (Hrsg.)

    2005-01-01

    Spéculations sur l’évolution de l’administration dans la région du Fars à la suite de la conquête arabo-musulmane. Cette prosopographie est truffée de coquilles (WHYC au lieu de WYHC, Holelesheom pour Hildesheim, etc.), d’erreurs (e.a. xwarwārān (north-east) à corriger en (west)), de renvois fautifs (p. ex. n. 77 : Anthologie de Zādspram, pp. 114-115 où on ne trouve rien qui soit en rapport avec la phrase de l’A.) et d’oublis bibliographiques (p. ex. la monographie de H. Gaube sur Arrajan) et...

  9. INFLUENCE OF SINTERING TEMPERATURE ON THE POLARIZATION RESISTANCE OF LaO20.6SrO20.4CoO20.2FeO20.8O3-δ - SDC CARBONATE COMPOSITE CATHODE

    Directory of Open Access Journals (Sweden)

    Nurul Akidah Baharuddin

    2016-05-01

    Full Text Available The effects of sintering temperature of an LSCF-samarium-doped ceria carbonate (SDCC cathode composite film on its polarization resistance (Rp were evaluated in this study. An LSCF-SDCC composite cathode was prepared for cathode film development by electrophoretic deposition (EPD. The LSCF-SDCC composite cathode was prepared at 50:50 weight percentage ratio. An EPD suspension which is based on an organic aqueous solution was used, and a mixture of ethanol and deionized water was used as medium with poly diallyl dimethyl ammonium chloride (PDADMAC as a dispersing agent. SDCC substrate was used, and EPD was performed on both sides. A symmetrical cell with cathode composite LSCF-SDCC films on both sides of the substrate was subjected to sintering at five different temperatures (from 550°C to 750°C. A symmetrical cell was painted using silver paste before undergoing electrochemical performance test (air condition, in which the impedance, Z data, was measured. The effects of sintering temperature change on element content and film porosity were first investigated by energy-dispersive X-ray spectroscopy, field emission scanning electron microscopy, and J-image analysis. Ceramic-based cathode LSCF-SDCC that was sintered at 600°C exhibited the lowest Rp at a value of 0.68 Ω when operated at 650°C. This study proved that EPD has potential in developing IT-LT solid oxide fuel cell cathode components with high electrochemical performance in terms of Rp values.

  10. SU-D-204-05: Quantitative Comparison of a High Resolution Micro-Angiographic Fluoroscopic (MAF) Detector with a Standard Flat Panel Detector (FPD) Using the New Metric of Generalized Measured Relative Object Detectability (GM-ROD)

    Energy Technology Data Exchange (ETDEWEB)

    Russ, M; Ionita, C; Bednarek, D; Rudin, S [Toshiba Stroke and Vascular Research Center, University at Buffalo (SUNY), Buffalo, NY (United States)

    2015-06-15

    Purpose: In endovascular image-guided neuro-interventions, visualization of fine detail is paramount. For example, the ability of the interventionist to visualize the stent struts depends heavily on the x-ray imaging detector performance. Methods: A study to examine the relative performance of the high resolution MAF-CMOS (pixel size 75µm, Nyquist frequency 6.6 cycles/mm) and a standard Flat Panel Detector (pixel size 194µm, Nyquist frequency 2.5 cycles/mm) detectors in imaging a neuro stent was done using the Generalized Measured Relative Object Detectability (GM-ROD) metric. Low quantum noise images of a deployed stent were obtained by averaging 95 frames obtained by both detectors without changing other exposure or geometric parameters. The square of the Fourier transform of each image is taken and divided by the generalized normalized noise power spectrum to give an effective measured task-specific signal-to-noise ratio. This expression is then integrated from 0 to each of the detector’s Nyquist frequencies, and the GM-ROD value is determined by taking a ratio of the integrals for the MAF-CMOS to that of the FPD. The lower bound of integration can be varied to emphasize high frequencies in the detector comparisons. Results: The MAF-CMOS detector exhibits vastly superior performance over the FPD when integrating over all frequencies, yielding a GM-ROD value of 63.1. The lower bound of integration was stepped up in increments of 0.5 cycles/mm for higher frequency comparisons. As the lower bound increased, the GM-ROD value was augmented, reflecting the superior performance of the MAF-CMOS in the high frequency regime. Conclusion: GM-ROD is a versatile metric that can provide quantitative detector and task dependent comparisons that can be used as a basis for detector selection. Supported by NIH Grant: 2R01EB002873 and an equipment grant from Toshiba Medical Systems Corporation.

  11. Multibeam collection for KN204-01: Multibeam data collected aboard Knorr from 2011-11-06 to 2011-12-11, departing from Woods Hole, MA and returning to Praia, Cape Verde

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  12. O2.04TREATMENT WITH OMX-4.80, A TUMOR-PENETRATING TUNABLE OXYGEN CARRIER, REDUCES TUMOR HYPOXIA AND DRAMATICALLY ENHANCES RADIATION THERAPY IN INTRACRANIAL MODELS OF GLIOBLASTOMA

    OpenAIRE

    Krtolica, A; Le Moan, N.; Serwer, L.; Yoshida, Y.; Ozawa, T; Butowski, N.; James, D; Cary, S.

    2014-01-01

    We have developed OMX-4.80, a tunable oxygen carrier from the H-NOX protein family, that preferentially accumulates in tumor tissue, reduces hypoxia and enhances radiotherapy (RT). Tumor hypoxia is associated with poor patient outcomes in multiple solid tumors including glioblastoma (GB) and is thought to be a major contributor to poor cancer responses to chemo and radiation therapy. Here, we show that OMX-4.80 administered i.v. into the tail vein of mice bearing orthotopic GB passes the bloo...

  13. O2.04TREATMENT WITH OMX-4.80, A TUMOR-PENETRATING TUNABLE OXYGEN CARRIER, REDUCES TUMOR HYPOXIA AND DRAMATICALLY ENHANCES RADIATION THERAPY IN INTRACRANIAL MODELS OF GLIOBLASTOMA

    Science.gov (United States)

    Krtolica, A.; Le Moan, N.; Serwer, L.; Yoshida, Y.; Ozawa, T.; Butowski, N.; James, D.; Cary, S.

    2014-01-01

    We have developed OMX-4.80, a tunable oxygen carrier from the H-NOX protein family, that preferentially accumulates in tumor tissue, reduces hypoxia and enhances radiotherapy (RT). Tumor hypoxia is associated with poor patient outcomes in multiple solid tumors including glioblastoma (GB) and is thought to be a major contributor to poor cancer responses to chemo and radiation therapy. Here, we show that OMX-4.80 administered i.v. into the tail vein of mice bearing orthotopic GB passes the blood-tumor barrier, penetrates deep into intracranial tumors, and significantly reduces tumor hypoxia in a dose-dependent manner. Hypoxia reduction is demonstrated by a significant decrease in levels of hypoxia inducible factor, HIF1α, and the external hypoxia marker pimonidazole as assessed by IHC and image analysis. Furthermore, hypoxia before and after treatment is compared in the individual tumors by concurrent immunostaining of tumors with a long-term hypoxia marker, Glut1, and short-lived HIF-1α. These data reveal >50% reduction in hypoxic tumor area after OMX-4.80 treatment confirming the effectiveness of OMX-4.80 in reducing hypoxia in individual tumors. When OMX-4.80 treatment was coupled with a single high dose of RT, we observed a 2.7-fold increase in tumor growth delay and 2.9-fold longer survival (p < 0.05, by logrank). Toxicology studies in rodents and dogs with single and multiple supratherapeutic doses of OMX-4.80 revealed a good safety profile affirming its suitability for clinical development. In conclusion, our results indicate that OMX-4.80 is an effective and promising RT enhancer that warrants clinical development in GB patients.

  14. (20S,2′′S-20-[4′-(3′′-Hydroxy-2′′-methylpropyl-3′-methylisoxazol-5-yl]-5β-pregnan-3β,16β-diol

    Directory of Open Access Journals (Sweden)

    Sylvain Bernès

    2009-12-01

    Full Text Available The title steroidal compound, C29H47NO4, was prepared in a one-pot reaction starting from a sarsasapogenin derivative of known configuration. The isoxazole heterocycle is oriented towards the α face of the steroid nucleus and, although fully functionalized on C atoms, does not provoke steric hindrance with the adjacent D ring. The absolute configuration observed for chiral centers is as expected, and shows that no epimerization occurred in the precursors. In the crystal, the three OH groups serve as donors for hydrogen bonding with O and N atoms. The isoxazole N atom is involved in O—H...N hydrogen bonds, forming chains along [100]. These chains are further connected via O—H...O and weak C—H...O contacts, giving rise to a three-dimensional supramolecular network.

  15. SU-D-204-05: Quantitative Comparison of a High Resolution Micro-Angiographic Fluoroscopic (MAF) Detector with a Standard Flat Panel Detector (FPD) Using the New Metric of Generalized Measured Relative Object Detectability (GM-ROD)

    International Nuclear Information System (INIS)

    Purpose: In endovascular image-guided neuro-interventions, visualization of fine detail is paramount. For example, the ability of the interventionist to visualize the stent struts depends heavily on the x-ray imaging detector performance. Methods: A study to examine the relative performance of the high resolution MAF-CMOS (pixel size 75µm, Nyquist frequency 6.6 cycles/mm) and a standard Flat Panel Detector (pixel size 194µm, Nyquist frequency 2.5 cycles/mm) detectors in imaging a neuro stent was done using the Generalized Measured Relative Object Detectability (GM-ROD) metric. Low quantum noise images of a deployed stent were obtained by averaging 95 frames obtained by both detectors without changing other exposure or geometric parameters. The square of the Fourier transform of each image is taken and divided by the generalized normalized noise power spectrum to give an effective measured task-specific signal-to-noise ratio. This expression is then integrated from 0 to each of the detector’s Nyquist frequencies, and the GM-ROD value is determined by taking a ratio of the integrals for the MAF-CMOS to that of the FPD. The lower bound of integration can be varied to emphasize high frequencies in the detector comparisons. Results: The MAF-CMOS detector exhibits vastly superior performance over the FPD when integrating over all frequencies, yielding a GM-ROD value of 63.1. The lower bound of integration was stepped up in increments of 0.5 cycles/mm for higher frequency comparisons. As the lower bound increased, the GM-ROD value was augmented, reflecting the superior performance of the MAF-CMOS in the high frequency regime. Conclusion: GM-ROD is a versatile metric that can provide quantitative detector and task dependent comparisons that can be used as a basis for detector selection. Supported by NIH Grant: 2R01EB002873 and an equipment grant from Toshiba Medical Systems Corporation

  16. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC204 (Link to dictyBase) - - - - VFC204P (Link to Original s...ite) VFC204F 508 VFC204Z 681 VFC204P 1189 - - Show VFC204 Library VF (Link to library) Clone ID VFC204 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.t...|X55972.1 D. discoideum EF1-II gene for elongation factor 1 alpha. 1245 0.0 2 AF016242 |AF016242.1 Dict... 8.0 %: vacuolar 4.0 %: mitochondrial 4.0 %: peroxisomal >> prediction for VFC204 is cyt 5' end seq. ID VFC2

  17. AcEST: BP918070 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_C06 454 Adiantum capillus-veneris mRNA. clone: YMU001_000109_C06. BP918070 - Show ... %), Positives = 54/80 (67%) Frame = +3 Query: 204 LPAD FYPDRVPLNIIDTSSRLEDRGKLEAECRKADAVVLTYACDRPETLDRLSSH ... (52%), Gaps = 22/100 (22%) Frame = +3 Query: 204 LPAD FYPDRVPLNIIDTSSRLEDRGKLEAECRKADAVVLTYACDRPETLDRLSSH ... 8 (53%), Gaps = 20/98 (20%) Frame = +3 Query: 204 LPAD FYPDRVPLNIIDTSSRLEDRGKLEAECRKADAVVLTYACDRPETLDRLSSH ... %), Positives = 46/79 (58%) Frame = +3 Query: 204 LPAD FYPDRVPLNIIDTSSRLEDRGKLEAECRKADAVVLTYACDRPETLDRLSSH ...

  18. 40 CFR 63.4361 - How do I determine the emission capture system efficiency?

    Science.gov (United States)

    2010-07-01

    ... criteria in Method 204 of appendix M to 40 CFR part 51 for a PTE and directs all the exhaust gases from the... 204 of appendix M to 40 CFR part 51. (2) Use Method 204A or 204F of appendix M to 40 CFR part 51 to... to 40 CFR part 51 to measure the total mass, kg, of TVH emissions that are not captured by...

  19. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    OpenAIRE

    BAYRAM, Ali

    1998-01-01

    In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 1...

  20. Human radiation studies: Remembering the early years: Oral history of Dr. Patricia Wallace Durbin, Ph.D., conducted November 11, 1994

    International Nuclear Information System (INIS)

    This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches