WorldWideScience

Sample records for astatine 204

  1. Radiochemistry of astatine

    International Nuclear Information System (INIS)

    Ruth, T.J.; Dombsky, M.; D'Auria, J.M.; Ward, T.E.

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs

  2. Formation and decomposition of astatine molecules

    International Nuclear Information System (INIS)

    Takahashi, Naruto; Ishikuro, Mituhiro; Baba Hiroshi

    1989-01-01

    A method determining the boiling points of elementary astatine and astatine iodide has been developed (K. Otozai and N. Takahashi, Radio. Chim. Acta 31, (1982) 201). Further, it was concluded from the simple rule among the boiling point of elementary halogens and interhalogen compounds that elementary astatine might exist in diatomic molecules as the other halogens. In the present work the reaction mechanisms of elementary astatine with radioactive iodine and organic solvents were studied by means of radiogaschromatography in order to obtain further experimental evidences for diatomic astaine molecules. The following conclusions were obtained by the analysis of reaction kinetics. Two astatine atoms are lost from the elementary astatine fraction per each radioactive decay of astatine. The astatine radical or hot atom liberated by the decay of the complementary astatine atom immediately reacts with iodine or organic solvents. Thus formed astatine compounds decompose in turn due to the decay of astatine

  3. Organic astatine compounds, their preparation and properties

    Energy Technology Data Exchange (ETDEWEB)

    Vasaros, L; Berei, K

    1985-01-01

    Aromatic astatine compounds of possible medical application were prepared by high energy substitutions, by astatine-halogen, and by electrophil astatine-hydrogen substitutions at the Joint Institute of Nuclear Researches, Dubna. Physico-chemical properties of organic astatine compounds such as boiling point and evaporation heat, and the refraction and dissociation energy of carbon-astatine bonds were determined experimentally by gas chromatography. The results are compared with extrapolated data. (V.N.). 41 refs.; 7 figs.; 5 tables.

  4. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    Berei, K.; Vasaros, L.

    1992-02-01

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211 At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  5. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Berei, K.; Vasaros, L.

    1994-03-01

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211 At species, 211 At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  6. Experimental and computational evidence of halogen bonds involving astatine

    Science.gov (United States)

    Guo, Ning; Maurice, Rémi; Teze, David; Graton, Jérôme; Champion, Julie; Montavon, Gilles; Galland, Nicolas

    2018-03-01

    The importance of halogen bonds—highly directional interactions between an electron-deficient σ-hole moiety in a halogenated compound and an acceptor such as a Lewis base—is being increasingly recognized in a wide variety of fields from biomedicinal chemistry to materials science. The heaviest halogens are known to form stronger halogen bonds, implying that if this trend continues down the periodic table, astatine should exhibit the highest halogen-bond donating ability. This may be mitigated, however, by the relativistic effects undergone by heavy elements, as illustrated by the metallic character of astatine. Here, the occurrence of halogen-bonding interactions involving astatine is experimentally evidenced. The complexation constants of astatine monoiodide with a series of organic ligands in cyclohexane solution were derived from distribution coefficient measurements and supported by relativistic quantum mechanical calculations. Taken together, the results show that astatine indeed behaves as a halogen-bond donor—a stronger one than iodine—owing to its much more electrophilic σ-hole.

  7. The reaction of astatine with aromatic diazonium compounds

    International Nuclear Information System (INIS)

    Visser, G.W.M.; Diemer, E.L.

    1982-01-01

    Astatine reacts prefrentially with that type of aromatic diazonium salt that decomposes via a radical reaction channel (homolytic breakage of the C-N bond). The dediazonation with p-aminobenzoic acid and p-toluidine as model compounds was investigated through estatin produced in the 209 Bi(α,2n) 211 At reaction. (author)

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    Science.gov (United States)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Köster, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjödin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine. PMID:23673620

  9. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...... vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  10. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single...... to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3......-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison...

  11. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Visser, G.W.M.

    1982-01-01

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments ( 209 At, 210 At, 211 At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  12. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    Sjoestroem, A.; Carlsson, J.; Lundqvist, H.; Koziorowski, J.

    2003-01-01

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  13. Estimation of the chemical form and the boiling point of elementary astatine by radiogas-chromatography

    International Nuclear Information System (INIS)

    Otozai, K.; Takahashi, N.

    1982-01-01

    After astatine (0) was mixed with 131 I 2 containing carrier I 2 , the sample was analyzed by means of radiogaschromatography and the peaks due to I 2 , AtI and At 2 were observed. Further, the boiling points were estimated from the retention volume in terms of the semi-empirical theory on gas chromatography. The boiling points of I 2 , AtI and At 2 were 457 +- 2,486 +- 2 and 503 +- 3K, respectively. The boiling point of At 2 obtained in the present work is far smaller than that expected by the extrapolation of lighter halogens. (orig.)

  14. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    Czech Academy of Sciences Publication Activity Database

    Sjostrom, A.; Tolmachev, V.; Lebeda, Ondřej; Koziorowski, J.; Carlsson, J.; Lundqvist, H.

    2003-01-01

    Roč. 256, č. 7 (2003), s. 191-197 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Keywords : neutron-capture therapy * astatine-211 Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.472, year: 2003

  15. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Pruszynski, M.; Bilewicz, A.

    2006-01-01

    211 At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211 At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At - to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh 3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At - anions, but first of all because of the kinetic inertness of low spin rhodium(III) d 6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh 3+ . The experiments related to optimization of the reaction conditions were performed with the 131 I, basing on a chemical similarity of I - to At - . The experiments with 211 At were then carried out under the conditions found optimal for I - . The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211 At-Rh(16-S4-diol) complex

  16. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  17. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  18. Thermogravimetric determination of the enthalpy of astatine and radon adsorption on palladium surfaces

    International Nuclear Information System (INIS)

    Eichler, B.; Son Chun, K.

    1985-01-01

    In order to investigate the adsorption of astatine and radon on a palladium surface some on- and off-line thermochromatographic experiments were carried out with 210 At and 220 Rn tracers. The partial molar adsorption enthalpy for zero covering was found to be ΔH/sub a//sup 0, loc./(At) = -(15S +- 10) kJ mole -1 and ΔH/sub a//sup 0, mob./(Rn) = -(37 +- 4) kJ mole -1 . The results are compared with theoretical and experimental values for other elements of the sixth period. The adsorption behaviour of At is in conformity with that of the p-metals on a palladium surface. (author)

  19. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  20. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    International Nuclear Information System (INIS)

    Lahiri, Susanta; Roy, Kamalika; Sen, Souvik

    2008-01-01

    No-carrier-added astatine radionuclides produced in the 7 Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about ∼12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h

  1. Astatine-211 Radiochemistry: The Development Of Methodologies For High Activity Level Radiosynthesis

    International Nuclear Information System (INIS)

    Zalutsky, Michael R.

    2012-01-01

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for α-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the α-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At-labeled targeted

  2. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  3. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  4. In vitro evaluation of the astatinated chimeric monoclonal antibody U36, a potential candidate for treatment of head and neck squamous cell carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Nestor, M.; Anniko, M. [Uppsala University, Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala (Sweden); Persson, M. [Uppsala University, Unit of Urology, Department of Surgical Sciences, Uppsala (Sweden); Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden); Dongen, G.A.M.S. van [Vrije Universiteit Medical Center, Department of Otolaryngology/Head and Neck Surgery, Amsterdam (Netherlands); Jensen, H.J. [Righshospitalet, PET and Cyclotron Unit, Department of Clinical Physiology and Nuclear Medicine, Copenhagen (Denmark); Lundqvist, H.; Tolmachev, V. [Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden)

    2005-11-01

    The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with {sup 211}At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with {sup 125}I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with {sup 131}I-labelled cMAb U36 (directly labelled). Comparisons between {sup 211}At-cMAb U36 and {sup 125}I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31{+-}2% vs 42.6{+-}1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for {sup 211}At-cMAb U36, with about 10% cell survival at 50 decays per cell. The {sup 131}I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)

  5. In vitro evaluation of the astatinated chimeric monoclonal antibody U36, a potential candidate for treatment of head and neck squamous cell carcinoma

    International Nuclear Information System (INIS)

    Nestor, M.; Anniko, M.; Persson, M.; Dongen, G.A.M.S. van; Jensen, H.J.; Lundqvist, H.; Tolmachev, V.

    2005-01-01

    The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with 211 At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with 125 I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with 131 I-labelled cMAb U36 (directly labelled). Comparisons between 211 At-cMAb U36 and 125 I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31±2% vs 42.6±1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for 211 At-cMAb U36, with about 10% cell survival at 50 decays per cell. The 131 I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)

  6. High-efficiency astatination of antibodies using N-iodosuccinimide as the oxidising agent in labelling of N-succinimidyl 3-(trimethylstannyl)benzoate

    International Nuclear Information System (INIS)

    Lindegren, S.; Andersson, H.; Baeck, T.; Jacobsson, L.; Karlsson, B.; Skarnemark, G.

    2001-01-01

    Monoclonal antibodies C215, reactive with colorectal carcinomas, and MOv18, reactive with most of the ovarian carcinomas, were radiohalogenated with [ 211 At]astatine. The radiohalogen was conjugate coupled to antibodies via the intermediate labelling reagent N-succinimidyl-3-(trimethylstannyl)benzoate (m-MeATE) in a two-step, single-pot reaction. Optimisation of the labelling of the reagent was achieved using N-iodosuccinimide, NIS, as the oxidising agent. The yields ranged from 69-95% in the labelling of 0.1-1.0 nmole of the m-MeATE precursor. Subsequent conjugation to antibodies resulted in yields of 58±7%. In vitro binding to tumour cells showed that the immunoreactivity of both antibodies was retained after astatine labelling

  7. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  8. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    Rothe, Sebastian

    2012-01-01

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  9. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  10. Radiobiological Effects of Alpha-Particles from Astatine-211: From DNA Damage to Cell Death

    Energy Technology Data Exchange (ETDEWEB)

    Claesson, Kristina

    2011-05-15

    In recent years, the use of high linear energy transfer (LET) radiation for radiotherapeutic applications has gained increased interest. Astatine-211 (211At) is an alpha-particle emitting radionuclide, promising for targeted radioimmunotherapy of isolated tumor cells and microscopic clusters. To improve development of safe radiotherapy using 211At it is important to increase our knowledge of the radiobiological effects in cells. During radiotherapy, both tumors and adjacent normal tissue will be irradiated and therefore, it is of importance to understand differences in the radio response between proliferating and resting cells. The aim of this thesis was to investigate effects in fibroblasts with different proliferation status after irradiation with alpha-particles from 211At or X-rays, from inflicted DNA damage, to cellular responses and biological consequences. Throughout this work, irradiation was performed with alpha-particles from 211A or X-rays. The induction and repair of double-strand breaks (DSBs) in human normal fibroblasts were investigated using pulsed-field gel electrophoresis and fragment analysis. The relative biological effectiveness (RBE) of 211At for DSB induction varied between 1.4 and 3.1. A small increase of DSBs was observed in cycling cells compared to stationary cells. The repair kinetics was slower after 211At and more residual damage was found after 24 h. Comparison between cells with different proliferation status showed that the repair was inefficient in cycling cells with more residual damage, regardless of radiation quality. Activation of cell cycle arrests was investigated using immunofluorescent labeling of the checkpoint kinase Chk2 and by measuring cell cycle distributions with flow cytometry analysis. After alpha-particle irradiation, the average number of Chk2-foci was larger and the cells had a more affected cell cycle progression for several weeks compared with X-irradiated cells, indicating a more powerful arrest after 211At

  11. 17 CFR 204.34 - Employee response.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Employee response. 204.34... DEBT COLLECTION Salary Offset § 204.34 Employee response. (a) Introduction. An employee must respond to... ways discussed in § 204.34, Employee response, and § 204.35, Petition for pre-offset hearing. Where...

  12. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  13. 7 CFR 1416.204 - Application process.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Application process. 1416.204 Section 1416.204 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT... PROGRAMS Livestock Indemnity Program II § 1416.204 Application process. (a) Applicants must submit to CCC a...

  14. 48 CFR 243.204 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Administration. 243.204... OF DEFENSE CONTRACT MANAGEMENT CONTRACT MODIFICATIONS Change Orders 243.204 Administration. Follow the procedures at PGI 243.204 for administration of change orders. [75 FR 48277, Aug. 10, 2010] ...

  15. 32 CFR 204.6 - Collections.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Collections. 204.6 Section 204.6 National... USER FEES § 204.6 Collections. (a) Collections of fees will be made in advance or simultaneously with..., and managing cash and debt collections. (b) Unless a statute provides otherwise, user fee collections...

  16. 42 CFR 93.204 - Contract.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Contract. 93.204 Section 93.204 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS... MISCONDUCT Definitions § 93.204 Contract. Contract means an acquisition instrument awarded under the HHS...

  17. 48 CFR 811.204 - Contract clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clause. 811.204 Section 811.204 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS COMPETITION AND ACQUISITION PLANNING DESCRIBING AGENCY NEEDS Using and Maintaining Requirements Documents 811.204 Contract...

  18. 9 CFR 204.7 - Appeals.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Appeals. 204.7 Section 204.7 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS... person whose request under § 204.6 of this part is denied shall have the right to appeal such denial in...

  19. 24 CFR 100.204 - Reasonable accommodations.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Reasonable accommodations. 100.204 Section 100.204 Housing and Urban Development Regulations Relating to Housing and Urban Development OFFICE... dog. The building has a no pets policy. It is a violation of § 100.204 for the owner or manager of the...

  20. 19 CFR 204.5 - Reports.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Reports. 204.5 Section 204.5 Customs Duties UNITED... ON AGRICULTURAL PROGRAMS § 204.5 Reports. After completion of its investigation, the Commission will transmit to the President a report of the results thereof, including its findings and recommendations based...

  1. 28 CFR 16.204 - Public notice.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Public notice. 16.204 Section 16.204 Judicial Administration DEPARTMENT OF JUSTICE PRODUCTION OR DISCLOSURE OF MATERIAL OR INFORMATION Public Observation of Parole Commission Meetings § 16.204 Public notice. (a) Requirements. Every open meeting and...

  2. 13 CFR 500.204 - Loan terms.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Loan terms. 500.204 Section 500.204 Business Credit and Assistance EMERGENCY OIL AND GAS GUARANTEED LOAN BOARD EMERGENCY OIL AND GAS GUARANTEED LOAN PROGRAM Oil and Gas Guaranteed Loans § 500.204 Loan terms. (a) All loans guaranteed under the...

  3. 13 CFR 400.204 - Loan terms.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Loan terms. 400.204 Section 400.204 Business Credit and Assistance EMERGENCY STEEL GUARANTEE LOAN BOARD EMERGENCY STEEL GUARANTEE LOAN PROGRAM Steel Guarantee Loans § 400.204 Loan terms. (a) All loans guaranteed under the Program shall be...

  4. 22 CFR 204.43 - Governing law.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Governing law. 204.43 Section 204.43 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT HOUSING GUARANTY STANDARD TERMS AND CONDITIONS Administration § 204.43 Governing law. This Guaranty shall be governed by and construed in accordance with the laws of...

  5. 22 CFR 20.4 - Retirement benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Retirement benefits. 20.4 Section 20.4 Foreign Relations DEPARTMENT OF STATE PERSONNEL BENEFITS FOR CERTAIN FORMER SPOUSES § 20.4 Retirement benefits. (a) Type of benefits. (1) A former spouse who meets the qualification requirements of § 20.3 is entitled to...

  6. 7 CFR 1430.204 - Requesting benefits.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Requesting benefits. 1430.204 Section 1430.204... Program § 1430.204 Requesting benefits. (a) A request for benefits or contract application, under this... MILC benefits must certify the accuracy and truthfulness of the information in their contract...

  7. 40 CFR 240.204 - Water quality.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Water quality. 240.204 Section 240.204 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE THERMAL PROCESSING OF SOLID WASTES Requirements and Recommended Procedures § 240.204 Water quality. ...

  8. 40 CFR 243.204 - Collection management.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Collection management. 243.204 Section 243.204 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES... and Recommended Procedures § 243.204 Collection management. ...

  9. 37 CFR 204.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Definitions. 204.2 Section 204.2 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES PRIVACY ACT: POLICIES AND PROCEDURES § 204.2 Definitions. For purposes of this part: (a) The term...

  10. 37 CFR 204.3 - General policy.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false General policy. 204.3 Section 204.3 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES PRIVACY ACT: POLICIES AND PROCEDURES § 204.3 General policy. The Copyright Office serves primarily...

  11. 37 CFR 204.9 - Judicial review.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Judicial review. 204.9 Section 204.9 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES PRIVACY ACT: POLICIES AND PROCEDURES § 204.9 Judicial review. Within two years of the...

  12. 37 CFR 204.6 - Fees.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Fees. 204.6 Section 204.6 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES PRIVACY ACT: POLICIES AND PROCEDURES § 204.6 Fees. (a) The Copyright Office will provide, free of charge...

  13. 7 CFR 1280.204 - Appointment.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Appointment. 1280.204 Section 1280.204 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... INFORMATION ORDER Lamb Promotion, Research, and Information Order Lamb Promotion, Research, and Information...

  14. 17 CFR 204.6 - Agency review.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Agency review. 204.6 Section... COLLECTION Administrative Offset § 204.6 Agency review. (a) To the extent that a debt owed has not been... request to review a disputed debt must be submitted to the Commission official who provided notification...

  15. 48 CFR 39.204 - Exceptions.

    Science.gov (United States)

    2010-10-01

    ... CONTRACTING ACQUISITION OF INFORMATION TECHNOLOGY Electronic and Information Technology 39.204 Exceptions. The... standards to the maximum extent practicable; (b) Is for a national security system; (c) Is acquired by a... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Exceptions. 39.204 Section...

  16. 48 CFR 2052.204-70 - Security.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Security. 2052.204-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 2052.204-70 Security. As prescribed... National Security information, restricted data, formerly restricted data, and other classified data...

  17. 10 CFR 63.204 - Preclosure standard.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Preclosure standard. 63.204 Section 63.204 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN A GEOLOGIC REPOSITORY AT YUCCA... must ensure that no member of the public in the general environment receives more than an annual dose...

  18. 41 CFR 50-204.68 - Hydrogen.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Hydrogen. 50-204.68..., Vapors, Fumes, Dusts, and Mists § 50-204.68 Hydrogen. The in-plant transfer, handling, storage, and utilization of hydrogen shall be in accordance with Compressed Gas Association Pamphlets G-5.1-1961 and G-5.2...

  19. 31 CFR 800.204 - Control.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Control. 800.204 Section 800.204 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT... preferences of the particular class of stock held by minority investors, as provided in the relevant corporate...

  20. 47 CFR 25.204 - Power limits.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Power limits. 25.204 Section 25.204 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS... purposes shall be coordinated between and among adjacent satellite operators. (f) In the band 13.75-14 GHz...

  1. 31 CFR 539.204 - Exempt transactions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Exempt transactions. 539.204 Section 539.204 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF... of services to market, produce or co-produce, create, or assist in the creation of information or...

  2. 28 CFR 36.204 - Administrative methods.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Administrative methods. 36.204 Section 36... PUBLIC ACCOMMODATIONS AND IN COMMERCIAL FACILITIES General Requirements § 36.204 Administrative methods... standards or criteria or methods of administration that have the effect of discriminating on the basis of...

  3. 19 CFR 10.204 - Imported directly.

    Science.gov (United States)

    2010-04-01

    ... customs authority in the intermediate country; (2) Did not enter into the commerce of the intermediate... 19 Customs Duties 1 2010-04-01 2010-04-01 false Imported directly. 10.204 Section 10.204 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY...

  4. 48 CFR 204.7101 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... OF DEFENSE GENERAL ADMINISTRATIVE MATTERS Uniform Contract Line Item Numbering System 204.7101 Definitions. Accounting classification reference number (ACRN) means any combination of a two position alpha... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Definitions. 204.7101...

  5. 44 CFR 206.204 - Project performance.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Project performance. 206.204... § 206.204 Project performance. (a) General. This section describes the policies and procedures applicable during the performance of eligible work. (b) Advances of funds. Advances of funds will be made in...

  6. Dicty_cDB: SLH204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH204 (Link to dictyBase) - - - Contig-U15479-1 SLH204Z (Link... to Original site) - - SLH204Z 657 - - - - Show SLH204 Library SL (Link to library) Clone ID SLH204 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH204Q.Seq.d/ Representative seq. ID SLH20...4Z (Link to Original site) Representative DNA sequence >SLH204 (SLH204Q) /CSM/SL/SLH2-A/SLH204Q.Seq.d/ XXXXX...g significant alignments: (bits) Value N ( AU039226 ) Dictyostelium discoideum slug cDNA, clone SLH204. 930

  7. 41 CFR 109-50.204 - Limitations.

    Science.gov (United States)

    2010-07-01

    ... DISPOSAL AUTHORITIES 50.2-Math and Science Equipment Gift Program § 109-50.204 Limitations. (a) Excess and... (or unlimited) level of authority. (d) Gifts shall be serviceable and in working order. Disposal...

  8. 30 CFR 204.204 - What accounting and auditing relief will MMS not allow?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What accounting and auditing relief will MMS... INTERIOR MINERALS REVENUE MANAGEMENT ALTERNATIVES FOR MARGINAL PROPERTIES Accounting and Auditing Relief § 204.204 What accounting and auditing relief will MMS not allow? MMS will not approve your request for...

  9. 20 CFR 633.204 - Responsibility review.

    Science.gov (United States)

    2010-04-01

    ... SEASONAL FARMWORKER PROGRAMS Grant Planning and Application Procedures § 633.204 Responsibility review. (a...) Established fraud or criminal activity within the organization. (4) Wilfull obstruction of the audit process... hand. (11) Failure to procure or arrange for audit coverage for any two year period when required by...

  10. 40 CFR 204.57 - Selective enforcement auditing.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Selective enforcement auditing. 204.57 Section 204.57 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT... enforcement auditing. ...

  11. 48 CFR 27.204 - Patented technology under trade agreements.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Patented technology under trade agreements. 27.204 Section 27.204 Federal Acquisition Regulations System FEDERAL ACQUISITION... Patented technology under trade agreements. ...

  12. 41 CFR 50-204.8 - Use of compressed air.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Use of compressed air. 50-204.8 Section 50-204.8 Public Contracts and Property Management Other Provisions Relating to Public... General Safety and Health Standards § 50-204.8 Use of compressed air. Compressed air shall not be used for...

  13. 12 CFR 204.3 - Reporting and location.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Reporting and location. 204.3 Section 204.3... REQUIREMENTS OF DEPOSITORY INSTITUTIONS (REGULATION D) § 204.3 Reporting and location. (a) Every depository... corporation is located in the Federal Reserve District that contains the location specified in the institution...

  14. 48 CFR 204.101 - Contracting officer's signature.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contracting officer's signature. 204.101 Section 204.101 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... officer's signature. Follow the procedures at PGI 204.101 for signature of contract documents. [71 FR 9268...

  15. 5 CFR 2638.204 - Deputy ethics official.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Deputy ethics official. 2638.204 Section 2638.204 Administrative Personnel OFFICE OF GOVERNMENT ETHICS GOVERNMENT ETHICS OFFICE OF GOVERNMENT ETHICS AND EXECUTIVE AGENCY ETHICS PROGRAM RESPONSIBILITIES Designated Agency Ethics Official § 2638.204...

  16. 41 CFR 101-6.204 - Discrimination prohibited.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Discrimination prohibited. 101-6.204 Section 101-6.204 Public Contracts and Property Management Federal Property Management...-Nondiscrimination in Programs Receiving Federal Financial Assistance § 101-6.204 Discrimination prohibited. ...

  17. 40 CFR 204.3 - Number and gender.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Number and gender. 204.3 Section 204.3... STANDARDS FOR CONSTRUCTION EQUIPMENT General Provisions § 204.3 Number and gender. As used in this part, words in the singular shall be deemed to import the plural, and words in the masculine gender shall be...

  18. 29 CFR 20.4 - Determination of delinquency; notice.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Determination of delinquency; notice. 20.4 Section 20.4 Labor Office of the Secretary of Labor FEDERAL CLAIMS COLLECTION Disclosure of Information to Credit Reporting Agencies § 20.4 Determination of delinquency; notice. (a) The agency head (or designee...

  19. 41 CFR 50-204.36 - Radiation standards for mining.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Radiation standards for mining. 50-204.36 Section 50-204.36 Public Contracts and Property Management Other Provisions Relating to... CONTRACTS Radiation Standards § 50-204.36 Radiation standards for mining. (a) For the purpose of this...

  20. 37 CFR 204.1 - Purposes and scope.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Purposes and scope. 204.1 Section 204.1 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES PRIVACY ACT: POLICIES AND PROCEDURES § 204.1 Purposes and scope. The purposes of these...

  1. 20 CFR 726.204 - Statutory policy provisions.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Statutory policy provisions. 726.204 Section 726.204 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR FEDERAL COAL MINE HEALTH AND SAFETY ACT OF 1969, AS AMENDED BLACK LUNG BENEFITS; REQUIREMENTS FOR COAL MINE OPERATOR'S...

  2. 48 CFR 952.204-77 - Computer security.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Computer security. 952.204... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.204-77 Computer security. As prescribed in 904.404(d)(7), the following clause shall be included: Computer Security (AUG 2006) (a...

  3. 41 CFR 50-204.69 - Nitrous oxide.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Nitrous oxide. 50-204.69..., Vapors, Fumes, Dusts, and Mists § 50-204.69 Nitrous oxide. The piped systems for the in-plant transfer and distribution of nitrous oxide shall be designed, installed, maintained, and operated in accordance...

  4. 41 CFR 105-72.204 - Special award conditions.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Special award conditions. 105-72.204 Section 105-72.204 Public Contracts and Property Management Federal Property Management... award conditions. If an applicant or recipient: (a) Has a history of poor performance, (b) Is not...

  5. 7 CFR 400.204 - Notification of deviation from standards.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Notification of deviation from standards. 400.204... Contract-Standards for Approval § 400.204 Notification of deviation from standards. A Contractor shall advise the Corporation immediately if the Contractor deviates from the requirements of these standards...

  6. 6 CFR 27.204 - Minimum concentration by security issue.

    Science.gov (United States)

    2010-01-01

    ... Section 27.204 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY CHEMICAL FACILITY ANTI-TERRORISM STANDARDS Chemical Facility Security Program § 27.204 Minimum concentration by security issue. (a) Release Chemicals—(1) Release-Toxic Chemicals. If a release-toxic chemical of interest...

  7. 7 CFR 3015.204 - Federal Register publications.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Federal Register publications. 3015.204 Section 3015.204 Agriculture Regulations of the Department of Agriculture (Continued) OFFICE OF THE CHIEF FINANCIAL... Register publications. (a) Program regulations. Most grant programs have program-specific regulations...

  8. 24 CFR 3285.204 - Ground moisture control.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Ground moisture control. 3285.204 Section 3285.204 Housing and Urban Development Regulations Relating to Housing and Urban Development... moisture control. (a) Vapor retarder. If the space under the home is to be enclosed with skirting or other...

  9. 48 CFR 243.204-70-2 - Price ceiling.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Price ceiling. 243.204-70..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT CONTRACT MODIFICATIONS Change Orders 243.204-70-2 Price ceiling. Unpriced change orders shall include a not-to-exceed price. [75 FR 48277, Aug. 10, 2010] ...

  10. 7 CFR 62.204 - Authority to request service.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Authority to request service. 62.204 Section 62.204 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... prove his/her financial interest in the product or service at the discretion of the Deputy Administrator. ...

  11. 15 CFR 20.4 - Rules against age discrimination.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Rules against age discrimination. 20.4 Section 20.4 Commerce and Foreign Trade Office of the Secretary of Commerce NONDISCRIMINATION ON THE BASIS..., be excluded from participation in, be denied the benefits of, or be subjected to discrimination under...

  12. 40 CFR 204.5-2 - National security exemptions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false National security exemptions. 204.5-2... PROGRAMS NOISE EMISSION STANDARDS FOR CONSTRUCTION EQUIPMENT General Provisions § 204.5-2 National security... for a national security exemption is required. (c) For purposes of section 11(d) of the Act, any...

  13. Growth of Enterococcus durans E204 producing bacteriocin-like ...

    African Journals Online (AJOL)

    Bacteriocin-like substance E204 is an antimicrobial compound produced by Enterococcus durans E204 isolated from camel milk of Morocco that shows a broad spectrum of inhibitory activity against taxonomically related microorganisms. It is sensitive to digestive proteases. In the first study, de Man, Regosa and Sharpe ...

  14. 23 CFR 973.204 - Management systems requirements.

    Science.gov (United States)

    2010-04-01

    ... system; (2) A process to operate and maintain the management systems and their associated databases; (3... may include consultation with the tribes, as appropriate. (k) The management systems shall be operated... 23 Highways 1 2010-04-01 2010-04-01 false Management systems requirements. 973.204 Section 973.204...

  15. 33 CFR 135.204 - Submission of evidence.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Submission of evidence. 135.204 Section 135.204 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OFFSHORE OIL POLLUTION COMPENSATION FUND...

  16. 44 CFR 204.53 - Certifying costs and payments.

    Science.gov (United States)

    2010-10-01

    ....21 and U. S. Treasury 31 CFR part 205, Cash Management Improvement Act. ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Certifying costs and payments. 204.53 Section 204.53 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY...

  17. 12 CFR 204.7 - Supplemental reserve requirement.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Supplemental reserve requirement. 204.7 Section... RESERVE REQUIREMENTS OF DEPOSITORY INSTITUTIONS (REGULATION D) § 204.7 Supplemental reserve requirement... reserve requirement on every depository institution of not more than 4 percent of its total transaction...

  18. 12 CFR 204.10 - Payment of interest on balances.

    Science.gov (United States)

    2010-01-01

    ... 204.10 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM RESERVE REQUIREMENTS OF DEPOSITORY INSTITUTIONS (REGULATION D) § 204.10 Payment of interest on balances. (a) Payment of interest. The Federal Reserve Banks shall pay interest on balances maintained at...

  19. 12 CFR 204.9 - Emergency reserve requirement.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Emergency reserve requirement. 204.9 Section... RESERVE REQUIREMENTS OF DEPOSITORY INSTITUTIONS (REGULATION D) § 204.9 Emergency reserve requirement. (a..., additional reserve requirements on depository institutions at any ratio on any liability upon a finding by at...

  20. 48 CFR 3003.204 - Treatment of violations.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Treatment of violations. 3003.204 Section 3003.204 Federal Acquisition Regulations System DEPARTMENT OF HOMELAND SECURITY, HOMELAND SECURITY ACQUISITION REGULATION (HSAR) GENERAL IMPROPER BUSINESS PRACTICES AND PERSONAL CONFLICTS...

  1. 48 CFR 952.204-75 - Public affairs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Public affairs. 952.204-75... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.204-75 Public affairs. As prescribed in 904.7201, insert the following clause: Public Affairs (DEC 2000) (a) The Contractor must...

  2. 7 CFR 1726.204 - Multiparty unit price quotations.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Multiparty unit price quotations. 1726.204 Section....204 Multiparty unit price quotations. The borrower or its engineer must contact a sufficient number of... basis of written unit price quotations, the borrower will select the supplier or contractor based on the...

  3. Oblate shapes of 200,202,204Hg

    International Nuclear Information System (INIS)

    Bockisch, A.; Bharuth-Ram, K.; Kleinfeld, A.M.; Lieb, K.P.

    1979-01-01

    Measurements of the reorientation effect for the first excited 2 + states in 200 , 202 , 204 Hg were performed by exploiting the dependence of the γ-ray yield on Q 2 + for different projectiles. For 200 Hg, a positive quadrupole moment of Q 2 = 0.96 +- 0.11 eb (for negative interference) or Q 2 = 1.11 +- 0.11 eb (for positive interference) was determined indicating an oblate shape. Small positive Q 2 values were also found for 202 Hg and 204 Hg. Nine B(E2) values for excitation of the 2 + , 2 + ' and 4 + states in 196-204 Hg were measured. (orig.) [de

  4. 5 CFR 2640.204 - Prohibited financial interests.

    Science.gov (United States)

    2010-01-01

    ....204: The Office of the Comptroller of the Currency (OCC), in a regulation that supplements part 2635...) for interests arising from the ownership of no more than $15,000 worth of publicly traded stock will...

  5. 40 CFR 211.204-3 - Label location and type.

    Science.gov (United States)

    2010-07-01

    ... packaging if the label complying with § 211.204-3(a)(1) is not visible at the point of ultimate purchase or...) If the protector is individually packaged and so displayed at the point of ultimate purchase or... the protector is displayed at the point of ultimate purchase or distribution to prospective users in a...

  6. 42 CFR 422.204 - Provider selection and credentialing.

    Science.gov (United States)

    2010-10-01

    ... SERVICES (CONTINUED) MEDICARE PROGRAM MEDICARE ADVANTAGE PROGRAM Relationships With Providers § 422.204... with respect to providers and suppliers who have signed contracts or participation agreements that— (1... indicators such as those collected through quality improvement programs, utilization management systems...

  7. 12 CFR 1806.204 - Applications for Bank Enterprise Awards.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Applications for Bank Enterprise Awards. 1806... OF THE TREASURY BANK ENTERPRISE AWARD PROGRAM Awards § 1806.204 Applications for Bank Enterprise... Enterprise Awards in accordance with this section and the applicable NOFA. After receipt of an application...

  8. 41 CFR 50-204.75 - Transportation safety.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Transportation safety. 50... Transportation Safety § 50-204.75 Transportation safety. Any requirements of the U.S. Department of Transportation under 49 CFR Parts 171-179 and Parts 390-397 and 14 CFR Part 103 shall be applied to...

  9. 9 CFR 113.204 - Mink Enteritis Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mink Enteritis Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.204 Mink Enteritis Vaccine, Killed Virus. Mink Enteritis Vaccine...

  10. 27 CFR 46.204 - Articles in transit.

    Science.gov (United States)

    2010-04-01

    ... Tubes Held for Sale on April 1, 2009 Inventories § 46.204 Articles in transit. The dealer must include articles subject to floor stocks tax that are in transit in the inventory if the dealer holds title to... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Articles in transit. 46...

  11. 5 CFR 870.204 - Annual rates of pay.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Annual rates of pay. 870.204 Section 870... rates of pay. (a) (1) An insured employee's annual pay is his/her annual rate of basic pay as fixed by law or regulation. (2) Annual pay for this purpose includes the following: (i) Interim geographic...

  12. 18 CFR 367.2040 - Account 204, Preferred stock issued.

    Science.gov (United States)

    2010-04-01

    ... GAS ACT Balance Sheet Chart of Accounts Proprietary Capital § 367.2040 Account 204, Preferred stock... REGULATORY COMMISSION, DEPARTMENT OF ENERGY REGULATIONS UNDER THE PUBLIC UTILITY HOLDING COMPANY ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT UNIFORM SYSTEM OF ACCOUNTS FOR CENTRALIZED SERVICE COMPANIES SUBJECT...

  13. 40 CFR 204.55-3 - Configuration identification.

    Science.gov (United States)

    2010-07-01

    ... PROGRAMS NOISE EMISSION STANDARDS FOR CONSTRUCTION EQUIPMENT Portable Air Compressors § 204.55-3... the following parameters: (1) The compressor type (screw, sliding vane, etc.). (2) Number of compressor stages. (3) Maximum pressure (psi). (4) Air intake system of compressor: (i) Number of filters...

  14. 48 CFR 204.470-2 - National security exclusion.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false National security... Within Industry 204.470-2 National security exclusion. (a) The U.S.-IAEA AP permits the United States... associated with such activities, with direct national security significance. (b) In order to ensure that all...

  15. 48 CFR 52.204-2 - Security Requirements.

    Science.gov (United States)

    2010-10-01

    ... Agreement (DD Form 441), including the National Industrial Security Program Operating Manual (DOD 5220.22-M... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Security Requirements. 52....204-2 Security Requirements. As prescribed in 4.404(a), insert the following clauses: Security...

  16. 48 CFR 52.204-7 - Central Contractor Registration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Central Contractor....204-7 Central Contractor Registration. As prescribed in 4.1105, use the following clause: Central Contractor Registration (APR 2008) (a) Definitions. As used in this clause— Central Contractor Registration...

  17. 48 CFR 3052.204-71 - Contractor employee access.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Contractor employee access... CLAUSES Text of Provisions and Clauses 3052.204-71 Contractor employee access. As prescribed in (HSAR) 48...: Contractor Employee Access (JUN 2006) (a) “Sensitive Information,” as used in this Chapter, means any...

  18. 48 CFR 1652.204-70 - Contractor records retention.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contractor records... of FEHBP Clauses 1652.204-70 Contractor records retention. As prescribed in 1604.705 the following clause will be inserted in all FEHB Program contracts. Contractor Records Retention (JUL 2005...

  19. 23 CFR 230.204 - Implementation of supportive services.

    Science.gov (United States)

    2010-04-01

    ... PROGRAMS Supportive Services for Minority, Disadvantaged, and Women Business Enterprises § 230.204... training and assistance programs specifically for the benefit of women and minority businesses. Supportive... only to those minority business enterprises determined to be eligible for participation in the Federal...

  20. 40 CFR 2.204 - Initial action by EPA office.

    Science.gov (United States)

    2010-07-01

    ... paragraph (c)(1) of this section discloses the existence of any business which, although it has not asserted... Confidentiality of Business Information § 2.204 Initial action by EPA office. (a) Situations requiring action... whether business information is entitled to confidential treatment for reasons of business confidentiality...

  1. 41 CFR 109-38.204-1 - Unlimited exemptions.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Unlimited exemptions... Regulations System (Continued) DEPARTMENT OF ENERGY PROPERTY MANAGEMENT REGULATIONS AVIATION, TRANSPORTATION... § 109-38.204-1 Unlimited exemptions. (a)-(f) [Reserved] (g) The Director, Office of Administrative...

  2. 41 CFR 101-6.204-3 - Special benefits.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Special benefits. 101-6...-Nondiscrimination in Programs Receiving Federal Financial Assistance § 101-6.204-3 Special benefits. An individual shall not be deemed subjected to discrimination by reason of his exclusion from benefits limited by...

  3. 42 CFR 50.204 - Informed consent requirement.

    Science.gov (United States)

    2010-10-01

    ... APPLICABILITY Sterilization of Persons in Federally Assisted Family Planning Projects § 50.204 Informed consent... available alternative methods of family planning and birth control; (3) Advice that the sterilization... effectively communicated to any individual to be sterilized who is blind, deaf or otherwise handicapped. (d) A...

  4. 12 CFR 204.4 - Computation of required reserves.

    Science.gov (United States)

    2010-01-01

    ... RESERVE REQUIREMENTS OF DEPOSITORY INSTITUTIONS (REGULATION D) § 204.4 Computation of required reserves. (a) In determining the reserve requirement under this part, the amount of cash items in process of... reserves are computed by applying the reserve requirement ratios below to net transaction accounts...

  5. 12 CFR 204.1 - Authority, purpose and scope.

    Science.gov (United States)

    2010-01-01

    ....1 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM RESERVE REQUIREMENTS OF DEPOSITORY INSTITUTIONS (REGULATION D) § 204.1 Authority, purpose and scope. (a) Authority... the Federal Reserve Act and of section 7 of the International Banking Act of 1978 (12 U.S.C. 3105). (b...

  6. 12 CFR 204.8 - International banking facilities.

    Science.gov (United States)

    2010-01-01

    ... RESERVE REQUIREMENTS OF DEPOSITORY INSTITUTIONS (REGULATION D) § 204.8 International banking facilities... reserve requirements. An institution that is subject to the reserve requirements of this part is not... to reserve requirements under this part or result in the revocation of the institution's ability to...

  7. 42 CFR 460.204 - Financial recordkeeping and reporting requirements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Financial recordkeeping and reporting requirements...-INCLUSIVE CARE FOR THE ELDERLY (PACE) Data Collection, Record Maintenance, and Reporting § 460.204 Financial... financial statements. (c) Accepted reporting practices. Except as specified under Medicare principles of...

  8. Tank 241-B-204 push mode core sampling and analysis plan. Revision 1

    International Nuclear Information System (INIS)

    Sasaki, L.M.

    1995-01-01

    This Sampling and Analysis Plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for two push-mode core samples from tank 241-B-204 (B-204)

  9. 41 CFR 50-204.6 - Medical services and first aid.

    Science.gov (United States)

    2010-07-01

    ... first aid. 50-204.6 Section 50-204.6 Public Contracts and Property Management Other Provisions Relating... SUPPLY CONTRACTS General Safety and Health Standards § 50-204.6 Medical services and first aid. (a) The... trained to render first aid. First aid supplies approved by the consulting physician shall be readily...

  10. 30 CFR 250.204 - How must I protect the rights of the Federal government?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How must I protect the rights of the Federal government? 250.204 Section 250.204 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR... Information § 250.204 How must I protect the rights of the Federal government? (a) To protect the rights of...

  11. 38 CFR 1.204 - Information to be reported to the Office of Inspector General.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Information to be reported to the Office of Inspector General. 1.204 Section 1.204 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS GENERAL PROVISIONS Referrals of Information Regarding Criminal Violations § 1.204 Information to be reported to the...

  12. 39 CFR 20.4 - Amendments to the International Mail Manual.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Amendments to the International Mail Manual. 20.4 Section 20.4 Postal Service UNITED STATES POSTAL SERVICE INTERNATIONAL MAIL INTERNATIONAL POSTAL SERVICE § 20.4 Amendments to the International Mail Manual. New issues of the International Mail Manual will be...

  13. 48 CFR 252.204-7001 - Commercial and Government Entity (CAGE) code reporting.

    Science.gov (United States)

    2010-10-01

    ... Entity (CAGE) code reporting. 252.204-7001 Section 252.204-7001 Federal Acquisition Regulations System... Entity (CAGE) Code Reporting (AUG 1999) (a) The offeror is requested to enter its CAGE code on its offer... AND CONTRACT CLAUSES Text of Provisions And Clauses 252.204-7001 Commercial and Government Entity...

  14. 46 CFR 180.204 - Survival craft-vessels operating on coastwise routes.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft-vessels operating on coastwise routes. 180.204 Section 180.204 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL... Craft § 180.204 Survival craft—vessels operating on coastwise routes. (a) Except as allowed by paragraph...

  15. 48 CFR 52.204-5 - Women-Owned Business (Other Than Small Business).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Women-Owned Business (Other Than Small Business). 52.204-5 Section 52.204-5 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.204-5 Women-Owned Business (Other Than Small Business). As prescribed in 4.607(b...

  16. 13 CFR 126.204 - May a qualified HUBZone SBC have affiliates?

    Science.gov (United States)

    2010-01-01

    ... affiliates? 126.204 Section 126.204 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION HUBZONE PROGRAM Requirements to be a Qualified HUBZone SBC § 126.204 May a qualified HUBZone SBC have affiliates? A concern may have affiliates provided that the aggregate size of the concern and all of its...

  17. 44 CFR 204.25 - FEMA-State agreement for fire management assistance grant program.

    Science.gov (United States)

    2010-10-01

    ... GRANT PROGRAM Declaration Process § 204.25 FEMA-State agreement for fire management assistance grant... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false FEMA-State agreement for fire management assistance grant program. 204.25 Section 204.25 Emergency Management and Assistance FEDERAL...

  18. 42 CFR 415.204 - Services of residents in skilled nursing facilities and home health agencies.

    Science.gov (United States)

    2010-10-01

    ... Services of Residents § 415.204 Services of residents in skilled nursing facilities and home health... 42 Public Health 3 2010-10-01 2010-10-01 false Services of residents in skilled nursing facilities and home health agencies. 415.204 Section 415.204 Public Health CENTERS FOR MEDICARE & MEDICAID...

  19. 48 CFR 2928.204 - Alternatives in lieu of corporate or individual sureties.

    Science.gov (United States)

    2010-10-01

    ... corporate or individual sureties. 2928.204 Section 2928.204 Federal Acquisition Regulations System... Bonds 2928.204 Alternatives in lieu of corporate or individual sureties. Upon receipt of any of the... of the security and coordinate the retention of the security with the Chief Financial Officer...

  20. 50 CFR 226.204 - Critical habitat for Sacramento winter-run chinook salmon.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Critical habitat for Sacramento winter-run chinook salmon. 226.204 Section 226.204 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL... § 226.204 Critical habitat for Sacramento winter-run chinook salmon. The following waterways, bottom and...

  1. 41 CFR 109-38.204-50 - Records of exempted motor vehicles.

    Science.gov (United States)

    2010-07-01

    ... motor vehicles. 109-38.204-50 Section 109-38.204-50 Public Contracts and Property Management Federal... AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 38-MOTOR EQUIPMENT MANAGEMENT 38.2-Registration, Identification, and Exemptions § 109-38.204-50 Records of exempted motor vehicles. The Director, Office of...

  2. 48 CFR 28.204-2 - Certified or cashiers checks, bank drafts, money orders, or currency.

    Science.gov (United States)

    2010-10-01

    ... checks, bank drafts, money orders, or currency. 28.204-2 Section 28.204-2 Federal Acquisition Regulations... Other Security for Bonds 28.204-2 Certified or cashiers checks, bank drafts, money orders, or currency... draft, Post Office money order, or currency, in an amount equal to the penal sum of the bond, instead of...

  3. 48 CFR 204.7206 - Using CAGE codes to identify agents and brokers.

    Science.gov (United States)

    2010-10-01

    ... identify agents and brokers. 204.7206 Section 204.7206 Federal Acquisition Regulations System DEFENSE... 204.7206 Using CAGE codes to identify agents and brokers. Authorized agents and brokers are entities... code will be assigned to the agent/broker establishment in addition to any codes assigned to the...

  4. 37 CFR 204.7 - Request for correction or amendment of records.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Request for correction or amendment of records. 204.7 Section 204.7 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES PRIVACY ACT: POLICIES AND PROCEDURES § 204.7 Request for...

  5. 37 CFR 204.8 - Appeal of refusal to correct or amend an individual's record.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Appeal of refusal to correct or amend an individual's record. 204.8 Section 204.8 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES PRIVACY ACT: POLICIES AND PROCEDURES § 204.8...

  6. 37 CFR 204.5 - Procedures for requesting access to records.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Procedures for requesting access to records. 204.5 Section 204.5 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES PRIVACY ACT: POLICIES AND PROCEDURES § 204.5 Procedures for...

  7. 48 CFR 25.204 - Evaluating offers of foreign construction material.

    Science.gov (United States)

    2010-10-01

    ... foreign construction material. 25.204 Section 25.204 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Buy American Act-Construction Materials 25.204 Evaluating offers of foreign construction material. (a) Offerors proposing to use foreign...

  8. 48 CFR 625.204 - Evaluating offers of foreign construction material.

    Science.gov (United States)

    2010-10-01

    ... foreign construction material. 625.204 Section 625.204 Federal Acquisition Regulations System DEPARTMENT OF STATE SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Buy American Act-Construction Materials 625.204 Evaluating offers of foreign construction material. (b) The head of the contracting activity is the agency...

  9. 48 CFR 1325.204 - Evaluating offers of foreign construction material.

    Science.gov (United States)

    2010-10-01

    ... foreign construction material. 1325.204 Section 1325.204 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Buy American Act-Construction Materials 1325.204 Evaluating offers of foreign construction material. The designee authorized to specify a...

  10. The magnetic field of cloud 3 in L204

    Energy Technology Data Exchange (ETDEWEB)

    Cashman, Lauren R.; Clemens, D. P., E-mail: lcashman@bu.edu, E-mail: clemens@bu.edu [Institute for Astrophysical Research, Boston University, 725 Commonwealth Avenue, Boston, MA 02215 (United States)

    2014-10-01

    The L204 dark cloud complex is a nearby filamentary structure in Ophiuchus North that has no signs of active star formation. Past studies show that L204 is interacting with the nearby runaway O star, ζ Oph, and hosts a magnetic field that is coherent across parsec-length scales. Near-infrared H-band (1.6 μm) linear polarization measurements were obtained for 3896 background stars across a 1° × 1.°5 region centered on the dense Cloud 3 in L204, using the Mimir near-infrared instrument on the 1.8 m Perkins Telescope. Analysis of these observations reveals both large-scale properties and small-scale changes in the magnetic field direction in Cloud 3. In the northern and western ζ Oph facing regions of the cloud, the magnetic field appears to be pushed up against the face of the cloud. This may indicate that the UV flux from ζ Oph has compressed the magnetic field on the western edge of L204. The plane-of-sky magnetic field strength is estimated to be ∼11-26 μG using the Chandrasekhar-Fermi method. The polarimetry data also reveal that the polarization efficiency (PE ≡ P {sub H}/A {sub V}) steadily decreases with distance from ζ Oph (–0.09% ± 0.03% mag{sup –1} pc{sup –1}). Additionally, power-law fits of PE versus A {sub V} for localized samples of probe stars show steeper negative indices with distance from ζ Oph. Both findings highlight the importance of external illumination, here from ζ Oph, in aligning dust grains to embedded magnetic fields.

  11. Reagents for Astatination of Biomolecules. 5. Evaluation of hydrazone linkers in 211At- and 125I-labeled closo-decaborate(2-) conjugates of Fab′ as a means of decreasing kidney retention

    Science.gov (United States)

    Wilbur, D. Scott; Chyan, Ming-Kuan; Hamlin, Donald K.; Nguyen, Holly; Vessella, Robert L.

    2011-01-01

    Evaluation of monoclonal antibody (MAb) fragments (e.g. Fab′, Fab or engineered fragments) as cancer-targeting reagents for therapy with the α-particle emitting radionuclide astatine-211 (211At) has been hampered by low in vivo stability of the label and a propensity of these proteins localize to kidneys. Fortunately, our group has shown that the low stability of the 211At label, generally a meta- or para-[211At]astatobenzoyl conjugate, on MAb Fab′ fragments can be dramatically improved by use of closo-decaborate(2-) conjugates. However, the higher stability of radiolabeled MAb Fab′ conjugates appears to result in retention of the radioactivity in kidneys. This investigation was conducted to evaluate whether the retention of radioactivity in kidney might be decreased by the use of acid-cleavable hydrazone between the Fab′ and the radiolabeled closo-decaborate(2-) moiety. Five conjugation reagents containing sulfhydryl-reactive maleimide groups, a hydrazone functionality and a closo-decaborate(2-) moiety were prepared. In four of the five conjugation reagents, a discrete polyethylene glycol (PEG) linker was used, and one substituent adjacent to the hydrazone was varied (phenyl, benzoate, anisole or methyl) to provide varying acid-sensitivity. In the initial studies, the five maleimido-closo-decaborate(2-) conjugation reagents were radioiodinated (125I or 131I), then conjugated with an anti-PSMA Fab′ (107-1A4 Fab′). Biodistributions of the five radioiodinated Fab′ conjugates were obtained in nude mice at 1, 4 and 24 h post injection (pi). In contrast to closo-decaborate(2-) conjugated to 107-1A4 Fab′ through a non-cleavable linker, two conjugates containing either a benzoate or a methyl substituent on the hydrazone functionality displayed clearance rates from kidney, liver and spleen that were similar to those obtained with directly radioiodinated Fab′ (i.e. no conjugate). The maleimido-closo-decaborate(2-) conjugation reagent containing a benzoate

  12. 48 CFR 53.204-1 - Safeguarding classified information within industry (DD Form 254, DD Form 441).

    Science.gov (United States)

    2010-10-01

    ... information within industry (DD Form 254, DD Form 441). 53.204-1 Section 53.204-1 Federal Acquisition....204-1 Safeguarding classified information within industry (DD Form 254, DD Form 441). The following... specified in subpart 4.4 and the clause at 52.204-2: (a) DD Form 254 (Department of Defense (DOD)), Contract...

  13. Molecular characterization of the 17D-204 yellow fever vaccine.

    Science.gov (United States)

    Salmona, Maud; Gazaignes, Sandrine; Mercier-Delarue, Severine; Garnier, Fabienne; Korimbocus, Jehanara; Colin de Verdière, Nathalie; LeGoff, Jerome; Roques, Pierre; Simon, François

    2015-10-05

    The worldwide use of yellow fever (YF) live attenuated vaccines came recently under close scrutiny as rare but serious adverse events have been reported. The population identified at major risk for these safety issues were extreme ages and immunocompromised subjects. Study NCT01426243 conducted by the French National Agency for AIDS research is an ongoing interventional study to evaluate the safety of the vaccine and the specific immune responses in HIV-infected patients following 17D-204 vaccination. As a preliminary study, we characterized the molecular diversity from E gene of the single 17D-204 vaccine batch used in this clinical study. Eight vials of lyophilized 17D-204 vaccine (Stamaril, Sanofi-Pasteur, Lyon, France) of the E5499 batch were reconstituted for viral quantification, cloning and sequencing of C/prM/E region. The average rate of virions per vial was 8.68 ± 0.07 log₁₀ genome equivalents with a low coefficient of variation (0.81%). 246 sequences of the C/prM/E region (29-33 per vials) were generated and analyzed for the eight vials, 25 (10%) being defective and excluded from analyses. 95% of sequences had at least one nucleotide mutation. The mutations were observed on 662 variant sites distributed through all over the 1995 nucleotides sequence and were mainly non-synonymous (66%). Genome variability between vaccine vials was highly homogeneous with a nucleotide distance ranging from 0.29% to 0.41%. Average p-distances observed for each vial were also homogeneous, ranging from 0.15% to 0.31%. This study showed a homogenous YF virus RNA quantity in vaccine vials within a single lot and a low clonal diversity inter and intra vaccine vials. These results are consistent with a recent study showing that the main mechanism of attenuation resulted in the loss of diversity in the YF virus quasi-species. Copyright © 2015 Elsevier Ltd. All rights reserved.

  14. 29 CFR 778.204 - “Clock pattern” premium pay.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false âClock patternâ premium pay. 778.204 Section 778.204 Labor... Excluded From the âRegular Rateâ Extra Compensation Paid for Overtime § 778.204 “Clock pattern” premium pay... pursuance of an applicable employment contract or collective bargaining agreement,” and the rates of pay and...

  15. 28 CFR 301.204 - Continuation of lost-time wages.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Continuation of lost-time wages. 301.204... ACCIDENT COMPENSATION Lost-Time Wages § 301.204 Continuation of lost-time wages. (a) Once approved, the inmate shall receive lost-time wages until the inmate: (1) Is released; (2) Is transferred to another...

  16. 42 CFR 3.204 - Privilege of patient safety work product.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Privilege of patient safety work product. 3.204... PROVISIONS PATIENT SAFETY ORGANIZATIONS AND PATIENT SAFETY WORK PRODUCT Confidentiality and Privilege Protections of Patient Safety Work Product § 3.204 Privilege of patient safety work product. (a) Privilege...

  17. 48 CFR 3052.204-70 - Security requirements for unclassified information technology resources.

    Science.gov (United States)

    2010-10-01

    ... unclassified information technology resources. 3052.204-70 Section 3052.204-70 Federal Acquisition Regulations... for unclassified information technology resources. As prescribed in (HSAR) 48 CFR 3004.470-3, insert a clause substantially the same as follows: Security Requirements for Unclassified Information Technology...

  18. 17 CFR 275.204A-1 - Investment adviser codes of ethics.

    Science.gov (United States)

    2010-04-01

    ... ethics. 275.204A-1 Section 275.204A-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... codes of ethics. (a) Adoption of code of ethics. If you are an investment adviser registered or required... enforce a written code of ethics that, at a minimum, includes: (1) A standard (or standards) of business...

  19. 7 CFR 761.204 - Methods of allocating funds to State Offices.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Methods of allocating funds to State Offices. 761.204... Funds to State Offices § 761.204 Methods of allocating funds to State Offices. FO and OL loan funds are... allocation, if the Agency cannot adequately meet program objectives with a formula allocation. The National...

  20. 48 CFR 204.7205 - Novation agreements, mergers and sales of assets.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Novation agreements, mergers and sales of assets. 204.7205 Section 204.7205 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL ADMINISTRATIVE MATTERS Contractor Identification...

  1. Assessment of the myostatin Q204X allele using an allelic discrimination assay

    OpenAIRE

    Sifuentes-Rincón,Ana M.; Puentes-Montiel,Herlinda E.; Moreno-Medina,Víctor R.; Rosa-Reyna,Xóchitl F. de la

    2006-01-01

    An allelic discrimination assay was designed and used to determine the genotypic and allelic frequencies of the myostatin (MSTN) gene Q204X allele from two Mexican Full-French herds. The assay is a simple high throughput genotyping method that could be applied to investigate the effect of the Q204X allele on the Charolais breed.

  2. 18 CFR 376.204 - Delegation of Commission's authority during emergency conditions.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Delegation of Commission's authority during emergency conditions. 376.204 Section 376.204 Conservation of Power and Water... Director; (ii) Director of the Office of Energy Market Regulation; (iii) Director of the Office of Energy...

  3. 17 CFR 204.55 - Change in notification to Financial Management Service.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Change in notification to Financial Management Service. 204.55 Section 204.55 Commodity and Securities Exchanges SECURITIES AND... Financial Management Service. After the Commission sends FMS notification of an individual's liability for a...

  4. 20 CFR 703.204 - Decision on insurance carrier's application; minimum amount of deposit.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Decision on insurance carrier's application; minimum amount of deposit. 703.204 Section 703.204 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION... on the Internet at http://www.dol.gov/esa/owcp/dlhwc/lstable.htm for both the current rating year and...

  5. 27 CFR 19.204 - Alternation of distilled spirits plant and taxpaid wine bottling house premises.

    Science.gov (United States)

    2010-04-01

    ... spirits plant and taxpaid wine bottling house premises. 19.204 Section 19.204 Alcohol, Tobacco Products... distilled spirits plant and taxpaid wine bottling house premises. (a) General. A proprietor of a distilled spirits plant operating a contiguous taxpaid wine bottling house desiring to alternate the use of each...

  6. 31 CFR 0.204 - Use of controlled substances and intoxicants.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Use of controlled substances and intoxicants. 0.204 Section 0.204 Money and Finance: Treasury Office of the Secretary of the Treasury... intoxicant in a manner that adversely affects their work performance. ...

  7. 30 CFR 210.204 - How do I submit facility data?

    Science.gov (United States)

    2010-07-01

    ... 210.204 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT FORMS AND REPORTS Production and Royalty Reports-Solid Minerals § 210.204 How do I submit facility... stockpile inventory. (3) You must include in your facility data all production processed in the facility...

  8. 12 CFR 204.122 - Secondary market activities of international banking facilities.

    Science.gov (United States)

    2010-01-01

    ... banking facilities. 204.122 Section 204.122 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM RESERVE REQUIREMENTS OF DEPOSITORY INSTITUTIONS (REGULATION D... the institution establishing the IBF would continue to be subject to Eurocurrency reserve requirements...

  9. 44 CFR 204.23 - Processing a request for a fire management assistance declaration.

    Science.gov (United States)

    2010-10-01

    ... management assistance declaration. The Principal Advisor may consult with State agencies, usually emergency... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Processing a request for a fire management assistance declaration. 204.23 Section 204.23 Emergency Management and Assistance...

  10. 8 CFR 204.1 - General information about immediate relative and family-sponsored petitions.

    Science.gov (United States)

    2010-01-01

    ... relative and family-sponsored petitions. 204.1 Section 204.1 Aliens and Nationality DEPARTMENT OF HOMELAND... about immediate relative and family-sponsored petitions. (a) Types of petitions. Petitions may be filed..., Application to Determine Suitability as Adoptive Parents for a Convention adoptee; and (ii) After USCIS...

  11. 40 CFR 141.204 - Tier 3 Public Notice-Form, manner, and frequency of notice.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Tier 3 Public Notice-Form, manner, and frequency of notice. 141.204 Section 141.204 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...., house renters, apartment dwellers, university students, nursing home patients, prison inmates, etc...

  12. 37 CFR 204.4 - Procedure for notification of the existence of records pertaining to individuals.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Procedure for notification of the existence of records pertaining to individuals. 204.4 Section 204.4 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES PRIVACY ACT: POLICIES AND...

  13. Fresenius AS.TEC204 blood cell separator.

    Science.gov (United States)

    Sugai, Mikiya

    2003-02-01

    Fresenius AS.TEC204 is a third-generation blood cell separator that incorporates the continuous centrifugal separation method and automatic control of the cell separation process. Continuous centrifugation separates cell components according to their specific gravity, and different cell components are either harvested or eliminated as needed. The interface between the red blood cell and plasma is optically detected, and the Interface Control (IFC) cooperates with different pumps, monitors and detectors to harvest required components automatically. The system is composed of three major sections; the Front Panel Unit; the Pump Unit, and the Centrifuge Unit. This unit can be used for a wide variety of clinical applications including collection of platelets, peripheral blood stem cells, bone marrow stem cells, granulocytes, mononuclear cells, and exchange of plasma or red cells, and for plasma treatment.

  14. 30 CFR 204.207 - Who will approve, deny, or modify my request for accounting and auditing relief?

    Science.gov (United States)

    2010-07-01

    ... for accounting and auditing relief? 204.207 Section 204.207 Mineral Resources MINERALS MANAGEMENT... Accounting and Auditing Relief § 204.207 Who will approve, deny, or modify my request for accounting and auditing relief? (a) If there is not a State concerned for your marginal property, only MMS will decide...

  15. 10 CFR 431.204 - Uniform test method for the measurement of energy consumption of illuminated exit signs.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Uniform test method for the measurement of energy consumption of illuminated exit signs. 431.204 Section 431.204 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION... Procedures § 431.204 Uniform test method for the measurement of energy consumption of illuminated exit signs...

  16. 24 CFR 960.204 - Denial of admission for criminal activity or drug abuse by household members.

    Science.gov (United States)

    2010-04-01

    ... activity or drug abuse by household members. 960.204 Section 960.204 Housing and Urban Development... HOUSING Admission § 960.204 Denial of admission for criminal activity or drug abuse by household members. (a) Required denial of admission—(1) Persons evicted for drug-related criminal activity. The PHA...

  17. 48 CFR 27.204-1 - Use of patented technology under the North American Free Trade Agreement.

    Science.gov (United States)

    2010-10-01

    ... under the North American Free Trade Agreement. 27.204-1 Section 27.204-1 Federal Acquisition Regulations... Patents and Copyrights 27.204-1 Use of patented technology under the North American Free Trade Agreement... the patent holder is from a country that is a party to the North American Free Trade Agreement (NAFTA...

  18. 5 CFR 892.204 - How do I waive participation in premium conversion before the benefit first becomes effective?

    Science.gov (United States)

    2010-01-01

    ... conversion before the benefit first becomes effective? 892.204 Section 892.204 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL FLEXIBLE BENEFITS PLAN: PRE-TAX PAYMENT OF HEALTH BENEFITS PREMIUMS Eligibility and Participation § 892.204 How do I...

  19. Secondary peritonitis - evaluation of 204 cases and literature review.

    Science.gov (United States)

    Doklestić, S K; Bajec, D D; Djukić, R V; Bumbaširević, V; Detanac, A D; Detanac, S D; Bracanović, M; Karamarković, R A

    2014-06-15

    Even at the beginning of the new millennium, secondary peritonitis presents a common life-threatening condition associated with high mortality and morbidity. This article comments on epidemiology, diagnosis and general principles of surgical management in patients with secondary peritonitis. The demographic data, clinical findings and surgical outcome of 204 patients who had a confirmed generalized secondary peritonitis were analyzed retrospectively. Our approach was laparotomy, surgical control of contamination, antibiotic therapy and modern intensive care support. Acid peptic disease was the most common cause of perforation peritonitis 60 (29,41%), following by the perforated appendicitis 45 ( 22,06%). The faecal peritonitis and colon perforation were found in 42 patients (20,59%). The morbidity rate was 50%; 41 (40,2%) patients had more than one complication. The morbidity rate was significantly the highest in patients with colon perforation (n=38, 90%) (Hi-square=40,1; pcases (23,81%), and 4(6,6%) deaths due to gastro-duodenal perforation (Hi-square=45,7; pclinical presentation and outcome of the secondary peritonitis depend on duration of abdominal infection, the site of perforation and the general condition of the patient. Rapid surgical source control, modern intensive care and sepsis therapy may offer the chance of decreased morbidity and mortality of the intra-abdominal infections.

  20. Electron Scattering from MERCURY-198 and Mercury -204.

    Science.gov (United States)

    Laksanaboonsong, Jarungsaeng

    This experiment is the first electron scattering study on mercury isotopes. Electron scattering from ^{198}Hg and ^{204 }Hg has been performed at the NIKHEF-K Medium Energy Accelerator. Measured cross sections cover an effective momentum transfer range from 0.4 to 2.9 fm^ {-1}. Elastic cross sections were determined for scattering from both isotopes. Cross section for inelastic excitations in ^{198}Hg below 3 MeV were also determined. Measured cross sections were fit using DWBA phase shift codes to determine coefficients for Fourier-Bessel expansions of ground state and transition charge densities. Differences between the ground state charge densities of the two isotopes reveal the effect of the polarization of the proton core in response to the addition of neutrons. Spin and parity of several excited states of ^{198}Hg were determined. Extracted transition densities of these states show their predominantly collective nature. Charge densities for members of the ground state rotational band were compared with axially symmetric Hartree-Fock and geometrical model predictions.

  1. Astatine-211 labeling. A study towards automatic production of astatinated antibodies

    International Nuclear Information System (INIS)

    Emma Aneheim; Per Albertsson; Sture Lindegren; Holger Jensen

    2015-01-01

    Targeted alpha therapy is especially interesting for therapy of microscopic cancer tumors due to short path length and high linear energy transfer of the alpha particles. One of the most promising nuclides for targeted alpha therapy is 211 At. To facilitate larger clinical studies using 211 At, the current manual synthesis of radiolabeled antibodies would benefit from being transferred into an automated method. In this work, successful modifications of the manual synthesis have been performed in order to adapt it to automation. The automatic synthesis has also been tested using the modified synthesis method. (author)

  2. 7 CFR 330.204 - Denial or cancellation of permits; reconsiderations.

    Science.gov (United States)

    2010-01-01

    ...; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.204 Denial or... ground it will involve a danger of dissemination of the plant pest into the State, Territory or...

  3. Tank 241-T-204, core 188 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Nuzum, J.L.

    1997-07-24

    TANK 241-T-204, CORE 188, ANALYTICAL RESULTS FOR THE FINAL REPORT. This document is the final laboratory report for Tank 241 -T-204. Push mode core segments were removed from Riser 3 between March 27, 1997, and April 11, 1997. Segments were received and extruded at 222-8 Laboratory. Analyses were performed in accordance with Tank 241-T-204 Push Mode Core Sampling and analysis Plan (TRAP) (Winkleman, 1997), Letter of instruction for Core Sample Analysis of Tanks 241-T-201, 241- T-202, 241-T-203, and 241-T-204 (LAY) (Bell, 1997), and Safety Screening Data Qual@ Objective (DO) ODukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DC) analyses exceeded the notification limits stated in DO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group and are not considered in this report.

  4. Tank characterization report for single-shell tank 241-C-204

    International Nuclear Information System (INIS)

    Conner, J.M.

    1996-01-01

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-C-204. This report supports the requirements of Tri Party Agreement Milestone M 44 09

  5. 5 CFR 591.204 - Who can receive COLAs and post differentials?

    Science.gov (United States)

    2010-01-01

    ... REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living Allowances and Post Differentials § 591.204 Who can receive COLAs and post differentials...

  6. 7 CFR 160.204 - Fees for extra cost and hourly rate service.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Fees for extra cost and hourly rate service. 160.204... STORES REGULATIONS AND STANDARDS FOR NAVAL STORES Specific Fees Payable for Services Rendered § 160.204 Fees for extra cost and hourly rate service. The fees specified in §§ 160.201 and 160.202 apply to the...

  7. Ginseng Purified Dry Extract, BST204, Improved Cancer Chemotherapy-Related Fatigue and Toxicity in Mice

    Directory of Open Access Journals (Sweden)

    Hyun-Jung Park

    2015-01-01

    Full Text Available Cancer related fatigue (CRF is one of the most common side effects of cancer and its treatments. A large proportion of cancer patients experience cancer-related physical and central fatigue so new strategies are needed for treatment and improved survival of these patients. BST204 was prepared by incubating crude ginseng extract with ginsenoside-β-glucosidase. The purpose of the present study was to examine the effects of BST204, mixture of ginsenosides on 5-fluorouracil (5-FU-induced CRF, the glycogen synthesis, and biochemical parameters in mice. The mice were randomly divided into the following groups: the naïve normal (normal, the HT-29 cell inoculated (xenograft, xenograft and 5-FU treated (control, xenograft + 5-FU + BST204-treated (100 and 200 mg/kg (BST204, and xenograft + 5-FU + modafinil (13 mg/kg treated group (modafinil. Running wheel activity and forced swimming test were used for evaluation of CRF. Muscle glycogen, serum inflammatory cytokines, aspartic aminotransferase (AST, alanine aminotransferase (ALT, creatinine (CRE, white blood cell (WBC, neutrophil (NEUT, red blood cell (RBC, and hemoglobin (HGB were measured. Treatment with BST204 significantly increased the running wheel activity and forced swimming time compared to the control group. Consistent with the behavioral data, BST204 markedly increased muscle glycogen activity and concentrations of WBC, NEUT, RBC, and HGB. Also, tumor necrosis factor-α (TNF-α and interleukin-6 (IL-6, AST, ALT, and CRE levels in the serum were significantly reduced in the BST204-treated group compared to the control group. This result suggests that BST204 may improve chemotherapy-related fatigue and adverse toxic side effects.

  8. Corrective Action Decision Document for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    Boehlecke, Robert

    2004-01-01

    The six bunkers included in CAU 204 were primarily used to monitor atmospheric testing or store munitions. The 'Corrective Action Investigation Plan (CAIP) for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada' (NNSA/NV, 2002a) provides information relating to the history, planning, and scope of the investigation; therefore, it will not be repeated in this CADD. This CADD identifies potential corrective action alternatives and provides a rationale for the selection of a recommended corrective action alternative for each CAS within CAU 204. The evaluation of corrective action alternatives is based on process knowledge and the results of investigative activities conducted in accordance with the CAIP (NNSA/NV, 2002a) that was approved prior to the start of the Corrective Action Investigation (CAI). Record of Technical Change (ROTC) No. 1 to the CAIP (approval pending) documents changes to the preliminary action levels (PALs) agreed to by the Nevada Division of Environmental Protection (NDEP) and DOE, National Nuclear Security Administration Nevada Site Office (NNSA/NSO). This ROTC specifically discusses the radiological PALs and their application to the findings of the CAU 204 corrective action investigation. The scope of this CADD consists of the following: (1) Develop corrective action objectives; (2) Identify corrective action alternative screening criteria; (3) Develop corrective action alternatives; (4) Perform detailed and comparative evaluations of corrective action alternatives in relation to corrective action objectives and screening criteria; and (5) Recommend and justify a preferred corrective action alternative for each CAS within CAU 204

  9. 33 CFR 165.T14-204 - Safety Zone; fixed mooring balls, south of Barbers Pt Harbor Channel, Oahu, Hawaii.

    Science.gov (United States)

    2010-07-01

    ..., south of Barbers Pt Harbor Channel, Oahu, Hawaii. 165.T14-204 Section 165.T14-204 Navigation and... Pt Harbor Channel, Oahu, Hawaii. (a) Location. The following area is a safety zone: All waters... position is approximately 2,500 yards south of Barbers Point Harbor channel buoy #2, Oahu, Hawaii. This...

  10. 30 CFR 204.5 - What statutory requirements must I meet to obtain royalty prepayment or accounting and auditing...

    Science.gov (United States)

    2010-07-01

    ... obtain royalty prepayment or accounting and auditing relief? 204.5 Section 204.5 Mineral Resources... prepayment or accounting and auditing relief? (a) MMS and the State may allow royalty prepayment or accounting and auditing relief for your marginal property production if MMS and the State jointly determine...

  11. 41 CFR 302-10.204 - What costs are allowed for preparing a mobile home for shipment?

    Science.gov (United States)

    2010-07-01

    ... and cost of replacement blocks broken while mobile home was being transported; (h) Packing and... for preparing a mobile home for shipment? 302-10.204 Section 302-10.204 Public Contracts and Property...-ALLOWANCES FOR TRANSPORTATION OF MOBILE HOMES AND BOATS USED AS A PRIMARY RESIDENCE Computation of Allowances...

  12. 30 CFR 204.215 - Are the information collection requirements in this subpart approved by the Office of Management...

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Are the information collection requirements in this subpart approved by the Office of Management and Budget (OMB)? 204.215 Section 204.215 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT ALTERNATIVES...

  13. 31 CFR 560.204 - Prohibited exportation, reexportation, sale or supply of goods, technology, or services to Iran.

    Science.gov (United States)

    2010-07-01

    ..., sale or supply of goods, technology, or services to Iran. 560.204 Section 560.204 Money and Finance..., reexportation, sale or supply of goods, technology, or services to Iran. Except as otherwise authorized pursuant..., sale, or supply of any goods, technology, or services to a person in a third country undertaken with...

  14. 14 CFR 204.6 - Certificated and commuter air carriers proposing a change in operations, ownership, or management...

    Science.gov (United States)

    2010-01-01

    ... proposing a change in operations, ownership, or management which is not substantial. 204.6 Section 204.6... carriers proposing a change in operations, ownership, or management which is not substantial. Carriers proposing to make a change which would not substantially affect their operations, management, or ownership...

  15. 31 CFR 545.204 - Prohibited exportation, reexportation, sale, or supply of goods, software, technology, or services.

    Science.gov (United States)

    2010-07-01

    ..., sale, or supply of goods, software, technology, or services. 545.204 Section 545.204 Money and Finance... exportation, reexportation, sale, or supply of goods, software, technology, or services. Except as otherwise... States, or by a U.S. person, wherever located, of any goods, software, technology (including technical...

  16. 30 CFR 204.3 - What alternatives are available for marginal properties?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What alternatives are available for marginal... MINERALS REVENUE MANAGEMENT ALTERNATIVES FOR MARGINAL PROPERTIES General Provisions § 204.3 What alternatives are available for marginal properties? If you have production from a marginal property, MMS and...

  17. 30 CFR 204.4 - What is a marginal property under this part?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What is a marginal property under this part... REVENUE MANAGEMENT ALTERNATIVES FOR MARGINAL PROPERTIES General Provisions § 204.4 What is a marginal property under this part? (a) To qualify as a marginal property eligible for royalty prepayment or...

  18. 29 CFR 779.204 - Common types of “enterprise.”

    Science.gov (United States)

    2010-07-01

    ... RETAILERS OF GOODS OR SERVICES Employment to Which the Act May Apply; Enterprise Coverage Enterprise; the Business Unit § 779.204 Common types of “enterprise.” (a) The single establishment business. In the simplest type of organization—the entire business ordinarily is one enterprise. The entire business...

  19. 30 CFR 204.205 - How do I obtain accounting and auditing relief?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I obtain accounting and auditing relief... MINERALS REVENUE MANAGEMENT ALTERNATIVES FOR MARGINAL PROPERTIES Accounting and Auditing Relief § 204.205 How do I obtain accounting and auditing relief? (a) To take cumulative reports and payments relief...

  20. 30 CFR 204.201 - Who may obtain accounting and auditing relief?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Who may obtain accounting and auditing relief... MINERALS REVENUE MANAGEMENT ALTERNATIVES FOR MARGINAL PROPERTIES Accounting and Auditing Relief § 204.201 Who may obtain accounting and auditing relief? (a) You may obtain accounting and auditing relief under...

  1. 8 CFR 204.308 - Where to file Form I-800A or Form I-800.

    Science.gov (United States)

    2010-01-01

    ... IMMIGRANT PETITIONS Intercountry Adoption of a Convention Adoptee § 204.308 Where to file Form I-800A or... adjudicate the child's application for an immigrant or nonimmigrant visa has jurisdiction to grant final.... When, and if, USCIS adopts electronic, internet-based or other digital means for filing Convention...

  2. 30 CFR 204.203 - What is the other relief option?

    Science.gov (United States)

    2010-07-01

    ... MANAGEMENT ALTERNATIVES FOR MARGINAL PROPERTIES Accounting and Auditing Relief § 204.203 What is the other... that is appropriate for production from your marginal property, provided it is not prohibited under... are: (1) To report and pay royalties using a valuation method other than that required under 30 CFR...

  3. 48 CFR 51.204 - Use of interagency fleet management system (IFMS) vehicles and related services.

    Science.gov (United States)

    2010-10-01

    ... Contractor Use of Interagency Fleet Management System (IFMS) 51.204 Use of interagency fleet management system (IFMS) vehicles and related services. Contractors authorized to use interagency fleet management... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Use of interagency fleet...

  4. 42 CFR 412.204 - Payment to hospitals located in Puerto Rico.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Payment to hospitals located in Puerto Rico. 412... Payment System for Inpatient Operating Costs for Hospitals Located in Puerto Rico § 412.204 Payment to hospitals located in Puerto Rico. (a) FY 1988 through FY 1997. For discharges occurring on or after October...

  5. 17 CFR 275.204-1 - Amendments to application for registration.

    Science.gov (United States)

    2010-04-01

    ... you have received a continuing hardship exemption under § 275.203-3. (2) If you have received a... (CONTINUED) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.204-1 Amendments to application for... a complete Part 1A of Form ADV on paper with the SEC by mailing it to FINRA. (c) Special rule for...

  6. 17 CFR 275.204-2 - Books and records to be maintained by investment advisers.

    Science.gov (United States)

    2010-04-01

    ..., financial statements, and internal audit working papers relating to the business of such investment adviser... pursuant to § 275.204A-1 that is in effect, or at any time within the past five years was in effect; (ii) A... currently, or within the past five years was, a supervised person of the investment adviser. (13)(i) A...

  7. 46 CFR 117.204 - Survival craft-vessels operating on coastwise routes.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-vessels operating on coastwise routes... PASSENGERS LIFESAVING EQUIPMENT AND ARRANGEMENTS Number and Type of Survival Craft § 117.204 Survival craft... allowed, the following survival craft requirements apply when not engaged in an overnight voyage: (1...

  8. 8 CFR 204.313 - Filing and adjudication of a Form I-800.

    Science.gov (United States)

    2010-01-01

    .... This option is not available if the child will be adopted in the United States. (2) In applying this....C. 2101, or as a civilian officer or employee of the United States Government, the child will be... providing proper care for the child, as defined in 8 CFR 204.301; (C) Information about the circumstances of...

  9. 14 CFR 204.4 - Carriers proposing to provide essential air service.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Carriers proposing to provide essential air... (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS DATA TO SUPPORT FITNESS DETERMINATIONS Filing Requirements § 204.4 Carriers proposing to provide essential air service. Applicants proposing to provide essential air...

  10. 34 CFR 403.204 - What are the State's responsibilities for program evaluation and improvement?

    Science.gov (United States)

    2010-07-01

    ... APPLIED TECHNOLOGY EDUCATION PROGRAM What Are the Administrative Responsibilities of a State Under the State Vocational and Applied Technology Education Program? § 403.204 What are the State's... description of vocational education strategies designed to improve the performance of the program as measured...

  11. 30 CFR 90.204 - Approved sampling devices; maintenance and calibration.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Approved sampling devices; maintenance and... LABOR COAL MINE SAFETY AND HEALTH MANDATORY HEALTH STANDARDS-COAL MINERS WHO HAVE EVIDENCE OF THE DEVELOPMENT OF PNEUMOCONIOSIS Sampling Procedures § 90.204 Approved sampling devices; maintenance and...

  12. 30 CFR 204.211 - When may MMS rescind relief for a property?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false When may MMS rescind relief for a property? 204... MMS rescind relief for a property? (a) MMS may retroactively rescind the relief for your property if MMS determines that your property was not eligible for the relief obtained under this subpart because...

  13. 31 CFR 515.803 - Customs procedures; merchandise specified in § 515.204.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Customs procedures; merchandise... CONTROL REGULATIONS Procedures § 515.803 Customs procedures; merchandise specified in § 515.204. (a) With... thereto) whether or not such merchandise has been imported into the United States, collectors of customs...

  14. 30 CFR 204.202 - What is the cumulative royalty reports and payments relief option?

    Science.gov (United States)

    2010-07-01

    ... Auditing Relief § 204.202 What is the cumulative royalty reports and payments relief option? (a) The... information on Form MMS-2014 for the calendar year, the same as if it were a monthly report; and (5) Report... section until the date MMS receives it. (d) If you take relief you are not qualified for, you may be...

  15. 41 CFR 109-38.204-4 - Report of exempted motor vehicles.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Report of exempted motor..., TRANSPORTATION, AND MOTOR VEHICLES 38-MOTOR EQUIPMENT MANAGEMENT 38.2-Registration, Identification, and Exemptions § 109-38.204-4 Report of exempted motor vehicles. DOE offices shall provide upon request the...

  16. RESULTS OF AIRPLANE TU-204-300 OPERATED BY "VLADIVOSTOK AVIA" COMPANY FUEL FLOW MONITIRING

    Directory of Open Access Journals (Sweden)

    G. E. Maslennikova

    2014-01-01

    Full Text Available This article describes the results obtained from continuous monitoring of fuel flow on the airplanes Tu-204-300, operated by the aircompany "Vladivostok Avia". The reasons for the change in the cost of each copy of airplane and changes in fuel characteristics due to pilots manner of flying.

  17. 12 CFR 204.134 - Linked time deposits and transaction accounts.

    Science.gov (United States)

    2010-01-01

    ... RESERVE SYSTEM RESERVE REQUIREMENTS OF DEPOSITORY INSTITUTIONS (REGULATION D) Interpretations § 204.134...) establishes general reserve requirements on transaction accounts and nonpersonal time deposits. Under section... other than to allow the payment of higher interest through the avoidance of reserve requirements. As the...

  18. 41 CFR 101-6.204-2 - Specific discriminatory actions prohibited.

    Science.gov (United States)

    2010-07-01

    ... REGULATIONS 6.2-Nondiscrimination in Programs Receiving Federal Financial Assistance § 101-6.204-2 Specific... under the program (including the opportunity to participate in the program as an employee but only to... defeating or substantially impairing accomplishment of the objectives of the program as respect individuals...

  19. 49 CFR 24.204 - Availability of comparable replacement dwelling before displacement.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Availability of comparable replacement dwelling... General Relocation Requirements § 24.204 Availability of comparable replacement dwelling before displacement. (a) General. No person to be displaced shall be required to move from his or her dwelling unless...

  20. 41 CFR 302-9.204 - What is the “authorized point of origin” when I transport my POV from my post of duty?

    Science.gov (United States)

    2010-07-01

    ... point of originâ when I transport my POV from my post of duty? 302-9.204 Section 302-9.204 Public Contracts and Property Management Federal Travel Regulation System RELOCATION ALLOWANCES TRANSPORTATION AND... Return Transportation of a POV From a Post of Duty § 302-9.204 What is the “authorized point of origin...

  1. Internal Bremsstrahlung spectrum of 204TI in the X-ray region

    International Nuclear Information System (INIS)

    Raghavendra, M.K.; Ramaswamy, C.R.

    2001-01-01

    The internal Bremsstrahlung spectrum from 204 TI has been measured, using magnetic deflector method, in the X-ray region. The corrected spectral intensity is compared with the Coulomb-corrected KUB theory in the energy region of 10 to 30 keV. The good agreement between experiment and theory in this energy region, suggests that 'detour effects' are negligible in the low energy region. (author)

  2. 41 CFR 101-27.204 - Types of shelf-life items.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Types of shelf-life items...-Management of Shelf-Life Materials § 101-27.204 Types of shelf-life items. Shelf-life items are classified as nonextendable (Type I) and extendable (Type II). Type I items have a definite storage life after which the item...

  3. Shell model calculations for levels and transition rates in 204Pb and 206Pb

    International Nuclear Information System (INIS)

    Wang, D.; McEllistrem, M.T.

    1990-01-01

    Level energies and decay rates of both negative and positive parity levels of 206,204 Pb have been calculated through mixed-configuration shell model calculations using the modified surface delta interaction (MSDI), the Schiffer-True central interaction, and another two-body interaction. These calculations were all carried out with a full six-orbit neutron hole space. The predicted low-lying levels with the MSDI are in excellent agreement with experiments, accounting for the energies, spins, and parities of essentially all levels below 3 MeV excitation energy except known particle-hole collective excitations in both nuclei. Almost all calculated E2 and M1 transition rates are consistent with measured branching ratios for γ-ray decay of excited levels. The comparison of the observed and calculated levels demonstrates the important role played by the neutron-hole i 13/2 configuration in the levels of 204 Pb and 206 Pb, and interprets an apparent discrepancy over the character and energy spacings of 0 + levels in 204 Pb

  4. Neutron capture at the s-process branching points $^{171}$Tm and $^{204}$Tl

    CERN Multimedia

    Branching points in the s-process are very special isotopes for which there is a competition between the neutron capture and the subsequent b-decay chain producing the heavy elements beyond Fe. Typically, the knowledge on the associated capture cross sections is very poor due to the difficulty in obtaining enough material of these radioactive isotopes and to measure the cross section of a sample with an intrinsic activity; indeed only 2 out o the 21 ${s}$-process branching points have ever been measured by using the time-of-flight method. In this experiment we aim at measuring for the first time the capture cross sections of $^{171}$Tm and $^{204}$Tl, both of crucial importance for understanding the nucleosynthesis of heavy elements in AGB stars. The combination of both (n,$\\gamma$) measurements on $^{171}$Tm and $^{204}$Tl will allow one to accurately constrain neutron density and the strength of the 13C(α,n) source in low mass AGB stars. Additionally, the cross section of $^{204}$Tl is also of cosmo-chrono...

  5. Identification of the one-quadrupole phonon 21,ms+ state of 204Hg

    Directory of Open Access Journals (Sweden)

    R. Stegmann

    2017-07-01

    Full Text Available One-phonon states of vibrational nuclei with mixed proton–neutron symmetry have been observed throughout the nuclear chart besides the mass A≈200 region. Very recently, it has been proposed that the 22+ state of 212Po is of isovector nature. This nucleus has two valence protons and two valence neutrons outside the doubly-magic 208Pb nucleus. The stable isotope 204Hg, featuring two valence-proton and valence-neutron holes, with respect to 208Pb, is the particle-hole mirror of 212Po. In order to compare the properties of low-lying isovector excitations in these particle-hole mirror nuclei, we have studied 204Hg by using the projectile Coulomb-excitation technique. The measured absolute B(M1;22+→21+ strength of 0.20(2μN2 indicates that the 22+ level of 204Hg is at least the main fragment of the 21,ms+ state. For the first time in this mass region, both lowest-lying, one-quadrupole phonon excitations are established together with the complete set of their decay strengths. This allows for a microscopic description of their structures, achieved in the framework of the Quasi-particle Phonon Model.

  6. Analysis of OXA-204 carbapenemase-producing Enterobacteriaceae reveals possible endoscopy-associated transmission, France, 2012 to 2014.

    Science.gov (United States)

    Potron, Anaïs; Bernabeu, Sandrine; Cuzon, Gaëlle; Pontiès, Valérie; Blanchard, Hervé; Seringe, Elise; Naas, Thierry; Nordmann, Patrice; Dortet, Laurent

    2017-12-01

    OXA-48-like beta-lactamase producing bacteria are now endemic in several European and Mediterranean countries. Among this carbapenemase family, the OXA-48 and OXA-181 variants predominate, whereas other variants such as OXA-204 are rarely reported. Here, we report the molecular epidemiology of a collection of OXA-204-positive enterobacterial isolates (n = 29) recovered in France between October 2012 and May 2014. This study describes the first outbreak of OXA-204-producing Enterobacteriaceae in Europe, involving 12 isolates of an ST90 Escherichia coli clone and nine isolates of an ST147 Klebsiella pneumoniae clone. All isolates co-produced the cephalosporinase CMY-4, and 60% of them co-produced the extended-spectrum beta-lactamase CTX-M-15. The bla OXA-204 gene was located on a 150-kb IncA/C plasmid, isolated from various enterobacterial species in the same patient, indicating a high conjugative ability of this genetic vehicle.

  7. 30 CFR 204.210 - What if a property is approved as part of a nonqualifying agreement?

    Science.gov (United States)

    2010-07-01

    ... THE INTERIOR MINERALS REVENUE MANAGEMENT ALTERNATIVES FOR MARGINAL PROPERTIES Accounting and Auditing... from the date your payment was due under § 204.202 (b)(2) until the date MMS receives it. ...

  8. Comparison of plateletpheresis on the Fresenius AS.TEC 204 and Haemonetics MCS 3p.

    Science.gov (United States)

    Ranganathan, Sudha

    2007-02-01

    This is an attempt at comparing two cell separators for plateletpheresis, namely the Fresenius AS.TEC 204 and Haemonetics MCS 3p, at a tertiary care center in India. Donors who weighed between 55-75 kg, who had a hematocrit of 41-43%, and platelet counts of 250x10(3)-400x10(3)/microl were selected for the study. The comparability of the donors who donated on the two cell separators were analysed by t-test independent samples and no significant differences were found (P>0.05). The features compared were time taken for the procedure, volume processed on the separators, adverse reactions of the donors, quality control of the product, separation efficiency of the separators, platelet loss in the donors after the procedure, and the predictor versus the actual yield of platelets given by the cell separator. The volume processed to get a target yield of >3x10(11) was equal to 2.8-3.2 l and equal in both the cell separators. Symptoms of citrate toxicity were seen in 4 and 2.5% of donors who donated on the MCS 3p and the AS.TEC 204, respectively, and 3 and 1% of donors, respectively, had vasovagal reactions. All the platelet products collected had a platelet count of >3x10(11); 90% of the platelet products collected on the AS.TEC 204 attained the predicted yield that was set on the cell separator where as 75% of the platelet products collected on the MCS 3p attained the target yield. Quality control of the platelets collected on both the cell separators complied with the standards except that 3% of the platelets collected on the MCS 3p had a visible red cell contamination. The separation efficiency of the MCS 3p was higher, 50-52% as compared to the 40-45% on the AS.TEC 204. A provision of double venous access, less adverse reactions, negligible RBC contamination with a better predictor yield of platelets makes the AS.TEC 204 a safer and more reliable alternative than the widely used Haemonetics MCS 3p. Copyright (c) 2006 Wiley-Liss, Inc.

  9. Astatine-211 labelled proteins and their stability in vivo

    International Nuclear Information System (INIS)

    Yi Changhou; Jin Jannan; Zhang Shuyuan; Wang Ketai; Zhang Dayuan; Zhou Maolun

    1989-01-01

    211 At or 131 I labelled proteins, e.g. 211 At-IgG or 211 At-BSA (bovine serum albumin) were prepared by 211 At reaction with the diazo-compound of para-aminobenzoic acid, which is then conjugated with IgG or BSA via an acylation reaction. The 211 At-carbon bond was found metabolically stable under in vivo conditions. For the labelling of proteins with 211 At or 131 I, other methods of direct oxidation are also described. The results show that for the labelling of proteins with 211 At, high rate of incorporation can be obtained with hydrogen peroxide as oxidant, but the labelling of proteins with 131 I is more favourable with the strong oxidant Chloramine-T. (author) 12 refs.; 6 figs

  10. Analytical investigation of energy spectrums of beta rays emitted from 90Sr and 204Tl radioisotopes

    International Nuclear Information System (INIS)

    Yalcin, S.

    2011-01-01

    The energy spectra of beta rays emitted from 90 Sr and 204 Tl radioisotopes were obtained by using a silicon surface barrier detector with a 1000 μm depleted layer and 50 mm 2 effective area. The detector response function is interpreted by making use of range distributions of mono-energetic electrons in matter and by assuming a linear energy loss along the range in the depleted layer of the detector. An analytical expression is given for pulse height distribution obtained in the surface barrier detector. A good agreement is observed between the experimental results and theoretical interpretation. (author)

  11. Fission threshold determination of 209Bi and sup(204,206,207,208)Pb by electrofission

    International Nuclear Information System (INIS)

    Tuerck, D.

    1975-01-01

    At the Darmstadt electron linear accelerator the cross sections for the electrofission of 209 Bi were measured for electron energies between 24 and 70 MeV, for the separated lead isotopes sup(204,206,207,208)Pb between 38 and 50 MeV. For the determination of the fission thresholds the cross sections were examined by the virtuel photon method using calculations in first Born approximation for the point nucleus with Coulomb wave functions. The analytic functions fitting the fission probability were based on level densities after the Fermi-gas-model. (orig./WL) [de

  12. Report of Apollo 204 Review Board to the Administrator, National Aeronautics and Space Administration . Appendix F ; Schedule of Physical Evidence

    Science.gov (United States)

    1967-01-01

    Immediately following the Apollo 204 accident of January 27, 1961. all associated equipment and material were impounded. Release of this equipment and material for normal use was under the close control of the Apollo 204 Review Board. Apollo Review Board Administrative Procedure No. 11, February 11, 1961, established the Apollo 204 Review Board Material Release Record (MRR). This MRR was the official form used to release material from full impoundment and was valid only after being approved by the Board and signed by a Member. The form was used as the authority to place any impounded item into one of the three Categories defined in Administrative Procedure No. 11. This appendix contains all of the authorized MRR's. Each item submitted on an MRR was given a control number; a description, including the part number and serial number; the relevance and location to the accident; any constraints before release; and the control category. The categories placed on the equipment were as follows: Category A - Items which may have a significant influence or bearing on the results or findings of the Apollo 204 Review Board; Category B - All material other than Category A which is considered relevant to the Apollo 204 Review Board investigation; Category C - Material released from Board jurisdiction. Several classes of equipment were released by special Board action prior to the establishment of the MRR system. The operating procedure for release of these classes is Enclosure F-l to this appendix.

  13. Corrective Action Decision Document for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada, Rev. No. 0

    Energy Technology Data Exchange (ETDEWEB)

    Robert Boehlecke

    2004-04-01

    The six bunkers included in CAU 204 were primarily used to monitor atmospheric testing or store munitions. The ''Corrective Action Investigation Plan (CAIP) for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada'' (NNSA/NV, 2002a) provides information relating to the history, planning, and scope of the investigation; therefore, it will not be repeated in this CADD. This CADD identifies potential corrective action alternatives and provides a rationale for the selection of a recommended corrective action alternative for each CAS within CAU 204. The evaluation of corrective action alternatives is based on process knowledge and the results of investigative activities conducted in accordance with the CAIP (NNSA/NV, 2002a) that was approved prior to the start of the Corrective Action Investigation (CAI). Record of Technical Change (ROTC) No. 1 to the CAIP (approval pending) documents changes to the preliminary action levels (PALs) agreed to by the Nevada Division of Environmental Protection (NDEP) and DOE, National Nuclear Security Administration Nevada Site Office (NNSA/NSO). This ROTC specifically discusses the radiological PALs and their application to the findings of the CAU 204 corrective action investigation. The scope of this CADD consists of the following: (1) Develop corrective action objectives; (2) Identify corrective action alternative screening criteria; (3) Develop corrective action alternatives; (4) Perform detailed and comparative evaluations of corrective action alternatives in relation to corrective action objectives and screening criteria; and (5) Recommend and justify a preferred corrective action alternative for each CAS within CAU 204.

  14. miR-204 inhibits angiogenesis and promotes sensitivity to cetuximab in head and neck squamous cell carcinoma cells by blocking JAK2-STAT3 signaling.

    Science.gov (United States)

    Wu, Qingwei; Zhao, Yingying; Wang, Peihua

    2018-03-01

    This study aims to investigate the roles of miR-204 in tumor angiogenesis of head and neck squamous cell carcinoma (HNSCC). Here, we found that miR-204 level was reduced in HNSCC tissues relative to that in normal adjacent tissues. Overexpression of miR-204 promoted tumor angiogenesis in HNSCC cells. Mechanistically, JAK2 was identified as a direct target of miR-204, and miR-204 overexpression blocked JAK2/STAT3 pathway. Moreover, overexpression of JAK2 attenuated the inhibition of miR-204 on tumor angiogenesis of HNSCC. Furthermore, overexpression of miR-204 enhanced sensitivity of cetuximab in HNSCC cells, this effect was attenuated by JAK2 overexpression too. Importantly, JAK2 expression was negatively correlated with miR-204 level in HNSCC tissues. Therefore, miR-204 acts as a tumor suppressor by blocking JAK2/STAT3 pathway in HNSCC cells. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

  15. Routine lead isotope determinations using a lead-207-lead-204 double spike: a long-term assessment of analytical precision and accuracy

    International Nuclear Information System (INIS)

    Woodhead, J.D.; McCulloch, M.T.; Volker, F.

    1995-01-01

    Lead-isotope data obtained on a multicollector mass spectrometer over a four year period using a 207 Pb- 204 Pb double spike to correct for the effects of mass discrimination, are reported. Considerable improvements in both precision and accuracy over conventional correction procedures were noted, without recourse to rigorous loading or run conditions. An external precision in 206 Pb/ 204 Pb, 207 Pb/ 204 Pb and 208 Pb/ 204 Pb ratios ± 0.003, 0.003 and 0.01 (2 x standard deviation), respectively, is routinely obtainable independent of minor variations in loading and run parameters. (author)

  16. Detection of Hepatitis B Virus M204I Mutation by Quantum Dot-Labeled DNA Probe

    Directory of Open Access Journals (Sweden)

    Cheng Zhang

    2017-04-01

    Full Text Available Quantum dots (QDs are semiconductor nanoparticles with a diameter of less than 10 nm, which have been widely used as fluorescent probes in biochemical analysis and vivo imaging because of their excellent optical properties. Sensitive and convenient detection of hepatitis B virus (HBV gene mutations is important in clinical diagnosis. Therefore, we developed a sensitive, low-cost and convenient QDs-mediated fluorescent method for the detection of HBV gene mutations in real serum samples from chronic hepatitis B (CHB patients who had received lamivudine or telbivudine antiviral therapy. We also evaluated the efficiency of this method for the detection of drug-resistant mutations compared with direct sequencing. In CHB, HBV DNA from the serum samples of patients with poor response or virological breakthrough can be hybridized to probes containing the M204I mutation to visualize fluorescence under fluorescence microscopy, where fluorescence intensity is related to the virus load, in our method. At present, the limits of the method used to detect HBV genetic variations by fluorescence quantum dots is 103 IU/mL. These results show that QDs can be used as fluorescent probes to detect viral HBV DNA polymerase gene variation, and is a simple readout system without complex and expensive instruments, which provides an attractive platform for the detection of HBV M204I mutation.

  17. Levels and transitions in /sup 204/Pb and the four valence neutron-hole configurations

    International Nuclear Information System (INIS)

    Hanly, J.M.; Hicks, S.E.; McEllistrem, M.T.; Yates, S.W.

    1988-01-01

    Levels of the nucleus /sup 204/Pb have been investigated using the (n,n'γ) reaction, and γ rays from low-spin excited levels have been observed. Forty-three low-spin levels connected by 78 γ rays are found below 2.9 MeV, whereas only about 28 levels had previously been known. The levels below 2 MeV excitation energy are expected to be dominated by the p/sub 1/2/, f/sub 5/2/, and p/sub 3/2/ valence neutron hole excitations, and 0 + levels at 0, 1730, and 2433.1 keV are associated primarily with these configurations. These states are at almost the same excitation energies as parent 0 + excitations in /sup 206/Pb. Approximately six unnatural-parity levels are identified; this is close to the number predicted in six orbit valence-space shell model calculations. The number of natural-parity levels found, however, is almost twice that calculated with the shell model. Levels and transitions below 2 MeV excitation energy are consistent with expectations basing /sup 204/Pb states on correlated two-hole excitations dominant in /sup 206/Pb

  18. Spectroscopic measurement of 204Pb isotope shift and 205Pb nuclear spin

    International Nuclear Information System (INIS)

    Schonberger, P.

    1984-01-01

    The isotope shift of 204 Pb and the nuclear spin of 1.4 X 10 7 -y 205 Pb was determined from a high-resolution optical measurement of the 6p 23 P 0 -6p7s 3 P 1 0 283.3-nm resonance line. The value of the shift, relative to 208 Pb is -140.2(8) x 10 -3 cm -1 , the negative sign indicating a shift to lower wave numbers. The precision is 3-4 times greater than that of previous measurements. The spin of 205 Pb I = 5/2 was obtained from the measurement of the relative intensities of its three hyperfine components. This method of absorption spectroscopy determination of ground state nuclear spin is applicable to any stable or long-lived isotope. High resolution optical absorption spectra were obtained with a 25.4 cm diffraction grating in a 9.1 m focal length Czerny-Turner spectrometer. A signal-averaging scanning technique was used to record the spectra. Increased precision in the isotope shift measurement was attained by using separated isotope samples of 204 Pb and 207 Pb

  19. Spectroscopic Measurement of LEAD-204 Isotope Shift and LEAD-205 Nuclear Spin.

    Science.gov (United States)

    Schonberger, Peter

    The isotope shift of ('204)Pb and the nuclear spin of 1.4 x 10('7)-y ('205)Pb was determined from a high -resolution optical measurement of the 6p('2) ('3)P(,o) -6p7s('3)P(,1)('o) 283.3-nm resonance line. The value of the shift, relative to ('208)Pb is -140.2(8) x 10('-3)cm(' -1), the negative sign indicating a shift to lower wave numbers. The precision is 3-4 times greater than that of previous measurements. The spin of ('205)Pb l = 5/2 was obtained from the measurement of the relative intensities of its three hyperfine components. This method of absorption spectroscopy determination of ground state nuclear spin is applicable to any stable or longlived isotope. High resolution optical absorption spectra were obtained with a 25.4cm diffraction grating in a 9.1m focal length Czerny-Turner spectrometer. A signal-averaging scanning technique was used to record the spectra. Increased precision in the isotope shift measurement was attained by using separated isotope samples of ('204)Pb and ('207)Pb. A controlled amount of the later was incorporated in the absorption cell to provide internal calibration by its 6p7s ('3)P(,1)('o) hfs separation. Absorption spectra were recorded for several optical thicknesses of the absorber. A single spin value of increased precision was derived from the entire set of combined data.

  20. Deep Ly alpha imaging of two z=2.04 GRB host galaxy fields

    DEFF Research Database (Denmark)

    Fynbo, J.P.U.; Møller, Per; Thomsen, Bente

    2002-01-01

    We report on the results of deep narrow-band Lyalpha and broad-band U and I imaging of the fields of two Gamma-Ray bursts at redshift z = 2.04 (GRB 000301C and GRB 000926). We find that the host galaxy of GRB 000926 is an extended (more than 2 arcsec), strong Lyalpha emitter with a rest-frame equ......We report on the results of deep narrow-band Lyalpha and broad-band U and I imaging of the fields of two Gamma-Ray bursts at redshift z = 2.04 (GRB 000301C and GRB 000926). We find that the host galaxy of GRB 000926 is an extended (more than 2 arcsec), strong Lyalpha emitter with a rest...... - I colour than the eastern component, suggesting the presence of at least some dust. We do not detect the host galaxy of GRB 000301C in neither Lyalpha emission nor in U and I broad-band images. The strongest limit comes from combining the narrow and U-band imaging where we infer a limit of U...

  1. Precise determination of the neutron scattering length of lead isotopes 204Pb,207Pb and 208Pb by neutron interferometry

    International Nuclear Information System (INIS)

    Ioffe, A.; Ermakov, O.; Karpikhin, I.; Krupchitsky, P.; Mikula, P.; Lukas, P.; Vrana, M.

    2000-01-01

    The neutron scattering length of lead isotopes 204 Pb, 207 Pb and 208 Pb are determined by a set of neutron interferometry experiments. The obtained values b (208) =9.494(30) fm, b (207) =9.286(16) fm, b (204) =10.893(78) fm have much higher accuracy then current table data. Together with the precise value of b for natural lead, these results represent a complete set of data and allow one to calculate b (206) =9.221(69) fm, which is in the very good agreement with the present day experimental value. (orig.)

  2. 41 CFR 301-75.204 - May we use Government contractor-issued travelers checks to pay for the interviewee's travel...

    Science.gov (United States)

    2010-07-01

    ... contractor-issued travelers checks to pay for the interviewee's travel expenses? 301-75.204 Section 301-75.204 Public Contracts and Property Management Federal Travel Regulation System TEMPORARY DUTY (TDY) TRAVEL ALLOWANCES AGENCY RESPONSIBILITIES 75-PRE-EMPLOYMENT INTERVIEW TRAVEL Obtaining Travel Services...

  3. 41 CFR 302-4.204 - If my spouse does not accompany me but travels unaccompanied at a different time, what per diem...

    Science.gov (United States)

    2010-07-01

    ... accompany me but travels unaccompanied at a different time, what per diem rate will he/she receive? 302-4.204 Section 302-4.204 Public Contracts and Property Management Federal Travel Regulation System... my spouse does not accompany me but travels unaccompanied at a different time, what per diem rate...

  4. Corrosion behaviour of AISI 204Cu and AISI 304 stainless steels in simulated pore solution

    Energy Technology Data Exchange (ETDEWEB)

    Kocijan, Aleksandra [Institute of Metals and Technology, Ljubljana (Slovenia)

    2013-10-15

    The evolution of the passive films on AISI 204Cu and AISI 304 stainless steels in simulated pore solution for steel reinforcements in concrete, and with and without the addition of chloride, was studied using cyclic voltammetry and potentiodynamic measurements. The passive layers were studied at open-circuit potential by means of X-ray photoelectron spectroscopy. The passive films on both materials predominantly contained Cr-oxides, whereas the Fe-species were markedly depleted. Mn-enrichment was also observed. The addition of chloride ions did not have a significant influence on the composition of the passive layers. The surface morphology of the products formed on the surface of both investigated materials at open-circuit potential and at high over-potentials in the presence of chloride was studied using scanning electron microscopy. (orig.)

  5. Breakup mechanisms for 7Li + 197Au, 204Pb systems at sub-barrier energies

    Directory of Open Access Journals (Sweden)

    Luong D.H.

    2013-12-01

    Full Text Available Coincidence measurements of breakup fragments were carried out for the 7Li + 197Au and 204Pb systems at sub-barrier energies. The mechanisms triggering breakup, and time-scales of each process, were identified through the reaction Q-values and the relative energy of the breakup fragments. Binary breakup of 7Li were found to be predominantly triggered by nucleon transfer, with p-pickup leading to 8Be → α + α decay being the preferred breakup mode. From the time-scales of each process, the coincidence yields were separated into prompt and delayed components, allowing the identification of breakup process important in the suppression of complete fusion of 7Li at above-barrier energies.

  6. Influence of gamma radiation on productiveness of Cuba C-204 wheat variety in spring

    International Nuclear Information System (INIS)

    Caballero Torres, I.; Perez Talavera, S.; Diaz Esquivel, R.

    1995-01-01

    The percentage of flowers carrying seeds in spikes from seed irradiated plant with 100 to 800 Gy and non irradiated control plants was evaluated cv. Cuba C -204 wheat affectation. The results showed a significative (1 %) dose and s'pikes maturity time influence by bi factorial analysis. A significance of 1 % dose-maturity time interaction was obtained too and that bigger flowers carrying seeds percentage is obtained in 400 Gy radiated seeds plants. A delay of 5 days is present in the 500 Gy radiated plants maturity and a seed carrying flowers reduction of 35 % with reference to control. From 600 Gy up in the studied variety seeds were not obtained in the spring season

  7. The 17D-204 and 17DD yellow fever vaccines: an overview of major similarities and subtle differences.

    Science.gov (United States)

    Ferreira, Clarissa de Castro; Campi-Azevedo, Ana Carolina; Peruhype-Magalhāes, Vanessa; Costa-Pereira, Christiane; Albuquerque, Cleandro Pires de; Muniz, Luciana Feitosa; Yokoy de Souza, Talita; Oliveira, Ana Cristina Vanderley; Martins-Filho, Olindo Assis; da Mota, Licia Maria Henrique

    2018-01-01

    The yellow fever vaccine is a live attenuated virus vaccine that is considered one of the most efficient vaccines produced to date. The original 17D strain generated the substrains 17D-204 and 17DD, which are used for the current production of vaccines against yellow fever. The 17D-204 and 17DD substrains present subtle differences in their nucleotide compositions, which can potentially lead to variations in immunogenicity and reactogenicity. We will address the main changes in the immune responses induced by the 17D-204 and 17DD yellow fever vaccines and report similarities and differences between these vaccines in cellular and humoral immunity . This is a relevant issue in view of the re-emergence of yellow fever in Uganda in 2016 and in Brazil in the beginning of 2017. Areas covered: This article will be divided into 8 sections that will analyze the innate immune response, adaptive immune response, humoral response, production of cytokines, immunity in children, immunity in the elderly, gene expression and adverse reactions. Expert commentary: The 17D-204 and 17DD yellow fever vaccines present similar immunogenicity, with strong activation of the cellular and humoral immune responses. Additionally, both vaccines have similar adverse effects, which are mostly mild and thus are considered safe.

  8. Cortical Morphogenesis during Embryonic Development Is Regulated by miR-34c and miR-204

    DEFF Research Database (Denmark)

    Veno, Morten T.; Veno, Susanne T.; Rehberg, Kati

    2017-01-01

    The porcine brain closely resembles the human brain in aspects such as development and morphology. Temporal miRNA profiling in the developing embryonic porcine cortex revealed a distinct set of miRNAs, including miR-34c and miR-204, which exhibited a highly specific expression profile across...

  9. 20 CFR 718.204 - Total disability and disability causation defined; criteria for determining total disability and...

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Total disability and disability causation... Section 718.204 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR FEDERAL COAL... than those listed in Table B1 (Males) or Table B2 (Females) in Appendix B to this part for an...

  10. 30 CFR 204.206 - What will MMS do when it receives my request for other relief?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What will MMS do when it receives my request... THE INTERIOR MINERALS REVENUE MANAGEMENT ALTERNATIVES FOR MARGINAL PROPERTIES Accounting and Auditing Relief § 204.206 What will MMS do when it receives my request for other relief? When MMS receives your...

  11. Hypoxia promotes apoptosis of neuronal cells through hypoxia-inducible factor-1α-microRNA-204-B-cell lymphoma-2 pathway.

    Science.gov (United States)

    Wang, Xiuwen; Li, Ji; Wu, Dongjin; Bu, Xiangpeng; Qiao, Yong

    2016-01-01

    Neuronal cells are highly sensitive to hypoxia and may be subjected to apoptosis when exposed to hypoxia. Several apoptosis-related genes and miRNAs involve in hypoxia-induced apoptosis. This study aimed to examine the role of HIF1α-miR-204-BCL-2 pathway in hypoxia-induced apoptosis in neuronal cells. Annexin V/propidium iodide assay was performed to analyze cell apoptosis in AGE1.HN and PC12 cells under hypoxic or normoxic conditions. The expression of BCL-2 and miR-204 were determined by Western blot and qRT-PCR. The effects of miR-204 overexpression or knockdown on the expression of BCL-2 were evaluated by luciferase assay and Western blot under hypoxic or normoxic conditions. HIF-1α inhibitor YC-1 and siHIF-1α were employed to determine the effect of HIF-1α on the up-regulation of miR-204 and down-regulation of BCL-2 induced by hypoxia. Apoptosis assay showed the presence of apoptosis induced by hypoxia in neuronal cells. Moreover, we found that hypoxia significantly down-regulated the expression of BCL-2, and increased the mRNA level of miR-204 in neuronal cells than that in control. Bioinformatic analysis and luciferase reporter assay demonstrated that miR-204 directly targeted and regulated the expression of BCL-2. Specifically, the expression of BCL-2 was inhibited by miR-204 mimic and enhanced by miR-204 inhibitor. Furthermore, we detected that hypoxia induced cell apoptosis via HIF-1α/miR-204/BCL-2 in neuronal cells. This study demonstrated that HIF-1α-miR-204-BCL-2 pathway contributed to apoptosis of neuronal cells induced by hypoxia, which could potentially be exploited to prevent spinal cord ischemia-reperfusion injury. © 2015 by the Society for Experimental Biology and Medicine.

  12. Distinction of [220] and [204] textures of Cu(In,Ga)Se{sub 2} film and their growth behaviors depending on substrate nature and Na incorporation

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Dae-Hyung, E-mail: dhcho@etri.re.kr [IT Components and Materials Industry Technology Research Department, Electronics and Telecommunications Research Institute (ETRI), 218 Gajeongno, Yuseong-gu, Daejeon 305-700 (Korea, Republic of); Kim, Jeha [Department of Solar & Energy Engineering, Cheongju University, 298 Daeseongro, Sangdang-gu, Cheongju, Chungbuk 360-764 (Korea, Republic of); Chung, Yong-Duck [IT Components and Materials Industry Technology Research Department, Electronics and Telecommunications Research Institute (ETRI), 218 Gajeongno, Yuseong-gu, Daejeon 305-700 (Korea, Republic of); Korea University of Science and Technology (UST), 217 Gajeongno, Yuseong-gu, Daejeon 305-350 (Korea, Republic of)

    2015-08-31

    For better understanding of the structural property of polycrystalline tetragonal Cu(In,Ga)Se{sub 2} (CIGS) thin films grown on soda-lime glass, it is necessary to characterize the [220]- and [204]-oriented textures clearly that are related to the different physical properties. However, the distinction between the [220]- and [204]-oriented textures is very difficult because of their nearly identical plane spacings and atomic arrangements. Using X-ray diffraction techniques of high resolution θ–2θ scanning and reciprocal space mapping, we distinguished the [220]- and [204]-oriented textures of CIGS films and observed that the behaviors of [220] and [204] textures independently depended on both substrate nature and Na presence. We report the Na- and substrate-related dependence of the physical properties of the CIGS film was attributed to the independent growth behaviors of the [220] and [204] textures in the CIGS. - Highlights: • We investigated [220]- and [204]-oriented textures of Cu(In,Ga)Se{sub 2} (CIGS) films. • X-ray diffraction methods distinguished two textures. • The growth behaviors were influenced by underlying substrate and Na. • The [220] and [204] textures in CIGS should be differentially observed.

  13. Genomic loss of tumor suppressor miRNA-204 promotes cancer cell migration and invasion by activating AKT/mTOR/Rac1 signaling and actin reorganization.

    Directory of Open Access Journals (Sweden)

    J Saadi Imam

    Full Text Available Increasing evidence suggests that chromosomal regions containing microRNAs are functionally important in cancers. Here, we show that genomic loci encoding miR-204 are frequently lost in multiple cancers, including ovarian cancers, pediatric renal tumors, and breast cancers. MiR-204 shows drastically reduced expression in several cancers and acts as a potent tumor suppressor, inhibiting tumor metastasis in vivo when systemically delivered. We demonstrated that miR-204 exerts its function by targeting genes involved in tumorigenesis including brain-derived neurotrophic factor (BDNF, a neurotrophin family member which is known to promote tumor angiogenesis and invasiveness. Analysis of primary tumors shows that increased expression of BDNF or its receptor tropomyosin-related kinase B (TrkB parallel a markedly reduced expression of miR-204. Our results reveal that loss of miR-204 results in BDNF overexpression and subsequent activation of the small GTPase Rac1 and actin reorganization through the AKT/mTOR signaling pathway leading to cancer cell migration and invasion. These results suggest that microdeletion of genomic loci containing miR-204 is directly linked with the deregulation of key oncogenic pathways that provide crucial stimulus for tumor growth and metastasis. Our findings provide a strong rationale for manipulating miR-204 levels therapeutically to suppress tumor metastasis.

  14. Screening ultrasonography of 2,204 patients with blunt abdominal trauma in the Wenchuan earthquake.

    Science.gov (United States)

    Zhou, Jixiang; Huang, Jiwei; Wu, Hong; Jiang, Hui; Zhang, Heqing; Prasoon, Pankaj; Xu, Yinglong; Bai, Yannan; Qiu, Jianguo; Zeng, Yong

    2012-10-01

    Abdominal injuries constitute a small proportion of all earthquake-related traumas; however, it often resulted in fatal hemorrhage. Ultrasonography has been described as an effective triage tool in the evaluation of blunt abdominal trauma. We aimed to present an overview of the diagnostic accuracy of screening ultrasonography for patients with blunt abdominal trauma admitted to various hospitals during the Wenchuan earthquake in China. We retrospectively analyzed the patients with blunt abdominal trauma who underwent ultrasonography after admission to various hospitals. Ultrasonography findings were considered positive if evidence of free fluid or a parenchymal injury was identified. Ultrasonography findings were compared with the findings of computed tomography, diagnostic peritoneal lavage, repeated ultrasonography, cystography, operation, and/or the clinical course. Findings from 2,204 ultrasonographic examinations were evaluated. Findings of 199 ultrasonographic examinations (9.0%) were considered positive. Of the patients, 12 (0.5%) had a false-negative ultrasonographic findings; of this group, 3 (25%) required exploratory laparotomy. Ultrasonography had a sensitivity of 91.9%, specificity of 96.9%, and an accuracy of 96.6% for detection of abdominal injuries. Positive predictive value was 68.3%, and negative predictive value was 99.4%. Screening ultrasonography is highly reliable in the setting of blunt abdominal trauma after earthquake. It should be used as an initial diagnostic modality in the evaluation of most blunt abdominal trauma. Diagnostic study, level III.

  15. Skin Cancer: ClinicoPathological Study of 204 Patients in Southern Governorates of Yemen.

    Science.gov (United States)

    AlZou, Amer Bin; Thabit, Mazen Abood Bin; AlSakkaf, Khalid Abdulla; Basaleem, Huda Omer

    2016-01-01

    Skin cancer is a group of heterogeneous malignancies, in general classified into nonmelanoma skin cancer (NMSC) and melanoma skin cancer (MSC). Incidences are high in many parts in the world with considerable geographical and racial variation. In the Yemen, there has been scarce information about skin cancer. The aim of this study was to evaluate the demographic characteristics and histological trend of skin cancer in Southern Governorates of Yemen. This retrospective study covered 204 cases of skin cancer at the Modern Histopathology Laboratory and Aden Cancer Registry and Research Center, Faculty of Medicine and Health Sciences, University of Aden, for the period 20062013. Data were classified regarding different demographic and tumor related variables and analyzed using CanReg4 for cancer registry and SPSS (version 21). The commonest encountered skin cancer was NMSC (93.1%). Generally, skin cancer appears slightly more frequently in females than males with a 1:1.06 male: female ratio, with a mean age of 62.9 years. Slightly higher than onethird (36.3%) were from Aden governorate. The head and neck proved to be the most common site in both males and females (58%). Basal cell carcinoma (BCC) is the most common histological type of skin cancer (50.5%). Skin cancer is a common cancer in patients living in southern governorates of Yemen. The pattern appears nearly similar to the international figures with a low incidence of MSC.

  16. Identification of vortex structures in a cohort of 204 intracranial aneurysms.

    Science.gov (United States)

    Varble, Nicole; Trylesinski, Gabriel; Xiang, Jianping; Snyder, Kenneth; Meng, Hui

    2017-05-01

    An intracranial aneurysm (IA) is a cerebrovascular pathology that can lead to death or disability if ruptured. Abnormal wall shear stress (WSS) has been associated with IA growth and rupture, but little is known about the underlying flow physics related to rupture-prone IAs. Previous studies, based on analysis of a few aneurysms or partial views of three-dimensional vortex structures, suggest that rupture is associated with complex vortical flow inside IAs. To further elucidate the relevance of vortical flow in aneurysm pathophysiology, we studied 204 patient IAs (56 ruptured and 148 unruptured). Using objective quantities to identify three-dimensional vortex structures, we investigated the characteristics associated with aneurysm rupture and if these features correlate with previously proposed WSS and morphological characteristics indicative of IA rupture. Based on the Q -criterion definition of a vortex, we quantified the degree of the aneurysmal region occupied by vortex structures using the volume vortex fraction ( vVF ) and the surface vortex fraction ( sVF ). Computational fluid dynamics simulations showed that the sVF , but not the vVF , discriminated ruptured from unruptured aneurysms. Furthermore, we found that the near-wall vortex structures co-localized with regions of inflow jet breakdown, and significantly correlated to previously proposed haemodynamic and morphologic characteristics of ruptured IAs. © 2017 The Author(s).

  17. Ultrasonic examination of the PVRC plates Nos. 50/52, 51/53 and 204

    International Nuclear Information System (INIS)

    1979-01-01

    The imposed procedure for the ultrasonic examination of the three PVRC plates given to Europe is based on the ASME Boiler and Pressure Vessel Code, Section XI as it applies to a vessel in service and accessible from the outer surface only. This procedure is referred to as the PISC procedure. After one year of use it was modified and remained, until the end of the exercise, characterized by a 50% DAC cut-off. The three plates (50/52, 51/53 and 204) were examined following this procedure by several teams. Results were furnished: - as raw data given by the instrumentation, - as data interpreted by the team. Inspection teams also were allowed to use other procedures which in the report are called alternative procedures. The results of the examination by teams using alternative procedures were given as interpreted data by the team. Those data were corrected and arranged in a data bank on tape and on cards. Full drawings of the teams findings were also produced by the computer for easy understanding and verification of the data. Besides many defects in the welded zones, relevant base-material defects were declared by the teams

  18. Evaluation of Energy-Related Inventions Program: An Empirical Analysis of 204 Inventions; TOPICAL

    International Nuclear Information System (INIS)

    Brown, M.A.

    1987-01-01

    This report is an evaluation of the Energy-Related Inventions Program (ERIP). It assess the program's effectiveness and impacts, characterizes participating inventions and inventors, and identifies correlates of successful commercialization in order to suggest possible improvements. Seventy of the 204 ERIP inventions that were studied were successfully introduced into the market, accounting for more than$200M in sales from 1976 through 1984. During 1984, 921 full-time equivalent employees were supported directly by ERIP inventors or their licensees. (Estimates of indirect economic impacts are also contained in the report.) Data on patterns of fund raising clearly show a need for assistance by programs like ERIP. Commercially successful inventors shared several traits. They had less formal education, fewer patents, more work experience in small firms, more outside funding early in their work, more shared responsibility with others for invention development, more management experience, and greater previous experience with starting new businesses. Recommendations are made regarding: (1) priorities for allocating ERIP grants; (2) improved efficiency of the NBS/DOE operations; (3) delivery of technical and commercialization assistance to grant recipients; and (4) further evaluation research

  19. Identificación de la variante Q204x en ganado charbray en prueba de comportamiento

    Directory of Open Access Journals (Sweden)

    Williams Arellano Vera

    2011-01-01

    Full Text Available Se identificó por medio de discriminación alélica, la variante Q204X del gen de la Miostatina en un grupo de 34 toretes de la raza Charbray del Noroeste de México sometidos a pruebas de comportamiento. Se obtuvo una frecuencia de 9.3 % de portadores heterocigotos, y una frecuencia génica del 5 % en la muestra evaluada. Este es el primer reporte de la presencia de la variante Q204X en ganado Charbray, con el cual se abre la posibilidad de diseñar estrategias de identificación y cuantificación del efecto de la variante segregada para complementar los esquemas de mejoramiento genético basados en características productivas y reproductivas en el ganado Charbray de México.

  20. Studies of photon spectra from a thallium-204 foil source as an aid to dosimetry and shielding

    CERN Document Server

    Francis, T M

    1976-01-01

    Beta ray foil sources incorporating nuclides such as thallium-204, promethium-147 and strontium-90 plus yttrium-90 ar increasingly used in industrial devices such as thickness gauges. These sources are so constructed that they give rise to complex photon spectra containing low energy Bremsstrahlung and X-rays characteristic of the constructional materials. The energy response of practical monitoring instruments is such that they are likely to underestimate the dose due to such spectra unless they are calibrated using appropriate spectra. This report describes a series of measurements carried out on a commercially available thallium-204 foil source and five commonly used shielding materials. The measurements made with a NaI(T1) spectrometer have been corrected for instrumental distortions to obtain the photon spectra in air. These spectra are presented and have been used to compute dose in air with the help of published data on mass energy-absorption coefficients. Also included in the report are data derived f...

  1. Standardization of radionuclides 45Ca, 137Cs, 204Tl by tracing method using 4πβ-γ coincidence system

    International Nuclear Information System (INIS)

    Ponge-Ferreira, Claudia Regina Ponte

    2005-01-01

    The procedure followed for the standardization of 45 Ca, 137 Cs and 204 Tl is described. The activity measurements was carried out in a 4πβ-γ coincidence system by the tracing method. The radionuclides chosen as the P-y emitting tracer nuclide were 60 Co for the 45 Ca and 134 Cs for 137 Cs and 204 TL because their end-point beta-ray energy are close to the respective beta emitters. The radioactive sources were prepared using two different techniques: one was the drops technique and the other was the solution technique. In the drop technique the sources were prepared by dropping directly on the subtract both solutions (tracer and beta pure). In the other technique a solution of tracer plus beta pure was mixed previously before making the radioactive sources. The activities of the radionuclides obtained with these technique were compared and the values are in agreement within the experimental uncertainties. (author)

  2. Genome Sequence of Vibrio campbellii Strain UMTGB204, a Marine Bacterium Isolated from a Green Barrel Tunicate

    Science.gov (United States)

    Gan, Huan You; Noor, Mohd Ezhar Mohd; Saari, Nur Azna; Musa, Najiah; Mustapha, Baharim; Usup, Gires

    2015-01-01

    Vibrio campbellii strain UMTGB204 was isolated from a green barrel tunicate. The genome of this strain comprises 5,652,224 bp with 5,014 open reading frames, 9 rRNAs, and 116 tRNAs. It contains genes related to virulence and environmental tolerance. Gene clusters for the biosynthesis of nonribosomal peptides and bacteriocin were also identified. PMID:25814609

  3. Corrective Action Decision Document for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada: Revision 0, Including Errata Sheet

    Energy Technology Data Exchange (ETDEWEB)

    U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office

    2004-04-01

    This Corrective Action Decision Document identifies the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office's corrective action alternative recommendation for each of the corrective action sites (CASs) within Corrective Action Unit (CAU) 204: Storage Bunkers, Nevada Test Site (NTS), Nevada, under the Federal Facility Agreement and Consent Order. An evaluation of analytical data from the corrective action investigation, review of current and future operations at each CAS, and a detailed comparative analysis of potential corrective action alternatives were used to determine the appropriate corrective action for each CAS. There are six CASs in CAU 204, which are all located between Areas 1, 2, 3, and 5 on the NTS. The No Further Action alternative was recommended for CASs 01-34-01, 02-34-01, 03-34-01, and 05-99-02; and a Closure in Place with Administrative Controls recommendation was the preferred corrective action for CASs 05-18-02 and 05-33-01. These alternatives were judged to meet all requirements for the technical components evaluated as well as applicable state and federal regulations for closure of the sites and will eliminate potential future exposure pathways to the contaminated media at CAU 204.

  4. Hanford Tanks 241-C-203 and 241-C-204: Residual Waste Contaminant Release Model and Supporting Data

    Energy Technology Data Exchange (ETDEWEB)

    Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.

    2004-10-28

    This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy.

  5. Hanford Tanks 241-C-203 and 241 C 204: Residual Waste Contaminant Release Model and Supporting Data

    Energy Technology Data Exchange (ETDEWEB)

    Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.

    2007-05-23

    This report was revised in May 2007 to correct 90Sr values in Chapter 3. The changes were made on page 3.9, paragraph two and Table 3.10; page 3.16, last paragraph on the page; and Tables 3.21 and 3.31. The rest of the text remains unchanged from the original report issued in October 2004. This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy.

  6. Hanford Tanks 241-C-203 and 241-C-204: Residual Waste Contaminant Release Model and Supporting Data

    International Nuclear Information System (INIS)

    Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.

    2004-01-01

    This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy

  7. Comparison of the osteogenesis and fusion rates between activin A/BMP-2 chimera (AB204) and rhBMP-2 in a beagle's posterolateral lumbar spine model.

    Science.gov (United States)

    Zheng, Guang Bin; Yoon, Byung-Hak; Lee, Jae Hyup

    2017-10-01

    Activin A/BMP-2 chimera (AB204) could promote bone healing more effectively than recombinant bone morphogenetic protein 2 (rhBMP-2) with much lower dose in a rodent model, but there is no report about the effectiveness of AB204 in a large animal model. The purpose of this study was to compare the osteogenesis and fusion rate between AB204 and rhBMP-2 using biphasic calcium phosphate (BCP) as a carrier in a beagle's posterolateral lumbar fusion model. This is a randomized control animal study. Seventeen male beagle dogs were included. Bilateral posterolateral fusion was performed at the L1-L2 and L4-L5 levels. Biphasic calcium phosphate (2 cc), rhBMP-2 (50 µg)+BCP (2 cc), or AB204 (50 µg)+BCP (2 cc) were implanted into the intertransverse space randomly. X-ray was performed at 4 and 8 weeks. After 8 weeks, the animals were sacrificed, and new bone formation and fusion rate were evaluated by manual palpation, computed tomography (CT), and undecalcified histology. The AB204 group showed significantly higher fusion rate (90%) than the rhBMP-2 group (15%) or the Osteon group (6.3%) by manual palpation. On x-ray and CT assessment, fusion rate and the volume of newly formed bone were also significantly higher in AB204 group than other groups. In contrast, more osteolysis was found in rhBMP-2 group (40%) than in AB204 group (10%) on CT study. In histologic results, new bone formation was sufficient between transverse processes in AB204 group, and obvious trabeculation and bone remodeling were observed. But in rhBMP-2 group, new bone formation was less than AB204 group and osteolysis was observed between the intertransverse spaces. A low dose of AB204 with BCP as a carrier significantly promotes the fusion rate in a large animal model when compared with the rhBMP-2. These findings demonstrate that AB204 could be an alternative to rhBMP-2 to improve fusion rate. Copyright © 2017 Elsevier Inc. All rights reserved.

  8. Delivery of antagomiR204-conjugated gold nanoparticles from PLGA sheets and its implication in promoting osseointegration of titanium implant in type 2 diabetes mellitus

    Directory of Open Access Journals (Sweden)

    Liu X

    2017-09-01

    Full Text Available Xiangwei Liu,1,* Naiwen Tan,1,* Yuchao Zhou,1 Hongbo Wei,1,* Shuai Ren,1 Fan Yu,2 Hui Chen,3 Chengming Jia,4 Guodong Yang,5 Yingliang Song1 1State Key Laboratory of Military Stomatology & National Clinical Research Center for Oral Diseases & Shaanxi Engineering Research Center for Dental Materials and Advanced Manufacture, Department of Implant Dentistry, 2Department of Prosthodontics, School of Stomatology, 3Department of Plastic Surgery, Tangdu Hospital, 4Department of Traditional Chinese Medicine, Xijing Hospital, 5Department of Biochemistry and Molecular Biology, Fourth Military Medical University, Xi’an, China *These authors contributed equally to this work Abstract: Impaired osseointegration of the implant remains the big hurdle for dental implant therapy in diabetic patients. In this study, the authors first identified that miR204 was strikingly highly expressed in the bone mesenchymal stem cells (BMSCs of diabetic rats. Forced expression of miR204 repressed the osteogenic potential of BMSCs, while inhibition of miR204 significantly increased the osteogenic capacity. Moreover, the miR204 inhibitor was conjugated with gold nanoparticles (AuNP-antagomiR204 and dispersed them in the poly(lactic-co-glycolic acid (PLGA solution. The AuNP-antagomiR204 containing PLGA solution was applied for coating the surface of titanium implant. Electron microscope revealed that an ultrathin sheet was formed on the surface of the implant, and the AuNPs were evenly dispersed in the coated PLGA sheet. Cellular experiments revealed that these encapsulated AuNP-antagomiR204 were able to be released from the PLGA sheet and uptaken by adherent BMSCs. In vivo animal study further confirmed that the AuNP-antagomiR204 released from PLGA sheet promoted osseointegration, as revealed by microcomputerized tomography (microCT reconstruction and histological assay. Taken together, this study established that miR204 misexpression accounted for the deficient

  9. EFFECT OF UV IRRADIATION ON THE DYEING OF COTTON FABRIC WITH REACTIVE BLUE 204

    Directory of Open Access Journals (Sweden)

    ROŞU Liliana

    2017-05-01

    Full Text Available Reactive dyes are synthetic organic compounds used on a wide scale in textile industry, for painting materials of different types and compositions (e.g. 100% cotton, wool, natural satin, viscose, synthetic fibres. Reactive dyes are solid compounds (powders completely water soluble at normal temperature and pressure conditions. Their structures contain chromophore groups, which generate colour, and auxochrome groups, which determine the compounds water solubility and the capacity to fix to the textile fiber. Such organic compounds absorb UV-Vis radiations at specific wavelengths, corresponding to maximum absorbtion peaks, in both solution and dyed fiber. The human organism, through the dyed clothing, comes in direct contact with those dyes which can undergo modifications once exposed to UV radiations, having the posibility to reach the organism via cutanated transport. As it is known, the provoked negative effects are stronger during summer when UV radiations are more intense and in order to reduce their intensity dark coloured clothing is avoided. Dyes can be transformed in compounds which are easily absorbed into the skin. Some of these metabolites can be less toxic than the original corresponding dye, whilst others, such as free radicals, are potentially cancerous. Knowledge of the biological effects of the organic dyes, reactive dyes in particular, correlated with their structural and physical characteristics, permanently consists an issue of high scientific and practical interest and its solution may contribute in the diminishing of risk factors and improving of population health. UV radiation influence on the structural and colour modifications of textile materials were studied. Colour modifications are due to structural changes in aromatic and carbonil groups. In most cases photo-oxidative processes were identified in the dye structure. Dyeing was performed using non-irradiated and irradiated cotton painted with reactive blue dye 204.

  10. Cyr61 promotes CD204 expression and the migration of macrophages via MEK/ERK pathway in esophageal squamous cell carcinoma

    International Nuclear Information System (INIS)

    Shigeoka, Manabu; Urakawa, Naoki; Nishio, Mari; Takase, Nobuhisa; Utsunomiya, Soken; Akiyama, Hiroaki; Kakeji, Yoshihiro; Komori, Takahide; Koma, Yu-ichiro; Yokozaki, Hiroshi

    2015-01-01

    Tumor-associated macrophages (TAMs) are known to be involved in the progression of various human malignancies. We previously demonstrated that CD204 was a useful marker for TAMs contributing to the angiogenesis, progression, and prognosis of human esophageal squamous cell carcinoma (ESCC). We also showed that conditioned media of ESCC cell lines induced CD204 expression in THP-1 human monocytic leukemia cells. Here, we performed a cDNA microarray analysis between THP-1 cells stimulated with TPA (macrophage [MΦ]-like THP-1 cells) treated with and without conditioned medium of ESCC cell line to clarify the molecular characteristics of TAMs in ESCC. From the microarray data, we discovered that Cyr61 was induced in CD204-positive-differentiated THP-1 cells (TAM-like THP-1 cells). In the ESCC microenvironment, not only cancer cells but also TAMs expressed Cyr61. Interestingly, the expression levels of Cyr61 showed a significant positive correlation with the number of CD204-positive macrophages in ESCCs by immunohistochemistry. Recombinant human Cyr61 (rhCyr61) promoted cell migration and induced the expression of CD204 along with the activation of the MEK/ERK pathway in MΦ-like THP-1 cells. Pretreatment with a MEK1/2 inhibitor significantly inhibited not only the Cyr61-mediated migration but also the CD204 expression in the MΦ-like THP-1 cells. These results suggest that Cyr61 may contribute to the expression of CD204 and the promotion of cell migration via the MEK/ERK pathway in TAMs in the ESCC microenvironment

  11. Suppression of TLR4-mediated inflammatory response by macrophage class A scavenger receptor (CD204)

    Energy Technology Data Exchange (ETDEWEB)

    Ohnishi, Koji; Komohara, Yoshihiro; Fujiwara, Yukio; Takemura, Kenichi [Department of Cell Pathology, Graduate School of Medical Sciences, Faculty of Life Sciences, Kumamoto University, Kumamoto (Japan); Lei, XiaoFeng [Department of Cell Pathology, Graduate School of Medical Sciences, Faculty of Life Sciences, Kumamoto University, Kumamoto (Japan); Department of Biochemistry, Showa University School of Medicine, Tokyo (Japan); Nakagawa, Takenobu [Department of Cell Pathology, Graduate School of Medical Sciences, Faculty of Life Sciences, Kumamoto University, Kumamoto (Japan); Sakashita, Naomi [Department of Cell Pathology, Graduate School of Medical Sciences, Faculty of Life Sciences, Kumamoto University, Kumamoto (Japan); Department of Human Pathology, Institute of Health Biosciences, The University of Tokushima, Tokushima (Japan); Takeya, Motohiro, E-mail: takeya@kumamoto-u.ac.jp [Department of Cell Pathology, Graduate School of Medical Sciences, Faculty of Life Sciences, Kumamoto University, Kumamoto (Japan)

    2011-08-05

    Highlights: {yields} We focused on the interaction between SR-A and TLR4 signaling in this study. {yields} SR-A deletion promoted NF{kappa}B activation in macrophages in septic model mouse. {yields} SR-A suppresses both MyD88-dependent and -independent TLR4 signaling in vitro. {yields} SR-A clears LPS binding to TLR4 which resulting in the suppression of TLR4 signals. -- Abstract: The class A scavenger receptor (SR-A, CD204), one of the principal receptors expressed on macrophages, has been found to regulate inflammatory response and attenuate septic endotoxemia. However, the detailed mechanism of this process has not yet been well characterized. To clarify the regulative mechanisms of lipopolysaccharide (LPS)-induced macrophage activation by SR-A, we evaluated the activation of Toll-like receptor 4 (TLR4)-mediated signaling molecules in SR-A-deficient (SR-A{sup -/-}) macrophages. In a septic shock model, the blood levels of tumor necrosis factor (TNF)-{alpha}, interleukin (IL)-6 and interferon (IFN)-{beta} were significantly increased in SR-A{sup -/-} mice compared to wild-type mice, and elevated nuclear factor kappa B (NF{kappa}B) activation was detected in SR-A{sup -/-} macrophages. SR-A deletion increased the production of pro-inflammatory cytokines, and the phosphorylation of mitogen-activated protein kinase (MAPK) and NF{kappa}B in vitro. SR-A deletion also promoted the nuclear translocation of NF{kappa}B and IFN regulatory factor (IRF)-3. In addition, a competitive binding assay with acetylated low-density lipoprotein, an SR-A-specific ligand, and anti-SR-A antibody induced significant activation of TLR4-mediated signaling molecules in wild-type macrophages but not in SR-A{sup -/-} macrophages. These results suggest that SR-A suppresses the macrophage activation by inhibiting the binding of LPS to TLR4 in a competitive manner and it plays a pivotal role in the regulation of the LPS-induced inflammatory response.

  12. Senegalese sole (solea senegalensis) broodstock nutrition: arachidonic acid (20:4n-6, ARA) and reproductive physiology

    OpenAIRE

    Norambuena Filcun, Fernando

    2012-01-01

    Considerando la total ausencia del desove natural y fertilización de huevos en reproductores de lenguado Senegalés (Solea senegalensis) nacidos en cautividad (G1) comparados con peces salvajes mantenidos en cautivo que son capaces de producir huevos fertilizados viables para su cultivo. Esta tesis se realizó con el objetivo de determinar la importancia dietética de los ácidos grasos, específicamente del ácido graso araquidónico (20:4n-6, ARA) y su interacción en la disfunción reproductiva pre...

  13. Completion Report for Well ER-20-4 Corrective Action Units 101 and 102: Central and Western Pahute Mesa

    Energy Technology Data Exchange (ETDEWEB)

    NSTec Environmental Management

    2011-04-30

    Well ER-20-4 was drilled for the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office in support of the Nevada Environmental Restoration Project at the Nevada National Security Site, Nye County, Nevada. The well was drilled in August and September 2010 as part of the Pahute Mesa Phase II drilling program. The primary purpose of the well was to investigate the possibility of radionuclide transport from up-gradient underground nuclear tests conducted in central Pahute Mesa. This well also provided detailed hydrogeologic information in the Tertiary volcanic section that will help reduce uncertainties within the Pahute Mesa-Oasis Valley hydrostratigraphic framework model.

  14. The long non-coding RNA MALAT1 promotes the migration and invasion of hepatocellular carcinoma by sponging miR-204 and releasing SIRT1.

    Science.gov (United States)

    Hou, Zhouhua; Xu, Xuwen; Zhou, Ledu; Fu, Xiaoyu; Tao, Shuhui; Zhou, Jiebin; Tan, Deming; Liu, Shuiping

    2017-07-01

    Increasing evidence supports the significance of long non-coding RNA in cancer development. Several recent studies suggest the oncogenic activity of long non-coding RNA metastasis-associated lung adenocarcinoma transcript 1 (MALAT1) in hepatocellular carcinoma. In this study, we explored the molecular mechanisms by which MALAT1 modulates hepatocellular carcinoma biological behaviors. We found that microRNA-204 was significantly downregulated in sh-MALAT1 HepG2 cell and 15 hepatocellular carcinoma tissues by quantitative real-time polymerase chain reaction analysis. Through bioinformatic screening, luciferase reporter assay, RNA-binding protein immunoprecipitation, and RNA pull-down assay, we identified microRNA-204 as a potential interacting partner for MALAT1. Functionally, wound-healing and transwell assays revealed that microRNA-204 significantly inhibited the migration and invasion of hepatocellular carcinoma cells. Notably, sirtuin 1 was recognized as a direct downstream target of microRNA-204 in HepG2 cells. Moreover, si-SIRT1 significantly inhibited cell invasion and migration process. These data elucidated, by sponging and competitive binding to microRNA-204, MALAT1 releases the suppression on sirtuin 1, which in turn promotes hepatocellular carcinoma migration and invasion. This study reveals a novel mechanism by which MALAT1 stimulates hepatocellular carcinoma progression and justifies targeting metastasis-associated lung adenocarcinoma transcript 1 as a potential therapy for hepatocellular carcinoma.

  15. Assessment of space proton radiation-induced charge transfer inefficiency in the CCD204 for the Euclid space observatory

    International Nuclear Information System (INIS)

    Gow, J P D; Murray, N J; Holland, A D; Hall, D J; Cropper, M; Burt, D; Hopkinson, G; Duvet, L

    2012-01-01

    Euclid is a medium class European Space Agency mission candidate for launch in 2019 with a primary goal to study the dark universe using the weak lensing and baryonic acoustic oscillations techniques. Weak lensing depends on accurate shape measurements of distant galaxies. Therefore it is beneficial that the effects of radiation-induced charge transfer inefficiency (CTI) in the Euclid CCDs over the course of the 5 year mission at L2 are understood. This will allow, through experimental analysis and modelling techniques, the effects of radiation induced CTI on shape to be decoupled from those of mass inhomogeneities along the line-of-sight. This paper discusses a selection of work from the study that has been undertaken using the e2v CCD204 as part of the initial proton radiation damage assessment for Euclid. The experimental arrangement and procedure are described followed by the results obtained, thereby allowing recommendations to be made on the CCD operating temperature, to provide an insight into CTI effects using an optical background, to assess the benefits of using charge injection on CTI recovery and the effect of the use of two different methods of serial clocking on serial CTI. This work will form the basis of a comparison with a p-channel CCD204 fabricated using the same mask set as the n-channel equivalent. A custom CCD has been designed, based on this work and discussions between e2v technologies plc. and the Euclid consortium, and designated the CCD273.

  16. Pattern Recognition Scavenger Receptor A/CD204 Regulates Airway Inflammatory Homeostasis Following Organic Dust Extract Exposures

    Science.gov (United States)

    Poole, Jill A.; Anderson, Leigh; Gleason, Angela M.; West, William W.; Romberger, Debra J.; Wyatt, Todd A.

    2014-01-01

    Exposure to agriculture organic dusts, comprised of a diversity of pathogen-associated molecular patterns, results in chronic airway diseases. The multi-functional class A macrophage scavenger receptor (SRA)/CD204 has emerged as an important class of pattern recognition receptors with broad ligand binding ability. Our objective was to determine the role of SRA in mediating repetitive and post-inflammatory organic dust extract (ODE)-induced airway inflammation. Wild-type (WT) and SRA knockout (KO) mice were intra-nasally treated with ODE or saline daily for 3 wk and immediately euthanized or allowed to recover for 1 wk. Results show that lung histopathologic changes were increased in SRA KO mice as compared to WT following repetitive ODE exposures marked predominately by increased size and distribution of lymphoid aggregates. After a 1-wk recovery from daily ODE treatments, there was significant resolution of lung injury in WT mice, but not SRA KO animals. The increased lung histopathology induced by ODE treatment was associated with decreased accumulation of neutrophils, but greater accumulation of CD4+ T-cells. The lung cytokine milieu induced by ODE was consistent with a TH1/TH17 polarization in both WT and SRA KO mice. Overall, our data demonstrate that SRA/CD204 plays an important role in the normative inflammatory lung response to ODE as evidenced by the enhanced dust-mediated injury viewed in the absence of this receptor. PMID:24491035

  17. Th{sup 232} (n,2n) Th{sup 231} cross section from threshold to 20.4 Mev

    Energy Technology Data Exchange (ETDEWEB)

    Butler, J P; Santry, D C

    1961-07-01

    The excitation curve for the reaction Th{sup 232} (n,2n) Th{sup 231} has been measured by the activation method from the threshold energy, 6.34 Mev, to 20.4 Mev, relative to the known cross section for the S{sup 32} (n, p) P{sup 32} reaction. Monoenergetic neutrons were obtained from the D (d,n) He{sup 3} and T (d,n) He{sup 4} reactions employing a Tandem Van de Graaff accelerator. From threshold to 9.0 Mev, the (n,2n) cross section rises rapidly, reaching its maximum value of 1.88 {+-} 0.09 barns in the region of 9.5 to 11.0 Mev. Above 11.5 Mev the (n,2n) cross section decreases due to competition of the (n,3n) and (n,2nf) reactions and at 20.4 Mev it has a value of 0.22{sub 5} {+-} 0.01{sub 5} barns. (author)

  18. A humanized monoclonal antibody neutralizes yellow fever virus strain 17D-204 in vitro but does not protect a mouse model from disease.

    Science.gov (United States)

    Calvert, Amanda E; Dixon, Kandice L; Piper, Joseph; Bennett, Susan L; Thibodeaux, Brett A; Barrett, Alan D T; Roehrig, John T; Blair, Carol D

    2016-07-01

    The yellow fever virus (YFV) vaccine 17D-204 is considered safe and effective, yet rare severe adverse events (SAEs), some resulting in death, have been documented following vaccination. Individuals exhibiting post-vaccinal SAEs are ideal candidates for antiviral monoclonal antibody (MAb) therapy; the time until appearance of clinical signs post-exposure is usually short and patients are quickly hospitalized. We previously developed a murine-human chimeric monoclonal antibody (cMAb), 2C9-cIgG, reactive with both virulent YFV and 17D-204, and demonstrated its ability to prevent and treat YF disease in both AG129 mouse and hamster models of infection. To counteract possible selection of 17D-204 variants that escape neutralization by treatment with a single MAb (2C9-cIgG), we developed a second cMAb, 864-cIgG, for use in combination with 2C9-cIgG in post-vaccinal therapy. MAb 864-cIgG recognizes/neutralizes only YFV 17D-204 vaccine substrain and binds to domain III (DIII) of the viral envelope protein, which is different from the YFV type-specific binding site of 2C9-cIgG in DII. Although it neutralized 17D-204 in vitro, administration of 864-cIgG had no protective capacity in the interferon receptor-deficient AG129 mouse model of 17D-204 infection. The data presented here show that although DIII-specific 864-cIgG neutralizes virus infectivity in vitro, it does not have the ability to abrogate disease in vivo. Therefore, combination of 864-cIgG with 2C9-cIgG for treatment of YF vaccination SAEs does not appear to provide an improvement on 2C9-cIgG therapy alone. Copyright © 2016 Elsevier B.V. All rights reserved.

  19. LncRNA TUG1 sponges miR-204-5p to promote osteoblast differentiation through upregulating Runx2 in aortic valve calcification.

    Science.gov (United States)

    Yu, Cong; Li, Lifu; Xie, Fei; Guo, Shichao; Liu, Fayuan; Dong, Nianguo; Wang, Yongjun

    2018-01-01

    Emerging evidence indicates that long non-coding RNAs (lncRNAs) play a vital role in cardiovascular physiology and pathology. Although the lncRNA TUG1 is implicated in atherosclerosis, its function in calcific aortic valve disease (CAVD) remains unknown. In this study, we found that TUG1 was highly expressed in human aortic valves and primary valve interstitial cells (VICs). Moreover, TUG1 knockdown induced inhibition of osteoblast differentiation in CAVD both in vitro and in vivo. Mechanistically, silencing of TUG1 increased the expression of miR-204-5p and subsequently inhibited Runx2 expression at the post-transcriptional level. Importantly, TUG1 directly interacted with miR-204-5p and downregulation of miR-204-5p efficiently reversed the suppression of Runx2 induced by TUG1 short hairpin RNA (shRNA). Thus, TUG1 positively regulated the expression of Runx2, through sponging miR-204-5p, and promoted osteogenic differentiation in CAVD. All together, the evidence generated by our study elucidates the role of lncRNA TUG1 as a miRNA sponge in CAVD, and sheds new light on lncRNA-directed diagnostics and therapeutics in CAVD. Published on behalf of the European Society of Cardiology. All rights reserved. © The Author 2017. For permissions please email: journals.permissions@oup.com.

  20. 41 CFR 301-71.204 - Within how many calendar days after the submission of a proper travel claim must we reimburse the...

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 4 2010-07-01 2010-07-01 false Within how many calendar days after the submission of a proper travel claim must we reimburse the employee's allowable expenses... REQUIREMENTS Travel Claims for Reimbursement § 301-71.204 Within how many calendar days after the submission of...

  1. How to Use the ADI-R for Classifying Autism Spectrum Disorders? Psychometric Properties of Criteria from the Literature in 1,204 Dutch Children

    Science.gov (United States)

    de Bildt, Annelies; Oosterling, Iris J.; van Lang, Natasja D. J.; Kuijper, Sanne; Dekker, Vera; Sytema, Sjoerd; Oerlemans, Anoek M.; van Steijn, Daphne J.; Visser, Janne C.; Rommelse, Nanda N.; Minderaa, Ruud B.; van Engeland, Herman; van der Gaag, Rutger-Jan; Buitelaar, Jan K.; de Jonge, Maretha V.

    2013-01-01

    The algorithm of the Autism Diagnostic Interview-Revised provides criteria for autism versus non-autism according to DSM-IV. Criteria for the broader autism spectrum disorders are needed. This study investigated the validity of seven sets of criteria from the literature, in 1,204 Dutch children (aged 3-18 years) with and without mental…

  2. 30 CFR 204.208 - May a State decide that it will or will not allow one or both of the relief options under this...

    Science.gov (United States)

    2010-07-01

    ... MARGINAL PROPERTIES Accounting and Auditing Relief § 204.208 May a State decide that it will or will not allow one or both of the relief options under this subpart? (a) A State may decide in advance that it... 30 Mineral Resources 2 2010-07-01 2010-07-01 false May a State decide that it will or will not...

  3. Structure-Based Mutagenesis of Sulfolobus Turreted Icosahedral Virus B204 Reveals Essential Residues in the Virion-Associated DNA-Packaging ATPase.

    Science.gov (United States)

    Dellas, Nikki; Snyder, Jamie C; Dills, Michael; Nicolay, Sheena J; Kerchner, Keshia M; Brumfield, Susan K; Lawrence, C Martin; Young, Mark J

    2015-12-23

    Sulfolobus turreted icosahedral virus (STIV), an archaeal virus that infects the hyperthermoacidophile Sulfolobus solfataricus, is one of the most well-studied viruses of the domain Archaea. STIV shares structural, morphological, and sequence similarities with viruses from other domains of life, all of which are thought to belong to the same viral lineage. Several of these common features include a conserved coat protein fold, an internal lipid membrane, and a DNA-packaging ATPase. B204 is the ATPase encoded by STIV and is thought to drive packaging of viral DNA during the replication process. Here, we report the crystal structure of B204 along with the biochemical analysis of B204 mutants chosen based on structural information and sequence conservation patterns observed among members of the same viral lineage and the larger FtsK/HerA superfamily to which B204 belongs. Both in vitro ATPase activity assays and transfection assays with mutant forms of B204 confirmed the essentiality of conserved and nonconserved positions. We also have identified two distinct particle morphologies during an STIV infection that differ in the presence or absence of the B204 protein. The biochemical and structural data presented here are not only informative for the STIV replication process but also can be useful in deciphering DNA-packaging mechanisms for other viruses belonging to this lineage. STIV is a virus that infects a host from the domain Archaea that replicates in high-temperature, acidic environments. While STIV has many unique features, there exist several striking similarities between this virus and others that replicate in different environments and infect a broad range of hosts from Bacteria and Eukarya. Aside from structural features shared by viruses from this lineage, there exists a significant level of sequence similarity between the ATPase genes carried by these different viruses; this gene encodes an enzyme thought to provide energy that drives DNA packaging into

  4. Corrective Action Decision Document for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada, Revision 0 with ROTC 1, 2, and Errata

    Energy Technology Data Exchange (ETDEWEB)

    Wickline, Alfred

    2004-04-01

    This Corrective Action Decision Document (CADD) has been prepared for Corrective Action Unit (CAU) 204 Storage Bunkers, Nevada Test Site (NTS), Nevada, in accordance with the ''Federal Facility Agreement and Consent Order'' (FFACO) that was agreed to by the State of Nevada; U.S. Department of Energy (DOE); and the U.S. Department of Defense (FFACO, 1996). The NTS is approximately 65 miles (mi) north of Las Vegas, Nevada (Figure 1-1). The Corrective Action Sites (CASs) within CAU 204 are located in Areas 1, 2, 3, and 5 of the NTS, in Nye County, Nevada (Figure 1-2). Corrective Action Unit 204 is comprised of the six CASs identified in Table 1-1. As shown in Table 1-1, the FFACO describes four of these CASs as bunkers one as chemical exchange storage and one as a blockhouse. Subsequent investigations have identified four of these structures as instrumentation bunkers (CASs 01-34-01, 02-34-01, 03-34-01, 05-33-01), one as an explosives storage bunker (CAS 05-99-02), and one as both (CAS 05-18-02). The six bunkers included in CAU 204 were primarily used to monitor atmospheric testing or store munitions. The ''Corrective Action Investigation Plan (CAIP) for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada'' (NNSA/NV, 2002a) provides information relating to the history, planning, and scope of the investigation; therefore, it will not be repeated in this CADD. This CADD identifies potential corrective action alternatives and provides a rationale for the selection of a recommended corrective action alternative for each CAS within CAU 204. The evaluation of corrective action alternatives is based on process knowledge and the results of investigative activities conducted in accordance with the CAIP (NNSA/NV, 2002a) that was approved prior to the start of the Corrective Action Investigation (CAI). Record of Technical Change (ROTC) No. 1 to the CAIP (approval pending) documents changes to the preliminary action levels

  5. Medium-spin levels and the character of the 20.4 ns 13/2+ isomer in 145Gd

    International Nuclear Information System (INIS)

    Pakkanen, A.; Muhonen, J.; Piiparinen, M.

    1981-06-01

    Levels of the N = 81 nucleus 145 Gd have been investigated by in-beam γ-ray and conversion electron spectroscopy with the 144 Sm( 3 He,2n) reaction. Fourteen new low- and medium-spin states between 1.0 and 2.4 MeV excitation, the known yrast levels up to spin (21/2) + , five other high-spin non-yrast states and a new 20.4 ns (13/2) + isomer at 2200.2 keV in 145 Gd have been observed. The isomer decays via a fast 927.3 keV E3 transition with B(E3) = 48 +- 7 W.u. Another weaker decay branch is a mixed, strongly hindered E1+M2+E3 transition to the νhsub(11/2)sup(-1) state. We propose an octupole νfsub(7/2)jsub(0)sup(-2)x3 - main configuration for the isomer, analogous to the 997 keV (13/2) + isomer in 147 Gd. The levels of 145 Gd are discussed on the basis of the spherical shell model. (author)

  6. Tank Vapor Characterization Project: Headspace vapor characterization of Hanford Waste Tank U-204, Results from samples collected on August 8, 1995

    International Nuclear Information System (INIS)

    Clauss, T.W.; Evans, J.C.; McVeety, B.D.; Pool, K.H.; Thomas, B.L.; Olsen, K.B.; Fruchter, J.S.; Ligotke, M.W.

    1995-11-01

    This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-U-204 (Tank U-204) at the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank-farm operations. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNL). Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNL. Analyte concentrations were based on analytical results and, where appropriate, sample volumes provided by WHC. A summary of the results is listed. Detailed descriptions of the analytical results appear in the text

  7. Relationship between open-circuit voltage in Cu(In,Ga)Se2 solar cell and peak position of (220/204) preferred orientation near its absorber surface

    International Nuclear Information System (INIS)

    Chantana, J.; Minemoto, T.; Watanabe, T.; Teraji, S.; Kawamura, K.

    2013-01-01

    Cu(In,Ga)Se 2 (CIGS) absorbers with various Ga/III, Ga/(In+Ga), profiles are prepared by the so-called “multi-layer precursor method” using multi-layer co-evaporation of material sources. It is revealed that open-circuit voltage (V OC ) of CIGS solar cell is primarily dependent on averaged Ga/III near the surface of its absorber. This averaged Ga/III is well predicted by peak position of (220/204) preferred orientation of CIGS film near its surface investigated by glancing-incidence X-ray diffraction with 0.1° incident angle. Finally, the peak position of (220/204) preferred orientation is proposed as a measure of V OC before solar cell fabrication

  8. A small animal peripheral challenge model of yellow fever using interferon-receptor deficient mice and the 17D-204 vaccine strain.

    Science.gov (United States)

    Thibodeaux, Brett A; Garbino, Nina C; Liss, Nathan M; Piper, Joseph; Blair, Carol D; Roehrig, John T

    2012-05-02

    Yellow fever virus (YFV), a member of the genus Flavivirus, is a mosquito-borne pathogen that requires wild-type (wt), virulent strains to be handled at biosafety level (BSL) 3, with HEPA-filtration of room air exhaust (BSL3+). YFV is found in tropical regions of Africa and South America and causes severe hepatic disease and death in humans. Despite the availability of effective vaccines (17D-204 or 17DD), YFV is still responsible for an estimated 200,000 cases of illness and 30,000 deaths annually. Besides vaccination, there are no other prophylactic or therapeutic strategies approved for use in human YF. Current small animal models of YF require either intra-cranial inoculation of YF vaccine to establish infection, or use of wt strains (e.g., Asibi) in order to achieve pathology. We have developed and characterized a BSL2, adult mouse peripheral challenge model for YFV infection in mice lacking receptors for interferons α, β, and γ (strain AG129). Intraperitoneal challenge of AG129 mice with 17D-204 is a uniformly lethal in a dose-dependent manner, and 17D-204-infected AG129 mice exhibit high viral titers in both brain and liver suggesting this infection is both neurotropic and viscerotropic. Furthermore the use of a mouse model permitted the construction of a 59-biomarker multi-analyte profile (MAP) using samples of brain, liver, and serum taken at multiple time points over the course of infection. This MAP serves as a baseline for evaluating novel therapeutics and their effect on disease progression. Changes (4-fold or greater) in serum and tissue levels of pro- and anti-inflammatory mediators as well as other factors associated with tissue damage were noted in AG129 mice infected with 17D-204 as compared to mock-infected control animals. Published by Elsevier Ltd.

  9. Modeling and Docking Studies on Novel Mutants (K71L and T204V of the ATPase Domain of Human Heat Shock 70 kDa Protein 1

    Directory of Open Access Journals (Sweden)

    Asita Elengoe

    2014-04-01

    Full Text Available The purpose of exploring protein interactions between human adenovirus and heat shock protein 70 is to exploit a potentially synergistic interaction to enhance anti-tumoral efficacy and decrease toxicity in cancer treatment. However, the protein interaction of Hsp70 with E1A32 kDa of human adenovirus serotype 5 remains to be elucidated. In this study, two residues of ATPase domain of human heat shock 70 kDa protein 1 (PDB: 1 HJO were mutated. 3D mutant models (K71L and T204V using PyMol software were then constructed. The structures were evaluated by PROCHECK, ProQ, ERRAT, Verify 3D and ProSA modules. All evidence suggests that all protein models are acceptable and of good quality. The E1A32 kDa motif was retrieved from UniProt (P03255, as well as subjected to docking interaction with NBD, K71L and T204V, using the Autodock 4.2 program. The best lowest binding energy value of −9.09 kcal/mol was selected for novel T204V. Moreover, the protein-ligand complex structures were validated by RMSD, RMSF, hydrogen bonds and salt bridge analysis. This revealed that the T204V-E1A32 kDa motif complex was the most stable among all three complex structures. This study provides information about the interaction between Hsp70 and the E1A32 kDa motif, which emphasizes future perspectives to design rational drugs and vaccines in cancer therapy.

  10. Variations of nuclear charge radii in mercury isotopes with A = 198, 199, 200, 201, 202, and 204 from x-ray isotope shifts

    International Nuclear Information System (INIS)

    Lee, P.L.; Boehm, F.; Hahn, A.A.

    1978-01-01

    The isotope shifts of atomic K x rays were measured for pairs of the six mercury isotopes with A = 198, 199, 200, 201, 202, and 204, using a curved crystal spectrometer. The changes of the nuclear charge radii were derived in terms of delta 2 > and deltaR/sub k/ and compared with optical an muonic isotope shift data. From our results, a renormalization of the optical data was obtained

  11. Comparison of the live attenuated yellow fever vaccine 17D-204 strain to its virulent parental strain Asibi by deep sequencing.

    Science.gov (United States)

    Beck, Andrew; Tesh, Robert B; Wood, Thomas G; Widen, Steven G; Ryman, Kate D; Barrett, Alan D T

    2014-02-01

    The first comparison of a live RNA viral vaccine strain to its wild-type parental strain by deep sequencing is presented using as a model the yellow fever virus (YFV) live vaccine strain 17D-204 and its wild-type parental strain, Asibi. The YFV 17D-204 vaccine genome was compared to that of the parental strain Asibi by massively parallel methods. Variability was compared on multiple scales of the viral genomes. A modeled exploration of small-frequency variants was performed to reconstruct plausible regions of mutational plasticity. Overt quasispecies diversity is a feature of the parental strain, whereas the live vaccine strain lacks diversity according to multiple independent measurements. A lack of attenuating mutations in the Asibi population relative to that of 17D-204 was observed, demonstrating that the vaccine strain was derived by discrete mutation of Asibi and not by selection of genomes in the wild-type population. Relative quasispecies structure is a plausible correlate of attenuation for live viral vaccines. Analyses such as these of attenuated viruses improve our understanding of the molecular basis of vaccine attenuation and provide critical information on the stability of live vaccines and the risk of reversion to virulence.

  12. Synthesis and characterization of binary (CuO)0.6(CeO2)0.4 nanoparticles via a simple heat treatment method

    Science.gov (United States)

    Baqer, Anwar Ali; Matori, Khamirul Amin; Al-Hada, Naif Mohammed; Shaari, Abdul Halim; Kamari, Halimah Mohamed; Saion, Elias; Chyi, Josephine Liew Ying; Abdullah, Che Azurahanim Che

    2018-06-01

    A binary (CuO)0.6 (CeO2)0.4 nanoparticles were prepared via thermal treatment method, using copper nitrate, cerium nitrate as precursors, PVP as capping agent and de-ionized water as a solvent. The structures, morphology, composition of the element and optical properties of these nanoparticles have been studied under different temperatures using various techniques. The XRD spectrum of the samples at 500 °C and above confirmed the existence of both monoclinic (CuO) and cubic fluorite (CeO2) structures. The findings of FESEM and TEM exhibited the average practical size and agglomeration increment with an elevation in the calcination temperature. The synthesized nanoparticles were also characterized by FTIR, which indicated the formation of binary Cu-O and Ce-O bonds. The EDX analysis was performed to indicate the chemical composition of the sample. The double energy band gaps of (CuO)0.6(CeO2)0.4 reduction with rising calcination temperature, can be referred to the enhancement of the crystallinity of the samples. PL intensity of (CuO)0.6(CeO2)0.4 nanoparticles peaks, which increased with the elevation of the calcination temperature to 800 °C was observed from the PL spectrum; this was due to the increment of the particle size that occurred.

  13. Food sources of total omega 6 fatty acids (18:2 + 20:4), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006

    Science.gov (United States)

    Food sources of total omega 6 fatty acids (18:2 + 20:4), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006

  14. Food sources of arachidonic acid (PFA 20:4), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006

    Science.gov (United States)

    Food sources of arachidonic acid (PFA 20:4), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006

  15. 204 - 207 Suleiman

    African Journals Online (AJOL)

    DR. AMIN

    2011-12-02

    Dec 2, 2011 ... insecticidal activities against the two insect pests of stored grains of maize ... If the plant powders reduce adult longevity and fitness, the number of ... physical contact and caused suffocation among the adult weevils. Powder of ...

  16. 204 - 207 Suleiman

    African Journals Online (AJOL)

    DR. AMIN

    2011-12-02

    Dec 2, 2011 ... important role in protection of stored grains from insect invasion during storage. Key words: ... for their insecticidal value, but there was no much progress in ... Neem. Dogon-Yaro. Meliaceae. Seeds. 2. Jatropha curcas L.

  17. Validation of expression patterns for nine miRNAs in 204 lymph-node negative breast cancers.

    Directory of Open Access Journals (Sweden)

    Kristin Jonsdottir

    Full Text Available INTRODUCTION: Although lymph node negative (LN- breast cancer patients have a good 10-years survival (∼85%, most of them still receive adjuvant therapy, while only some benefit from this. More accurate prognostication of LN- breast cancer patient may reduce over- and under-treatment. Until now proliferation is the strongest prognostic factor for LN- breast cancer patients. The small molecule microRNA (miRNA has opened a new window for prognostic markers, therapeutic targets and/or therapeutic components. Previously it has been shown that miR-18a/b, miR-25, miR-29c and miR-106b correlate to high proliferation. METHODS: The current study validates nine miRNAs (miR-18a/b miR-25, miR-29c, miR-106b, miR375, miR-424, miR-505 and let-7b significantly correlated with established prognostic breast cancer biomarkers. Total RNA was isolated from 204 formaldehyde-fixed paraffin embedded (FFPE LN- breast cancers and analyzed with quantitative real-time Polymerase Chain Reaction (qPCR. Independent T-test was used to detect significant correlation between miRNA expression level and the different clinicopathological features for breast cancer. RESULTS: Strong and significant associations were observed for high expression of miR-18a/b, miR-106b, miR-25 and miR-505 to high proliferation, oestrogen receptor negativity and cytokeratin 5/6 positivity. High expression of let-7b, miR-29c and miR-375 was detected in more differentiated tumours. Kaplan-Meier survival analysis showed that patients with high miR-106b expression had an 81% survival rate vs. 95% (P = 0.004 for patients with low expression. CONCLUSION: High expression of miR-18a/b are strongly associated with basal-like breast cancer features, while miR-106b can identify a group with higher risk for developing distant metastases in the subgroup of Her2 negatives. Furthermore miR-106b can identify a group of patients with 100% survival within the otherwise considered high risk group of patients with

  18. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  19. Reaction of aromatic diazonium salts with carrier-free radioiodine and astatine, evidence for complex formation

    International Nuclear Information System (INIS)

    Meyer, G.J.; Roessler, K.; Stoecklin, G.

    1979-01-01

    Systematic studies of the astatodiazoniation reaction and a comparison with iododediazoniation under comparable conditions are reported. The yields for all astatohalobenzenes and -toluenes were nearly constant and unaffected by the nature of the diazonium compound, its isomeric form, and the number of isomers used at the same time. Only astatofluorobenzenes were obtained at higher yields. An electron-transfer mechanism is proposed for dediazoniation at these low halide concentration levels. At sufficient thermal excitation levels the electron transfer leads to the dissociation of nitrogen, while the phenyl and halogen radicals recombine. The isomer distribution found for some of the derivatives from dediazoniation may also be due to steric effects

  20. Astatine-211-labeled biotin conjugates resistant to biotinidase for use in pretargeted radioimmunotherapy

    International Nuclear Information System (INIS)

    Foulon, Catherine F.; Alston, Kevin L.; Zalutsky, Michael R.

    1998-01-01

    We report herein the preparation and biological evaluation of two radioastatinated biotin conjugates, (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide. Both conjugates were stable in the presence of human serum and cerebrospinal fluid as well as murine serum, indicating a resistance to degradation to biotinidase. The normal tissue clearance of (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide was rapid, as observed previously with their iodo analogues. Also reported are the first syntheses of N-succinimidyl 5-[ 211 At]astato-3-pyridinecarboxylate and 3-[ 211 At]astatoaniline, two reagents of potential utility for labeling proteins and peptides with 211 At

  1. Microdosimetry of astatine-211 and comparison with that of iodine-125

    International Nuclear Information System (INIS)

    Unak, T.

    2001-01-01

    211 At is an alpha and Auger emitter radionuclide and has been frequently used for labeling of different kind of chemical agents. 125 I is also known as an effective Auger emitter. The radionuclides which emit short range and high LET radiations such as alpha particles and Auger electrons have high radiotoxic effectiveness on the living systems. The microdosimetric data are suitable to clarify the real radiotoxic effectiveness and to get the detail of diagnostic and therapeutic application principles of these radionuclides. In this study, the energy and dose absorptions by cell nucleus from alpha particles and Auger electrons emitted by 211 At have been calculated using a Monte Carlo calculation program (code: UNMOC). For these calculations two different model corresponding to the cell nucleus have been used and the data obtained were compared with the data earlier obtained for 125 I. As a result, the radiotoxicity of 211 At is in the competition with 125 I. In the case of a specific agent labelled with 211 At or 125 I is incorporated into the cell or cell nucleus, but non-bound to DNA or not found very close to it, 211 At should considerably be much more radiotoxic than 125 I, but in the case of the labelled agent is bound to DNA or take a place very close to it, the radiotoxicity of 125 I should considerably be higher than 211 At. (author)

  2. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-211 Isolation

    International Nuclear Information System (INIS)

    Wilbur, Daniel Scott

    2016-01-01

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O'Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211 At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211 At capture (>95%) from 8M HCl solutions and release with conc. NH 4 OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211 At when loading [ 211 At]astatate appeared to be similar to that of [ 211 At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211 At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO 3 , but higher capture rates (e.g. 99%) can be obtained when 10M HNO 3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211 At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211 At isolation studies have been conducted with full-scale target dissolution and 211 At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO 3 was used (rather than HCl) for loading the 211 At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211 At separation from bismuth, which allow use of HNO 3 /HCl mixtures for loading and NaOH for eluting 211 At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  3. The potential of 211Astatine for NIS-mediated radionuclide therapy in prostate cancer

    International Nuclear Information System (INIS)

    Willhauck, Michael J.; Sharif Samani, Bibi-Rana; Goeke, Burkhard; Wolf, Ingo; Senekowitsch-Schmidtke, Reingard; Stark, Hans-Juergen; Meyer, Geerd J.; Knapp, Wolfram H.; Morris, John C.; Spitzweg, Christine

    2008-01-01

    We reported recently the induction of selective iodide uptake in prostate cancer cells (LNCaP) by prostate-specific antigen (PSA) promoter-directed sodium iodide symporter (NIS) expression that allowed a significant therapeutic effect of 131 I. In the current study, we studied the potential of the high-energy alpha-emitter 211 At, also transported by NIS, as an alternative radionuclide after NIS gene transfer in tumors with limited therapeutic efficacy of 131 I due to rapid iodide efflux. We investigated uptake and therapeutic efficacy of 211 At in LNCaP cells stably expressing NIS under the control of the PSA promoter (NP-1) in vitro and in vivo. NP-1 cells concentrated 211 At in a perchlorate-sensitive manner, which allowed a dramatic therapeutic effect in vitro. After intrapertoneal injection of 211 At (1 MBq), NP-1 tumors accumulated approximately 16% ID/g 211 At (effective half-life 4.6 h), which resulted in a tumor-absorbed dose of 1,580 ± 345 mGy/MBq and a significant tumor volume reduction of up to 82 ± 19%, while control tumors continued their growth exponentially. A significant therapeutic effect of 211 At has been demonstrated in prostate cancer after PSA promoter-directed NIS gene transfer in vitro and in vivo suggesting a potential role for 211 At as an attractive alternative radioisotope for NIS-targeted radionuclide therapy, in particular in smaller tumors with limited radionuclide retention time. (orig.)

  4. Sci-Thur AM: YIS – 01: New technologies for astatine-211 targeted alpha therapy research

    Energy Technology Data Exchange (ETDEWEB)

    Crawford, Jason; Yang, Hua; Schaffer, Paul; Ruth, Thomas [University of Victoria, Victoria, BC (Canada); TRIUMF, Vancouver, BC (Canada)

    2016-08-15

    Purpose: The short-range, densely ionizing α-particles emitted by {sup 211}At (t{sub 1/2}=7.2h) are well suited for the treatment of diffuse microscopic disease, using cancer targeting biomolecules. {sup 211}At availability is limited by the rarity of α-cyclotrons required for standard production. Image-based dosimetry is also limited for {sup 211}At, which emits low intensity X-rays. Our goal was to leverage state-of-the-art infrastructure at TRIUMF to produce and evaluate two related isotopes, {sup 211}Rn (t{sub 1/2}=14.6h, 73% decay to {sup 211}At) as a generator for {sup 211}At, and {sup 209}At (t{sub 1/2}=5.4h, X-ray/gamma-ray emitter) as a novel 211At surrogate for preclinical imaging studies. Methods: Produced by spallation of uranium with 480 MeV protons, mass separated ion beams of short-lived francium isotopes were implanted into NaCl targets where {sup 211}Rn or {sup 209}At were produced by radioactive decay, in situ. {sup 211}Rn was transferred to dodecane from which {sup 211}At was efficiently extracted and evaluated for clinical applicability. High energy SPECT/CT was evaluated for measuring {sup 209}At activity distributions in mice and phantoms. Results: Our small scale {sup 211}Rn/{sup 211}At generator system provided high purity {sup 211}At samples. The methods are immediately scalable to the level of radioactivity required for in vivo experiments with {sup 211}At. {sup 209}At-based high energy SPECT imaging was determined suitable for pursuing image-based dosimetry in mouse tumour models. In the future, we will utilize quantitative {sup 209}At-SPECT for image-based dose calculations. Conclusion: These early studies provided a foundation for future endeavours with {sup 211}At-based α-therapy. Canada is now significantly closer to clinical targeted α-therapy of cancer.

  5. Targeted radionuclide therapy with astatine-211: Oxidative dehalogenation of astatobenzoate conjugates.

    Science.gov (United States)

    Teze, David; Sergentu, Dumitru-Claudiu; Kalichuk, Valentina; Barbet, Jacques; Deniaud, David; Galland, Nicolas; Maurice, Rémi; Montavon, Gilles

    2017-05-31

    211 At is a most promising radionuclide for targeted alpha therapy. However, its limited availability and poorly known basic chemistry hamper its use. Based on the analogy with iodine, labelling is performed via astatobenzoate conjugates, but in vivo deastatination occurs, particularly when the conjugates are internalized in cells. Actually, the chemical or biological mechanism responsible for deastatination is unknown. In this work, we show that the C-At "organometalloid" bond can be cleaved by oxidative dehalogenation induced by oxidants such as permanganates, peroxides or hydroxyl radicals. Quantum mechanical calculations demonstrate that astatobenzoates are more sensitive to oxidation than iodobenzoates, and the oxidative deastatination rate is estimated to be about 6 × 10 6 faster at 37 °C than the oxidative deiodination one. Therefore, we attribute the "internal" deastatination mechanism to oxidative dehalogenation in biological compartments, in particular lysosomes.

  6. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  7. Use of interhalogen exchange for preparation of astatine-benzene and iodo-benzene

    International Nuclear Information System (INIS)

    Kolachkovski, A.; Khalkin, V.A.

    1976-01-01

    Experimental testing of interhalogen exchange between the solid and liquid phases has been carried out at 155 deg C with particular reference to a NaOH-Na 131 I-BrPh system. Iodine transition rate is dependent on the process duration and alkali amount. The relative amounts of 131 IPh resultant from the reaction of interhalogen exchange is evaluated by paper chromatography. The results obtained may be considered as those which provide experimental support for the assumed efficiency of the production of 131 IPh based on the reaction of interhalogen exchange to yield 70-80% 131 IPh

  8. Preparation and evaluation of an astatine-211-labeled sigma receptor ligand for alpha radionuclide therapy

    International Nuclear Information System (INIS)

    Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira

    2015-01-01

    Introduction: Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated 131 I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[ 131 I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[ 131 I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[ 211 At]pAtV, an 211 At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. Methods: The radiolabeled sigma receptor ligand (+)-[ 211 At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[ 211 At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. Results: The lipophilicity of (+)-[ 211 At]pAtV was similar to that of (+)-[ 125 I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1 h post-injection were also similar between (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV. Namely, (+)-[ 211 At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. Conclusion: These results indicate that (+)-[ 211 At]pAtV could function as an new agent for alpha-radionuclide receptor therapy.

  9. Preparation and evaluation of an astatine-211-labeled sigma receptor ligand for alpha radionuclide therapy.

    Science.gov (United States)

    Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira

    2015-11-01

    Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated (131)I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[(131)I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[(131)I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[(211)At]pAtV, an (211)At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. The radiolabeled sigma receptor ligand (+)-[(211)At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[(211)At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[(211)At]pAtV and (+)-[(125)I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. The lipophilicity of (+)-[(211)At]pAtV was similar to that of (+)-[(125)I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1h post-injection were also similar between (+)-[(211)At]pAtV and (+)-[(125)I]pIV. Namely, (+)-[(211)At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. These results indicate that (+)-[(211)At]pAtV could function as an new agent for alpha-radionuclide receptor therapy. Copyright © 2015 Elsevier Inc. All rights reserved.

  10. Tank characterization report for single-shell tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204

    International Nuclear Information System (INIS)

    Simpson, B.C.

    1998-01-01

    A major function of the Tank Waste Remediation System (TWRS) is to characterize waste in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, in addition to other available information about a tank are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for the single-shell tank series consisting of 241-T-201, -T-202, -T-203, and -T-204. The objectives of this report are: (1) to use characterization data in response to technical issues associated with T-200 series tank waste and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Section 2.0 summarizes the response to technical issues, Section 3.0 shows the best-basis inventory estimate, Section 4.0 makes recommendations about the safety status of the tank and additional sampling needs. The appendices contain supporting data and information. Appendix A contains historical information for 241-T-201 to T-204, including surveillance information, records pertaining to waste transfers and tank operations, and expected tank contents derived from a process knowledge-based computer program. Appendix B summarizes sampling events, sample data obtained before 1989, and the most current sampling results. Appendix C reports the statistical analysis and numerical manipulation of data used in issue resolution. Appendix D contains the evaluation to establish the best-basis for the inventory estimate and the statistical analysis performed for this evaluation. Appendix E is a bibliography that resulted from an in-depth literature search of all known information sources applicable to tanks 241-T-201, -T-202, -T-203, and -T-204. The reports listed in Appendix E are available in the Tank Characterization and Safety Resource Center

  11. ELOVL4 protein preferentially elongates 20:5n3 to very long chain PUFAs over 20:4n6 and 22:6n3[S

    Science.gov (United States)

    Yu, Man; Benham, Aaron; Logan, Sreemathi; Brush, R. Steven; Mandal, Md Nawajes A.; Anderson, Robert E.; Agbaga, Martin-Paul

    2012-01-01

    We hypothesized that reduction/loss of very long chain PUFAs (VLC-PUFAs) due to mutations in the ELOngase of very long chain fatty acid-4 (ELOVL4) protein contributes to retinal degeneration in autosomal dominant Stargardt-like macular dystrophy (STGD3) and age-related macular degeneration; hence, increasing VLC-PUFA in the retina of these patients could provide some therapeutic benefits. Thus, we tested the efficiency of elongation of C20-C22 PUFA by the ELOVL4 protein to determine which substrates are the best precursors for biosynthesis of VLC-PUFA. The ELOVL4 protein was expressed in pheochromocytoma cells, while green fluorescent protein-expressing and nontransduced cells served as controls. The cells were treated with 20:5n3, 22:6n3, and 20:4n6, either individually or in equal combinations. Both transduced and control cells internalized and elongated the supplemented FAs to C22-C26 precursors. Only ELOVL4-expressing cells synthesized C28-C38 VLC-PUFA from these precursors. In general, 20:5n3 was more efficiently elongated to VLC-PUFA in the ELOVL4-expressing cells, regardless of whether it was in combination with 22:6n3 or with 20:4n6. In each FA treatment group, C34 and C36 VLC-PUFAs were the predominant VLC-PUFAs in the ELOVL4-expressing cells. In summary, 20:5n3, followed by 20:4n6, seems to be the best precursor for boosting the synthesis of VLC-PUFA by ELOVL4 protein. PMID:22158834

  12. Corrective Action Investigation Plan for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada (December 2002, Revision No.: 0), Including Record of Technical Change No. 1

    Energy Technology Data Exchange (ETDEWEB)

    NNSA/NSO

    2002-12-12

    The Corrective Action Investigation Plan contains the U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office's approach to collect the data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit (CAU) 204 under the Federal Facility Agreement and Consent Order. Corrective Action Unit 204 is located on the Nevada Test Site approximately 65 miles northwest of Las Vegas, Nevada. This CAU is comprised of six Corrective Action Sites (CASs) which include: 01-34-01, Underground Instrument House Bunker; 02-34-01, Instrument Bunker; 03-34-01, Underground Bunker; 05-18-02, Chemical Explosives Storage; 05-33-01, Kay Blockhouse; 05-99-02, Explosive Storage Bunker. Based on site history, process knowledge, and previous field efforts, contaminants of potential concern for Corrective Action Unit 204 collectively include radionuclides, beryllium, high explosives, lead, polychlorinated biphenyls, total petroleum hydrocarbons, silver, warfarin, and zinc phosphide. The primary question for the investigation is: ''Are existing data sufficient to evaluate appropriate corrective actions?'' To address this question, resolution of two decision statements is required. Decision I is to ''Define the nature of contamination'' by identifying any contamination above preliminary action levels (PALs); Decision II is to ''Determine the extent of contamination identified above PALs. If PALs are not exceeded, the investigation is completed. If PALs are exceeded, then Decision II must be resolved. In addition, data will be obtained to support waste management decisions. Field activities will include radiological land area surveys, geophysical surveys to identify any subsurface metallic and nonmetallic debris, field screening for applicable contaminants of potential concern, collection and analysis of surface and subsurface soil samples from biased locations

  13. Measurement of the radiative capture cross section of the s-process branching points 204Tl and 171Tm at the n_TOF facility (CERN)

    Science.gov (United States)

    Casanovas, A.; Domingo-Pardo, C.; Guerrero, C.; Lerendegui-Marco, J.; Calviño, F.; Tarifeño-Saldivia, A.; Dressler, R.; Heinitz, S.; Kivel, N.; Quesada, J. M.; Schumann, D.; Aberle, O.; Alcayne, V.; Andrzejewski, J.; Audouin, L.; Bécares, V.; Bacak, M.; Barbagallo, M.; Bečvář, F.; Bellia, G.; Berthoumieux, E.; Billowes, J.; Bosnar, D.; Brown, A.; Busso, M.; Caamaño, M.; Caballero-Ontanaya, L.; Calviani, M.; Cano-Ott, D.; Cerutti, F.; Chen, Y. H.; Chiaveri, E.; Colonna, N.; Cortés, G.; Cortés-Giraldo, M. A.; Cosentino, L.; Cristallo, S.; Damone, L. A.; Diakaki, M.; Dietz, M.; Dupont, E.; Durán, I.; Eleme, Z.; Fernández-Domínguez, B.; Ferrari, A.; Ferreira, P.; Finocchiaro, P.; Furman, V.; Göbel, K.; Gawlik, A.; Gilardoni, S.; Glodariu, T.; Gonçalves, I. F.; González-Romero, E.; Gunsing, F.; Heyse, J.; Jenkins, D. G.; Käppeler, F.; Kadi, Y.; Katabuchi, T.; Kimura, A.; Kokkoris, M.; Kopatch, Y.; Krtička, M.; Kurtulgil, D.; Ladarescu, I.; Lederer-Woods, C.; Meo, S. Lo; Lonsdale, S. J.; Macina, D.; Martínez, T.; Masi, A.; Massimi, C.; Mastinu, P.; Mastromarco, M.; Matteucci, F.; Maugeri, E. A.; Mazzone, A.; Mendoza, E.; Mengoni, A.; Michalopoulou, V.; Milazzo, P. M.; Mingrone, F.; Musumarra, A.; Negret, A.; Nolte, R.; Ogállar, F.; Oprea, A.; Patronis, N.; Pavlik, A.; Perkowski, J.; Persanti, L.; Porras, I.; Praena, J.; Radeck, D.; Ramos, D.; Rauscher, T.; Reifarth, R.; Rochman, D.; Sabaté-Gilarte, M.; Saxena, A.; Schillebeeckx, P.; Simone, S.; Smith, A. G.; Sosnin, N. V.; Stamatopoulos, A.; Tagliente, G.; Tain, J. L.; Talip, T.; Tassan-Got, L.; Tsinganis, A.; Ulrich, J.; Valenta, S.; Vannini, G.; Variale, V.; Vaz, P.; Ventura, A.; Vlachoudis, V.; Vlastou, R.; Wallner, A.; Woods, P. J.; Wright, T.; Žugec, P.; Köster, U.

    2018-05-01

    The neutron capture cross section of some unstable nuclei is especially relevant for s-process nucleosynthesis studies. This magnitude is crucial to determine the local abundance pattern, which can yield valuable information of the s-process stellar environment. In this work we describe the neutron capture (n,γ) measurement on two of these nuclei of interest, 204Tl and 171Tm, from target production to the final measurement, performed successfully at the n_TOF facility at CERN in 2014 and 2015. Preliminary results on the ongoing experimental data analysis will also be shown. These results include the first ever experimental observation of capture resonances for these two nuclei.

  14. Molecular modeling of human MT2 melatonin receptor: the role of Val204, Leu272 and Tyr298 in ligand binding

    Czech Academy of Sciences Publication Activity Database

    Mazna, Petr; Obšilová, Veronika; Jelínková, Irena; Balík, Aleš; Berka, K.; Sovová, Žofie; Ettrich, Rüdiger; Svoboda, Petr; Obšil, T.; Teisinger, Jan

    2004-01-01

    Roč. 91, č. 4 (2004), s. 836-842 ISSN 0022-3042 R&D Projects: GA ČR GA309/02/1479; GA ČR GA309/04/0496; GA ČR GA204/03/0714; GA AV ČR IAA5011103; GA AV ČR IAA5011408; GA AV ČR KJB5011308; GA MŠk LN00A141 Institutional research plan: CEZ:AV0Z5011922; CEZ:MSM 113100001 Keywords : homology modeling * MT2 melatonin receptor * site-directed mutagenesis Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 4.824, year: 2004

  15. Excitation of the high-spin isomers 180m Hf, 190m Os and 204m Pb in (γ, γ') reactions

    International Nuclear Information System (INIS)

    Balabanov, N.P.; Belov, A.G.; Gangrskij, Yu.P.; Kondev, F.G.; Tonchev, A.P.

    1993-01-01

    Excitation of isomeric states of 180 Hf (J m π = 8 - ), 190 Os (J m π = 10 - ) and 204 Pb (J m π = 9 - ) is studied for (γ, γ') reactions. The cross sections and isomeric ratios are measured using activation technique in the energy region from 6 up to 15 MeV. Experimental results were compared with statistical theory predictions. A relative contribution of different γ-ray multipolarities into the process of the population of isomeric states excited in the photoabsorption reaction and γ-cascade is investigated. (author). 32 refs.; 4 figs.; 2 tabs

  16. Testing the mutually enhanced magicity effect in nuclear incompressibility via the giant monopole resonance in the {sup 204,206,208}Pb isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Patel, D. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Garg, U., E-mail: garg@nd.edu [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Fujiwara, M. [Research Center for Nuclear Physics, Osaka University, Osaka 567-0047 (Japan); Adachi, T. [Kernfysisch Versneller Instituut, University of Groningen, 9747 AA Groningen (Netherlands); Akimune, H. [Department of Physics, Konan University, Kobe 568-8501 (Japan); Berg, G.P.A. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Harakeh, M.N. [Kernfysisch Versneller Instituut, University of Groningen, 9747 AA Groningen (Netherlands); GANIL, CEA/DSM-CNRS/IN2P3, 14076 Cean (France); Itoh, M. [Cyclotron and Radioisotope Center, Tohoku University, Sendai 980-8578 (Japan); Iwamoto, C. [Department of Physics, Konan University, Kobe 568-8501 (Japan); Long, A.; Matta, J.T. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Murakami, T. [Division of Physics and Astronomy, Kyoto University, Kyoto 606-8502 (Japan); Okamoto, A. [Department of Physics, Konan University, Kobe 568-8501 (Japan); Sault, K. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Talwar, R. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Uchida, M. [Department of Physics, Tokyo Institute of Technology, Tokyo 152-8850 (Japan); and others

    2013-10-07

    Using inelastic α-scattering at extremely forward angles, including 0°, the strength distributions of the isoscalar giant monopole resonance (ISGMR) have been measured in the {sup 204,206,208}Pb isotopes in order to examine the proposed mutually enhanced magicity (MEM) effect on the nuclear incompressibility. The MEM effect had been suggested as a likely explanation of the “softness” of nuclear incompressibility observed in the ISGMR measurements in the Sn and Cd isotopes. Our experimental results rule out any manifestation of the MEM effect in nuclear incompressibility and leave the question of the softness of the open-shell nuclei unresolved still.

  17. Pahute Mesa Well Development and Testing Analyses for Wells ER-20-8 and ER-20-4, Nevada National Security Site, Nye County, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Greg Ruskauff and Sam Marutzky

    2012-09-01

    Wells ER-20-4 and ER-20-8 were drilled during fiscal year (FY) 2009 and FY 2010 (NNSA/NSO, 2011a and b). The closest underground nuclear test detonations to the area of investigation are TYBO (U-20y), BELMONT (U-20as), MOLBO (U-20ag), BENHAM (U-20c), and HOYA (U-20 be) (Figure 1-1). The TYBO, MOLBO, and BENHAM detonations had working points located below the regional water table. The BELMONT and HOYA detonation working points were located just above the water table, and the cavity for these detonations are calculated to extend below the water table (Pawloski et al., 2002). The broad purpose of Wells ER-20-4 and ER-20-8 is to determine the extent of radionuclide-contaminated groundwater, the geologic formations, groundwater geochemistry as an indicator of age and origin, and the water-bearing properties and hydraulic conditions that influence radionuclide migration. Well development and testing is performed to determine the hydraulic properties at the well and between other wells, and to obtain groundwater samples at the well that are representative of the formation at the well. The area location, wells, underground nuclear detonations, and other features are shown in Figure 1-1. Hydrostratigraphic cross sections A-A’, B-B’, C-C’, and D-D’ are shown in Figures 1-2 through 1-5, respectively.

  18. Tank Vapor Characterization Project: Headspace vapor characterization of Hanford Waste Tank 241-C-204: Results from samples collected on 07/02/96

    International Nuclear Information System (INIS)

    Thomas, B.L.; Evans, J.C.; Pool, K.H.

    1997-01-01

    This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-C-204 (Tank C-204) at the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank farm operations. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNNL). Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Analyte concentrations were based on analytical results and, where appropriate, sample volumes provided by WHC. A summary of the inorganic analytes, permanent gases, and total non-methane organic compounds is listed in Table S.1. The three highest concentration analytes detected in SUMMA trademark canister and triple sorbent trap samples are also listed in Table S.1. Detailed descriptions of the analytical results appear in the appendices

  19. Transcriptome Profiling of Neovascularized Corneas Reveals miR-204 as a Multi-target Biotherapy Deliverable by rAAVs

    Directory of Open Access Journals (Sweden)

    Yi Lu

    2018-03-01

    Full Text Available Corneal neovascularization (NV is the major sight-threatening pathology caused by angiogenic stimuli. Current drugs that directly target pro-angiogenic factors to inhibit or reverse the disease require multiple rounds of administration and have limited efficacies. Here, we identify potential anti-angiogenic corneal microRNAs (miRNAs and demonstrate a framework that employs discovered miRNAs as biotherapies deliverable by recombinant adeno-associated viruses (rAAVs. By querying differentially expressed miRNAs in neovascularized mouse corneas induced by alkali burn, we have revealed 39 miRNAs that are predicted to target more than 5,500 differentially expressed corneal mRNAs. Among these, we selected miR-204 and assessed its efficacy and therapeutic benefit for treating injured corneas. Our results show that delivery of miR-204 by rAAV normalizes multiple novel target genes and biological pathways to attenuate vascularization of injured mouse cornea. Importantly, this gene therapy treatment alternative is efficacious and safe for mitigating corneal NV. Overall, our work demonstrates the discovery of potential therapeutic miRNAs in corneal disorders and their translation into viable treatment alternatives.

  20. Calculations and Evaluations of Cross Sections for n + 204,206,207,208,natPb Reactions in the En ≤ 250 MeV Energy Range

    International Nuclear Information System (INIS)

    Han Yinlu; Shen Qingbiao; Zhang Zhengjun; Cai Chonghai

    2005-01-01

    The quality and reliability of the computational simulation of a macroscopic nuclear device are directly related to the quality of the underlying basic nuclear data. To meet these needs, according to advanced nuclear models that account for details of nuclear structure and the quantum nature of nuclear reaction and the experimental data of total, nonelastic, and elastic scattering cross sections, and elastic scattering angular distributions of Pb and its isotopes, all cross sections of neutron-induced reaction, angular distributions, energy spectra, especially the double-differential cross sections for neutron, proton, deuteron, triton, helium, and alpha emissions are calculated and analyzed for n + 204,206,207,208,nat Pb at incident neutron energies below 20 MeV by using the UNF nuclear model code. At neutron incident energies 20 n ≤ 250 MeV, MEND codes are used. Theoretical calculations are compared with existing experimental data and other evaluated data from ENDF/B-VI and JENDL-3

  1. Yellow fever vaccine: comparison of the neurovirulence of new 17D-204 Stamaril™ seed lots and RK 168-73 strain.

    Science.gov (United States)

    Moulin, Jean-Claude; Silvano, Jérémy; Barban, Véronique; Riou, Patrice; Allain, Caroline

    2013-07-01

    The neurovirulence of two new candidate 17D-204 Stamaril™ working seed lots and that of two reference preparations were compared. The Stamaril™ working seed lots have been used for more than twenty years for the manufacturing of vaccines of acceptable safety and efficacy. The preparation designated RK 168-73 and provided by the Robert Koch Institute was used as a reference. It was confirmed that RK 168-73 strain was not a good virus control in our study because it has a very low neurovirulence regarding both the clinical and histopathological scores in comparison with Stamaril™ strain and is not representative of a vaccine known to be satisfactory in use. The results were reinforced by the phenotypic characterization by plaque assay demonstrating that RK 168-73 was very different from the Stamaril™ vaccine, and by sequencing results showing 4 mutations between Stamaril™ and RK 168-73 viruses leading to amino acid differences in the NS4B and envelop proteins. Copyright © 2013 The International Alliance for Biological Standardization. Published by Elsevier Ltd. All rights reserved.

  2. $^{204m}$Pb: A new Probe for TDPAC Experiments in Biology Complementing the Well Established Probes $^{111}$Cd and $^{199m}$Hg

    CERN Multimedia

    2002-01-01

    The short-lived nuclear probes $\\,^{111m}$Cd( t$_{1/2}$ = 49 min) , $^{199m}$Hg ( t$_{1/2}$ = 43 min) , and $^{204m}$Pb( t$_{1/2}$ = 43 min) supplied by ISOLDE are used to study the interaction of metals with biological macromolecules like, e.g., DNA and proteins. The structure and dynamics of metal sites in biomolecules are important in determining the functional efficiency of these macromolecules. Many life processes are based on such interactions. In order to study those metal sites close to physiological conditions a highly sensitive spectroscopic method is required, like Time Differential Perturbed Angular Correlation (TDPAC). Here, a radioactive atom is placed at the site of interest and by correlating the emitted $\\gamma$-quanta in space and on a nanosecond time scale local structural information is provided via the Nuclear Quadrupole Interaction. These investigations will allow a deeper insight into the adaptivity and rigidity of metal sites in the blue copper proteins (electron transfer proteins), th...

  3. Imprints of climate signals in a 204 year 18O tree-ring record of Nothofagus pumilio from Perito Moreno Glacier, southern Patagonia (50°S).

    Science.gov (United States)

    Grießinger, Jussi; Langhamer, Lukas; Schneider, Christoph; Saß, Björn-Lukas; Steger, David; Skvarca, Pedro; Braun, Matthias H.; Meier, Wolfgang J.-H.; Srur, Ana M.; Hochreuther, Philipp

    2018-04-01

    A 204 year-long record of 18O in tree-ring cellulose of southern beech (Nothofagus pumilio) from a site near Perito Moreno Glacier (50°S) in southern Patagonia was established to assess its potential for a climate reconstruction. The annually resolved oxygen isotope chronology is built out of seven individual tree-ring 18O series with a significant mean inter-series correlation (r = 0.61) and is the first of its kind located in Southern America south of 50°S. Over a common period from 1960 to 2013 of available stationary and high-resolution gridded CRU TS v. 4.01 data, the 18O chronology exhibits a strong sensitivity towards hydroclimatic as well as temperature parameters as revealed by correlation analyses. Among these, positive correlations with maximum temperature in the first part of the summer season (CRU rONDJ = 0.51, pAmerica. The modulation of positive and negative anomalies within this series can be interlinked to changes in moisture source origin as revealed by backward trajectory modeling. Additionally, these anomalies can be directly associated to positive or negative phases of the Antarctic Oscillation Index (AAOI) and therefore the strength of the Westerlies. Aligned by the analysis on the influence of different main weather types on the 18O chronology it is shown that such time-series hold the potential to additionally capture their respective influence and change during the last centuries.

  4. [Hospital infection in the maternity department. 3 years of surveillance in 9,204 deliveries of which 1,333 were cesarean sections].

    Science.gov (United States)

    Tissot-Guerraz, F; Moussy, L; Agniel, F; André, A; Reverdy, M E; Miellet, C C; Audra, P; Putet, G; Sepetjan, M; Dargent, D

    1990-01-01

    Hospital or nosocomial infection, or infection acquired in hospitals, is a health problem in all hospital departments and particularly in the maternity department. We report on a prospective survey of surveillance of hospital-acquired infections both from the mother and the baby's point of view after delivery vaginally or with caesarean carried out at the obstetrical clinic of the Edouard Herriot Hospital in Lyon (France) over three successive years with a series of 9,204 deliveries. The incidence of infection in women who were delivered without caesarean section was 1.37% when urinary tract infections had been excluded but 13% in women who had caesarean sections. Endometritis, skin infections and urinary tract infections were the leading causes. As far as the newborn were concerned, hospital infection ran at about 2.60% and this in the main was due to staphylococcal pustules in the skin. These figures are still too high and prevention should be based on more information given and more care taken by the whole staff of such a hospital.

  5. Depth profile of production yields of {sup nat}Pb(p, xn) {sup 206,205,204,203,202,201}Bi nuclear reactions

    Energy Technology Data Exchange (ETDEWEB)

    Mokhtari Oranj, Leila [Division of Advanced Nuclear Engineering, POSTECH, Pohang 37673 (Korea, Republic of); Jung, Nam-Suk; Kim, Dong-Hyun; Lee, Arim; Bae, Oryun [Pohang Accelerator Laboratory, POSTECH, Pohang 37673 (Korea, Republic of); Lee, Hee-Seock, E-mail: lee@postech.ac.kr [Pohang Accelerator Laboratory, POSTECH, Pohang 37673 (Korea, Republic of)

    2016-11-01

    Experimental and simulation studies on the depth profiles of production yields of {sup nat}Pb(p, xn) {sup 206,205,204,203,202,201}Bi nuclear reactions were carried out. Irradiation experiments were performed at the high-intensity proton linac facility (KOMAC) in Korea. The targets, irradiated by 100-MeV protons, were arranged in a stack consisting of natural Pb, Al, Au foils and Pb plates. The proton beam intensity was determined by activation analysis method using {sup 27}Al(p, 3p1n){sup 24}Na, {sup 197}Au(p, p1n){sup 196}Au, and {sup 197}Au(p, p3n){sup 194}Au monitor reactions and also by Gafchromic film dosimetry method. The yields of produced radio-nuclei in the {sup nat}Pb activation foils and monitor foils were measured by HPGe spectroscopy system. Monte Carlo simulations were performed by FLUKA, PHITS/DCHAIN-SP, and MCNPX/FISPACT codes and the calculated data were compared with the experimental results. A satisfactory agreement was observed between the present experimental data and the simulations.

  6. Depth profiles of production yields of natPb(p, xn206,205,204,203,202 Bi reactions using 100-MeV proton beam

    Directory of Open Access Journals (Sweden)

    Oranj Leila Mokhtari

    2017-01-01

    Full Text Available In this study, results of the experimental study on the depth profiles of production yields of 206,205,204,203,202Bi radio-nuclei in the natural Pb target irradiated by a 100-MeV proton beam are presented. Irradiation was performed at proton linac facility (KOMAC in Korea. The target, irradiated by 100-MeV protons, was arranged in a stack consisting of natural Pb, Al, Au foils and Pb plates. The proton beam intensity was determined by activation analysis method using 27Al(p, 3p1n24Na, 197Au(p, p1n196Au, and 197Au(p, p3n194Au monitor reactions and also using dosimetry method by a Gafchromic film. The production yields of produced Bi radio-nuclei in the natural Pb foils and monitor reactions were measured by gamma-ray spectroscopy. Monte Carlo simulations were performed by FLUKA, PHITS, and MCNPX codes and compared with the measurements in order to verify validity of physical models and nuclear data libraries in the Monte Carlo codes. A fairly good agreement was observed between the present experimental data and the simulations by FLUKA, PHITS, and MCNPX. However, physical models and the nuclear data relevant to the end of range of protons in the codes need to be improved.

  7. Gravity wave generation and propagation during geomagnetic storms over Kiruna (67.8°N, 20.4°E

    Directory of Open Access Journals (Sweden)

    P. R. Fagundes

    1995-04-01

    Full Text Available Atmospheric gravity waves, detected over Kiruna (67.8°N, 20.4°E during geomagnetic storms, are presented and analysed. The data include direct measurements of the OI 630.0 nm emission line intensity, the x-component of the local geomagnetic field and thermospheric (meridional and zonal wind velocities derived from the OI 630.0 nm Doppler shift observed with an imaging Fabry-Perot interferometer (IFPI. A low pass band filter technique was used to determine short-period variations in the thermospheric meridional wind velocities observed during geomagnetic storms. These short-period variations in the meridional wind velocities, which are identified as due to gravity waves, are compared to the corresponding variations observed in the OI 630.0 nm emission line intensity, x-component of the local geomagnetic field and the location of the auroral electrojet. A cross-correlation analysis was used to calculate the propagation velocities of the observed gravity waves.

  8. Neutron scattering cross sections for 204,206Pb and neutron and proton amplitudes of E2 and E3 excitations

    International Nuclear Information System (INIS)

    Hicks, S.F.; Hanly, J.M.; Hicks, S.E.; Shen, G.R.; McEllistrem, M.T.

    1994-01-01

    Differential elastic and inelastic scattering cross sections have been measured for neutrons incident on 204 Pb and 206 Pb at energies of 2.5, 4.6, and 8.0 MeV and total cross sections in 100-keV steps from 250 keV to 4.0 MeV. Both spherical and coupled-channels analyses have been used to interpret this large set of data, together with other cross sections extending to 8 MeV. Several purposes motivate this work. The first is to establish the dispersion-corrected mean field appropriate for these nuclei. A consistent description of the energy dependent neutron scattering potential includes a dispersion relation connecting the real and imaginary parts of the potential; the resultant potential relates the energy dependent scattering field to one representing bound single particle levels. Dispersion relations using both the single channel and coupled-channels models have been examined; both give very similar results. The second motivation is to deduce neutron and proton excitation strengths of the lowest-energy quadrupole and octupole excitations seen via neutron scattering, and to compare those strengths with similar values derived from electromagnetic exciton, heavy-ion and pion scattering. The role of target neutrons in both collective excitations was found to be enhanced compared to the proton role

  9. Relationship between open-circuit voltage in Cu(In,Ga)Se{sub 2} solar cell and peak position of (220/204) preferred orientation near its absorber surface

    Energy Technology Data Exchange (ETDEWEB)

    Chantana, J., E-mail: jakapan@fc.ritsumei.ac.jp; Minemoto, T. [Department of Electrical and Electronic Engineering, Ritsumeikan University, 1-1-1 Nojihigashi, Kusatsu, Shiga 525-8577 (Japan); Watanabe, T.; Teraji, S.; Kawamura, K. [Environment and Energy Research Center, Nitto Denko Corporation, 2-8 Yamadaoka, Suita, Osaka 565-0871 (Japan)

    2013-11-25

    Cu(In,Ga)Se{sub 2} (CIGS) absorbers with various Ga/III, Ga/(In+Ga), profiles are prepared by the so-called “multi-layer precursor method” using multi-layer co-evaporation of material sources. It is revealed that open-circuit voltage (V{sub OC}) of CIGS solar cell is primarily dependent on averaged Ga/III near the surface of its absorber. This averaged Ga/III is well predicted by peak position of (220/204) preferred orientation of CIGS film near its surface investigated by glancing-incidence X-ray diffraction with 0.1° incident angle. Finally, the peak position of (220/204) preferred orientation is proposed as a measure of V{sub OC} before solar cell fabrication.

  10. In vivo detection of somatostatin receptors in patients with functionless pituitary adenomas by means of a radioiodinated analog of somatostatin ((123I)SDZ 204-090)

    Energy Technology Data Exchange (ETDEWEB)

    Faglia, G.; Bazzoni, N.; Spada, A.; Arosio, M.; Ambrosi, B.; Spinelli, F.; Sara, R.; Bonino, C.; Lunghi, F. (Institute of Endocrine Sciences, University of Milan, Ospedale Maggiore IRCCS (Italy))

    1991-10-01

    The recent availability of a Tyr3-substituted octreotide (SDZ 204-090) for radioiodination has allowed somatostatin (SRIH) receptor binding to be studied in vivo, and receptor-positive tumors of different origins to be visualized with a gamma-camera. This prompted us to investigate whether this compound could be used for external imaging of functionless pituitary adenomas displaying SRIH receptors. Eight patients with functionless pituitary adenomas, three patients with acromegaly, and three with macroprolactinoma were injected iv with 123I-labeled Tyr3-octreotide and then scanned with a gamma-camera. Positive scans were obtained in the three acromegalics and in two of the eight patients with functionless pituitary tumors. The patients with macroprolactinoma had negative scans. The diagnosis of functionless pituitary adenomas was confirmed by light and electron microscopic examination as well as immunocytochemical studies. In vitro binding of (125I)Tyr11-SRIH to cell membranes was evaluated in four functionless and three GH-secreting adenomas removed from seven of the patients. All of the GH-secreting as well as one of the four functionless adenomas had high affinity SRIH-binding sites, without differences in number or affinity, whereas SRIH-binding sites were not detected in the others. Positive scans were observed only in patients bearing tumors with high affinity SRIH-binding sites. In conclusion, (123I)Tyr3-octreotide appears to be a promising tool for singling out, in vivo, patients with functionless pituitary tumors displaying SRIH receptors who might potentially benefit from octreotide treatment.

  11. Imprints of Climate Signals in a 204 Year δ18O Tree-Ring Record of Nothofagus pumilio From Perito Moreno Glacier, Southern Patagonia (50°S

    Directory of Open Access Journals (Sweden)

    Jussi Grießinger

    2018-04-01

    Full Text Available A 204 year-long record of δ18O in tree-ring cellulose of southern beech (Nothofagus pumilio from a site near Perito Moreno Glacier (50°S in Southern Patagonia was established to assess its potential for a climate reconstruction. The annually resolved oxygen isotope chronology is built out of seven individual tree-ring δ18O series with a significant mean inter-series correlation (r = 0.61 and is the first of its kind located in Southern America south of 50°S. Over a common period from 1960 to 2013 of available stationary and high-resolution gridded CRU TS v. 4.01 data, the δ18O chronology exhibits a strong sensitivity toward hydroclimatic as well as temperature parameters as revealed by correlation analyses. Among these, positive correlations with maximum temperature in the first part of the summer season (CRU rONDJ = 0.51, p < 0.01 and negative correlations with precipitation in the latter half of the vegetation period (CRU rONDJ = −0.54, p < 0.01 show the highest sensitivities. A strong supra-regional influence of the Southern Annular Mode (SAM is clearly recorded in this chronology as indicated by significant positive correlations during the vegetation period (rONDJ = 0.62, p < 0.01. This indicates that the presented δ18O-chronology shows great promise to reconstruct the influence and variability of the SAM within the last two centuries in southern South America. The modulation of positive and negative anomalies within this series can be interlinked to changes in moisture source origin as revealed by backward trajectory modeling. Additionally, these anomalies can be directly associated to positive or negative phases of the Antarctic Oscillation Index (AAOI and therefore the strength of the Westerlies. Aligned by the analysis on the influence of different main weather types on the δ18O chronology it is shown that such time-series hold the potential to additionally capture their respective influence and change during the last centuries.

  12. 211 At-labeled agents for alpha-immunotherapy: On the in vivo stability of astatine-agent bonds

    OpenAIRE

    Ayed , Tahra ,; Pilmé , Julien; Tézé , David; Bassal , Fadel ,; Barbet , Jacques ,; Chérel , Michel; Champion , Julie ,; Maurice , Rémi; Montavon , Gilles ,; Galland , Nicolas ,

    2016-01-01

    International audience; The application of 211 At to targeted cancer therapy is currently hindered by the rapid deastatination that occurs in vivo. As the deastatination mechanism is unknown, we tackled this issue from the viewpoint of the intrinsic properties of At-involving chemical bonds. An apparent correlation has been evidenced between in vivo stability of 211 At-labeled compounds and the AtÀR (R ¼ C, B) bond enthalpies obtained from relativistic quantum mechanical calculations. Further...

  13. Preparation and biological evaluation of an astatine-211 labeled biotin conjugate: Biotinyl-3-[211At]astatoanilide

    International Nuclear Information System (INIS)

    Foulon, Catherine F.; Schoultz, Bent W.; Zalutsky, Michael R.

    1997-01-01

    Biotinyl-3-[ 211 At]astatoanilide ([ 211 At]AtBA) was prepared in more than 80% yield by destannylation. In vitro, [ 211 At]AtBA exhibited a high affinity for streptavidin, and was stable after incubation in human serum, cerebrospinal fluid and distilled water, whereas it was rapidly degraded in mouse serum. HPLC analysis showed that the main degradation pathway in mouse serum was the cleavage of [ 211 At]astatoaniline. In mice, [ 211 At]AtBA and its 125 I-labeled analogue cleared rapidly from most tissues; however, there was some evidence for dehalogenation of both tracers

  14. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  15. Pb(II) and Hg(II) binding to $\\textit{de novo}$ designed proteins studied by $^{204m}$Pb- and $^{199m}$Hg-Perturbed Angular Correlation of $\\gamma$-rays (PAC) spectroscopy : Clues to heavy metal toxicity

    CERN Multimedia

    2002-01-01

    $\\textit{De novo}$ design of proteins combined with PAC spectroscopy offers a unique and powerful approach to the study of fundamental chemistry of heavy metal-protein interactions, and thus of the mechanisms underlying heavy metal toxicity. In this project we focus on Pb(II) and Hg(II) binding to designed three stranded coiled coil proteins with one or two binding sites, mimicking a variety of naturally occurring thiolate-rich metal ion binding sites in proteins. The $^{204m}$Pb- and $^{199m}$Hg-PAC experiments will complement data already recorded with EXAFS, NMR, UV-Vis and CD spectroscopies.

  16. High-titer lactic acid production from NaOH-pretreated corn stover by Bacillus coagulans LA204 using fed-batch simultaneous saccharification and fermentation under non-sterile condition.

    Science.gov (United States)

    Hu, Jinlong; Zhang, Zhenting; Lin, Yanxu; Zhao, Shumiao; Mei, Yuxia; Liang, Yunxiang; Peng, Nan

    2015-04-01

    Lactic acid (LA) is an important chemical with various industrial applications. Non-food feedstock is commercially attractive for use in LA production; however, efficient LA fermentation from lignocellulosic biomass resulting in both high yield and titer faces technical obstacles. In this study, the thermophilic bacterium Bacillus coagulans LA204 demonstrated considerable ability to ferment glucose, xylose, and cellobiose to LA. Importantly, LA204 produces LA from several NaOH-pretreated agro stovers, with remarkably high yields through simultaneous saccharification and fermentation (SSF). A fed-batch SSF process conducted at 50°C and pH 6.0, using a cellulase concentration of 30 FPU (filter paper unit)/g stover and 10 g/L yeast extract in a 5-L bioreactor, was developed to produce LA from 14.4% (w/w) NaOH-pretreated non-sterile corn stover. LA titer, yield, and average productivity reached 97.59 g/L, 0.68 g/g stover, and 1.63 g/L/h, respectively. This study presents a feasible process for lignocellulosic LA production from abundant agro stovers. Copyright © 2015 Elsevier Ltd. All rights reserved.

  17. Dynamic Equilibrium of Cardiac Troponin C's Hydrophobic Cleft and Its Modulation by Ca2+ Sensitizers and a Ca2+ Sensitivity Blunting Phosphomimic, cTnT(T204E).

    Science.gov (United States)

    Schlecht, William; Dong, Wen-Ji

    2017-10-18

    Several studies have suggested that conformational dynamics are important in the regulation of thin filament activation in cardiac troponin C (cTnC); however, little direct evidence has been offered to support these claims. In this study, a dye homodimerization approach is developed and implemented that allows the determination of the dynamic equilibrium between open and closed conformations in cTnC's hydrophobic cleft. Modulation of this equilibrium by Ca 2+ , cardiac troponin I (cTnI), cardiac troponin T (cTnT), Ca 2+ -sensitizers, and a Ca 2+ -desensitizing phosphomimic of cTnT (cTnT(T204E) is characterized. Isolated cTnC contained a small open conformation population in the absence of Ca 2+ that increased significantly upon the addition of saturating levels of Ca 2+ . This suggests that the Ca 2+ -induced activation of thin filament arises from an increase in the probability of hydrophobic cleft opening. The inclusion of cTnI increased the population of open cTnC, and the inclusion of cTnT had the opposite effect. Samples containing Ca 2+ -desensitizing cTnT(T204E) showed a slight but insignificant decrease in open conformation probability compared to samples with cardiac troponin T, wild type [cTnT(wt)], while Ca 2+ sensitizer treated samples generally increased open conformation probability. These findings show that an equilibrium between the open and closed conformations of cTnC's hydrophobic cleft play a significant role in tuning the Ca 2+ sensitivity of the heart.

  18. Irradiation performance and post-irradiation examinations of the instrumented sphere-pac UO2 assembly IFA-204, irradiated up to 1.7% FIMA in the Halden Boiling Water Reactor

    International Nuclear Information System (INIS)

    Linde, A. van der.

    1982-12-01

    Fuel assembly IFA-204 consisted of four pins filled with a blend of three sizes of UO 2 spheres. This blend was compacted in the zircaloy-4 cladding tube by vibration to achieve a 87-88% T.D. smear density of the 1500 mm long sphere-pac fuel column. IFA-204 was irradiated during 597 days, equivalent to 436 full power days, in the Halden BWR from November 1971 to April 1974 when the achieved assembly average burnup amounted to 13.7 MWd/kg UO 2 . Two of the four pins were equipped with fuel column length and pin length extensometers. The measurements showed that at average pin powers less than about 25 kW.m -1 only fuel-clad-thermal-interaction, FCTI, occurred. The clad thermal expansion coefficient was 4.8 ppm/kW.m -1 . For calculations of the irradiation behaviour of sphere-pac LWR pins, filled with 0.1 MPa helium, with the Gapcon-Thermal-2 code a new thermal conductivity-temperature relationship has been developed. The calculated data agreed reasonably well with the measured data when taking into account a restructured fuel density of 90% T.D., a fuel surface roughness of 1 μm, the absence of a fuel-cladding gap and an effective full power fuel restructuring time of 40 days. It is concluded that the porous structure of the sphere-pac fuel column, whether restructured or not, has the inherent disadvantage of a high mobility of gaseous fission products and the inherent advantage of a practically stress free operation of the cladding

  19. Automatización del laboratorio de ingeniería electrónica G-204 de la ECI a través de una red inmótica

    Directory of Open Access Journals (Sweden)

    Hernán Paz Penagos

    2006-09-01

    Full Text Available El aumento de usuarios (estudiantes y profesores de los laboratorios de ingeniería electrónica de la Escuela Colombiana de Ingeniería JULIO GARAVITO en el último año ha congestionado el acceso a dichos laboratorios, razón por la cual el Centro de Estudios de Electrónica Aplicada, Grupo de Investigación “Ecitrónica8 del programa de ingeniería electrónica de la escuela, propuso, diseñó y desarrolló un proyecto de investigación que aprovecha el tendido de distribución eléctrica del edificio G para ofrecer facilidades de acceso, control de equipos de laboratorio, ahorro de energía y mejoramiento de la calidad de servicio. El sistema de la red inmótica para el laboratorio G-204 estará constituida con los siguientes subsistemas: a. Un control de acceso con una arquitectura cliente - servidor; en este último reposa una base de datos de los usuarios, horarios, equipos y mesas de trabajo; el usuario se conecta desde cualquier computador (cliente al servidor a través de Internet para separar el turno de su práctica de laboratorio; en esa operación selecciona el horario, los equipos, la mesa, el tipo de red que requiere (monofásica o trifásica y registra a sus compañeros de trabajo. El acceso al laboratorio G-204, en el día y la hora de su práctica, se realiza mediante un lector de tarjetas inteligentes. b. Control de información de un aviso publicitario y de un reloj electrónico: desde el servidor se genera y controla el envió de información de interés a un aviso publicitario conformado por tres pantallas LCD ubicadas en una de las paredes del segundo piso del edificio G; así mismo, se actualiza continuamente la hora y se informa sobre la temperatura del laboratorio G-204. c. Habilitación o deshabilitación de los bancos de trabajo: mediante un control on-off, con mando desde el servidor, se energizan (al inicio de la práctica o desenergizan (al final de la práctica o ante eventualidades los bancos de trabajo para

  20. Tracking atmospheric sulphur pollution from the study of Racomitrium lanuginosum mosses in Iceland: A multi-isotope approach (δ34S, 206Pb/204Pb, δ13C and δ15N)

    Science.gov (United States)

    Proust, E.; Widory, D.; Gautason, B.; Rogers, K.; Morrison, J.

    2010-12-01

    Among terrestrial plants, the applicability of mosses as monitoring organisms of atmospheric pollutants is a world-wide accepted technique due to their special biological and morphologic characteristics as nonvascular plants. They are commonly regarded as the best bioindicators of air quality because they can accumulate sulphur (S) and other elements to a far greater level than is necessary for their physiological needs. This study aims at using different isotope systematics δ34S, 206Pb/204Pb, δ13C and δ15N) to help understand the origin of S in the atmophsere of Reykjavik and its vicinity, and especially the potential contribution of surrounding geothermal plants. The selected Icelandic woolly fringe moss (Racomitrium lanuginosum (Hedw.) Brid.) is extremely common in lava fields and gravely and stony areas. Samples were taken in four distinct sampling sites around the city of Reykjavik: Bláfjöll area (south-eastern suburb of the city), and close to three power plants: Hellisheioarvirkjun (northern suburb of the city), Svartsengi (south-western suburb of the city) and Nesjavellir (north-eastern suburb of the city). Results show that, whatever the sampling context is, S is controlled by a binary mixing, between i) a high δ34S (around 16‰) end-member, characteristic of mosses from Hellisheioarvirkjun, and ii) a low δ34S (around -2‰) end-member, characteristic of mosses from Nesjavellir. The multi-isotope approach, confirms this binary relation and helps to constrain the different end-members involved.

  1. 40 CFR 204.54 - Test procedures.

    Science.gov (United States)

    2010-07-01

    ... measure portable air compressor engine speed. (6) A gauge accurate to within ±5 percent shall be used to... used to measure the portable air compressor compressed air volumetric flow rate. (8) A barometer for...

  2. Publications | Page 204 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    We share the results of our funded research, and offer free training materials to ... and/or managing of a business which has been paying salaries for less than 42 months. ... Women play larger role in Latin America's commercial urban waste ...

  3. 32 CFR 204.5 - Fees.

    Science.gov (United States)

    2010-07-01

    ... demand exists for a good, resource, or service, its market price will be determined using commercial... substantial competitive demand, market price will be determined by taking into account the prevailing prices... advance, when feasible. The benefit of charging user fees must outweigh the cost of collecting the fees...

  4. TH-EF-204-01: Introduction

    International Nuclear Information System (INIS)

    Cygler, J.

    2016-01-01

    Joanna E. Cygler, Jan Seuntjens, J. Daniel Bourland, M. Saiful Huq, Josep Puxeu Vaque, Daniel Zucca Aparicio, Tatiana Krylova, Yuri Kirpichev, Eric Ford, Caridad Borras Stereotactic Radiation Therapy (SRT) utilizes small static and dynamic (IMRT) fields, to successfully treat malignant and benign diseases using techniques such as Stereotactic Radiosurgery (SRS) and Stereotactic Body Radiation Therapy (SBRT). SRT is characterized by sharp dose gradients for individual fields and their resultant dose distributions. For appropriate targets, small field radiotherapy offers improved treatment quality by allowing better sparing of organs at risk while delivering the prescribed target dose. Specialized small field treatment delivery systems, such as robotic-controlled linear accelerators, gamma radiosurgery units, and dynamic arc linear accelerators may utilize rigid fixation, image guidance, and tumor tracking, to insure precise dose delivery to static or moving targets. However, in addition to great advantages, small field delivery techniques present special technical challenges for dose calibration due to unique geometries and small field sizes not covered by existing reference dosimetry protocols such as AAPM TG-51 or IAEA TRS 398. In recent years extensive research has been performed to understand small field dosimetry and measurement instrumentation. AAPM, IAEA and ICRU task groups are expected to provide soon recommendations on the dosimetry of small radiation fields. In this symposium we will: 1] discuss the physics, instrumentation, methodologies and challenges for small field radiation dose measurements; 2] review IAEA and ICRU recommendations on prescribing, recording and reporting of small field radiation therapy; 3] discuss selected clinical applications and technical aspects for specialized image-guided, small field, linear accelerator based treatment techniques such as IMRT and SBRT. Learning Objectives: To learn the physics of small fields in contrast to dosimetry of conventional fields To learn about detectors suitable for small fields To learn about the role of Monte Carlo simulations in determination of small field output factors To provide an overview of the IAEA small field dosimetry recommendations To provide an overview of the content of the ICRU report on Prescribing, Reporting and Recording of Small Field Radiation Therapy. To learn about special technical considerations in delivering IMRT and SBRT treatments To appreciate specific challenges of IMRT implementation J. Seuntjens, Natural Sciences and Engineering Research Council; Canadian Institutes of Health Research

  5. TH-EF-204-06: Closing

    International Nuclear Information System (INIS)

    Borras, C.

    2016-01-01

    Joanna E. Cygler, Jan Seuntjens, J. Daniel Bourland, M. Saiful Huq, Josep Puxeu Vaque, Daniel Zucca Aparicio, Tatiana Krylova, Yuri Kirpichev, Eric Ford, Caridad Borras Stereotactic Radiation Therapy (SRT) utilizes small static and dynamic (IMRT) fields, to successfully treat malignant and benign diseases using techniques such as Stereotactic Radiosurgery (SRS) and Stereotactic Body Radiation Therapy (SBRT). SRT is characterized by sharp dose gradients for individual fields and their resultant dose distributions. For appropriate targets, small field radiotherapy offers improved treatment quality by allowing better sparing of organs at risk while delivering the prescribed target dose. Specialized small field treatment delivery systems, such as robotic-controlled linear accelerators, gamma radiosurgery units, and dynamic arc linear accelerators may utilize rigid fixation, image guidance, and tumor tracking, to insure precise dose delivery to static or moving targets. However, in addition to great advantages, small field delivery techniques present special technical challenges for dose calibration due to unique geometries and small field sizes not covered by existing reference dosimetry protocols such as AAPM TG-51 or IAEA TRS 398. In recent years extensive research has been performed to understand small field dosimetry and measurement instrumentation. AAPM, IAEA and ICRU task groups are expected to provide soon recommendations on the dosimetry of small radiation fields. In this symposium we will: 1] discuss the physics, instrumentation, methodologies and challenges for small field radiation dose measurements; 2] review IAEA and ICRU recommendations on prescribing, recording and reporting of small field radiation therapy; 3] discuss selected clinical applications and technical aspects for specialized image-guided, small field, linear accelerator based treatment techniques such as IMRT and SBRT. Learning Objectives: To learn the physics of small fields in contrast to dosimetry of conventional fields To learn about detectors suitable for small fields To learn about the role of Monte Carlo simulations in determination of small field output factors To provide an overview of the IAEA small field dosimetry recommendations To provide an overview of the content of the ICRU report on Prescribing, Reporting and Recording of Small Field Radiation Therapy. To learn about special technical considerations in delivering IMRT and SBRT treatments To appreciate specific challenges of IMRT implementation J. Seuntjens, Natural Sciences and Engineering Research Council; Canadian Institutes of Health Research

  6. 7 CFR 1901.204 - Compliance reviews.

    Science.gov (United States)

    2010-01-01

    ... Housing Project. (ii) The borrower's method of advertising the facility to the public, if there is any advertising, including how well these methods reach the minority community. (iii) Any records of request for... Director will immediately send a copy of the compliance review report to the Administrator, Attention...

  7. 5 CFR 2635.204 - Exceptions.

    Science.gov (United States)

    2010-01-01

    ..., to ensure its continuation on a regular basis; and (ii) Under which selection of award recipients is... dinner meeting hosted by the businessmen at a province restaurant where the market value of the food and...

  8. 28_197 - 204_Saminu et al.,

    African Journals Online (AJOL)

    pc

    the control of polymer molecular weight distribut and end group ... aqueous solutions(Cunningham, 2008; J. 2005), alcoholic ..... necessary to halt the reactions after the dura stated in Table ..... The application of ionizing radiation in reversible ...

  9. 40 CFR 204.58-2 - Tampering.

    Science.gov (United States)

    2010-07-01

    ... noise control systems on compressors subject to this part. (Secs. 6 and 13, Noise Control Act, Pub. L... rendering inoperative of noise control devices or elements of design of the compressor. (b) The manufacturer... Control System Prohibited Federal law prohibits the following acts or the causing thereof: (1) The removal...

  10. 40 CFR 204.58-1 - Warranty.

    Science.gov (United States)

    2010-07-01

    ... regulations. This warranty is not limited to any particular part, component, or system of the air compressor. Defects in the design, assembly, or in any part, component, or system of the compressor which, at the time... by this warranty for the life of the air compressor. (b) [Reserved] (Secs. 6 and 13, Noise Control...

  11. Publications | Page 204 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Working Paper 4: Institutions for Effective Water Demand Management. This working paper is part of WaDImena 's four Research Series on Water Demand Management, and aims to identify the institutional characteristics necessary for more effective WDM implementation. Exogenous and endogenous factors that may.

  12. 5 CFR 720.204 - Agency programs.

    Science.gov (United States)

    2010-01-01

    ... continuing program for the recruitment of minorities and women for positions in the agency and its components... out as part of their periodic performance appraisals. (b) Programs established under this subpart must... underrepresentation in the agency work force. ...

  13. 42 CFR 66.204 - Application.

    Science.gov (United States)

    2010-10-01

    ... PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES FELLOWSHIPS, INTERNSHIPS, TRAINING... subject area or areas in which the proposed research or training will be conducted; (2) The resources and facilities available for use by recipients of Awards in carrying out this research or training; (3) The names...

  14. 46 CFR 197.204 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... the diver access to the surrounding environment, and is capable of being used as a refuge during... supervisor. Diver means a person working beneath the surface, exposed to hyperbaric conditions, and using.... Injurious corrosion means an advanced state of corrosion which may impair the structural integrity or safe...

  15. 29 CFR 541.204 - Educational establishments.

    Science.gov (United States)

    2010-07-01

    ... to administration along the lines of general business operations. Such academic administrative...; department heads in institutions of higher education responsible for the administration of the mathematics...

  16. 35__200 - 204__Musa - Toxicity

    African Journals Online (AJOL)

    User

    common form of alternative medicine (Ogbonnia et al., 2011). The use of herbal ... points for the discovery of bioactive molecules for drug development (Ifeoma and Oluwakanyinsola,. 2013). ... cell (WBC) count and differential WBC count using the method of Tietz ..... by renal regeneration. Necrosis of the ... stem bark in rats.

  17. 49 CFR 172.204 - Shipper's certification.

    Science.gov (United States)

    2010-10-01

    ... the certification the words “herein-named” may be substituted for the words “above-named”. (2) “I... respects in proper condition for transport according to applicable international and national governmental... national governmental regulations. Note to paragraph (c)(1): In the certification, the word “packed” may be...

  18. 17 CFR 204.32 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... payments made to employees such as overpayment of benefits, salary or other allowances; loans when insured or guaranteed by the United States; and other amounts due the United States from fees, leases, rents... similar sources. Disposable pay means the amount that remains from an employee's federal pay after...

  19. 29 CFR 1614.204 - Class complaints.

    Science.gov (United States)

    2010-07-01

    ... practice adversely affecting the class as well as the specific action or matter affecting the class agent.../Petition. (e) Notification. (1) Within 15 days of receiving notice that the administrative judge has... parties shall furnish to the administrative judge copies of all materials that they wish to be examined...

  20. 12 CFR 268.204 - Class complaints.

    Science.gov (United States)

    2010-01-01

    ... agent or representative and must identify the policy or practice adversely affecting the class as well..., Notice of Appeal/Petition. (e) Notification. (1) Within 15 days of receiving notice that the...) Both parties shall furnish to the administrative judge copies of all materials that they wish to be...

  1. 8 CFR 204.301 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS IMMIGRANT PETITIONS... custody of the child without intending to transfer, or without transferring, these rights to any specific...-operation in Respect of Intercountry Adoption, opened for signature at The Hague on May 29, 1993. Convention...

  2. 30 CFR 75.204 - Roof bolting.

    Science.gov (United States)

    2010-07-01

    ... accessories addressed in ASTM F432-95, “Standard Specification for Roof and Rock Bolts and Accessories,” the.... (4) In each roof bolting cycle, the actual torque or tension of the first tensioned roof bolt... during each roof bolting cycle shall be tested during or immediately after the first row of bolts has...

  3. 17 CFR 204.62 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... agency of the Federal Government. Garnishment means the process of withholding amounts from an employee's disposable pay and the paying of those amounts to a creditor in satisfaction of a withholding order...

  4. 17 CFR 204.40 - Deductions.

    Science.gov (United States)

    2010-04-01

    ... satisfaction or the amount of the debt exceeds 15 percent of the indebted employee's current disposable pay... agreement. (3) If the employee requests a waiver or reconsideration or the program official refuses to... official's written decision. (4) If the employee consents to the terms and conditions set forth in the...

  5. 19 CFR 201.204 - Salary offset.

    Science.gov (United States)

    2010-04-01

    ... applicable. (7) Failure to appear. If, in the absence of good cause shown (e.g., illness), the employee or..., based on materially changed circumstances, including, but not limited to, catastrophic illness, divorce...

  6. Publications | Page 204 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The Millennium Development Goals identify lack of clean water supply as a key factor in ... In reality, policy making and implementation are often irrational, ... Integrated Natural Resource Management in the Highlands of Eastern Africa: From ...

  7. TU-AB-204-04: Partnerships

    International Nuclear Information System (INIS)

    Ochs, R.

    2016-01-01

    The responsibilities of the Food and Drug Administration (FDA) have increased since the inception of the Food and Drugs Act in 1906. Medical devices first came under comprehensive regulation with the passage of the 1938 Food, Drug, and Cosmetic Act. In 1971 FDA also took on the responsibility for consumer protection against unnecessary exposure to radiation-emitting devices for home and occupational use. However it was not until 1976, under the Medical Device Regulation Act, that the FDA was responsible for the safety and effectiveness of medical devices. This session will be presented by the Division of Radiological Health (DRH) and the Division of Imaging, Diagnostics, and Software Reliability (DIDSR) from the Center for Devices and Radiological Health (CDRH) at the FDA. The symposium will discuss on how we protect and promote public health with a focus on medical physics applications organized into four areas: pre-market device review, post-market surveillance, device compliance, current regulatory research efforts and partnerships with other organizations. The pre-market session will summarize the pathways FDA uses to regulate the investigational use and commercialization of diagnostic imaging and radiation therapy medical devices in the US, highlighting resources available to assist investigators and manufacturers. The post-market session will explain the post-market surveillance and compliance activities FDA performs to monitor the safety and effectiveness of devices on the market. The third session will describe research efforts that support the regulatory mission of the Agency. An overview of our regulatory research portfolio to advance our understanding of medical physics and imaging technologies and approaches to their evaluation will be discussed. Lastly, mechanisms that FDA uses to seek public input and promote collaborations with professional, government, and international organizations, such as AAPM, International Electrotechnical Commission (IEC), Image Gently, and the Quantitative Imaging Biomarkers Alliance (QIBA) among others, to fulfill FDA’s mission will be discussed. Learning Objectives: Understand FDA’s pre-market and post-market review processes for medical devices Understand FDA’s current regulatory research activities in the areas of medical physics and imaging products Understand how being involved with AAPM and other organizations can also help to promote innovative, safe and effective medical devices J. Delfino, nothing to disclose

  8. 12 CFR 204.121 - Bankers' banks.

    Science.gov (United States)

    2010-01-01

    ... actual or impending failure of another depository institution; share insurance funds; depository... Federal Home Loan Bank, or in the National Credit Union Administration Central Liquidity Facility if the...

  9. 40 CFR 204.55-2 - Requirements.

    Science.gov (United States)

    2010-07-01

    ... use more parameters): (A) Engine type. (1) Gasoline—two stroke cycle (2) Gasoline—four stroke cycle (3) Diesel—two stroke cycle (4) Diesel—four stroke cycle (5) Rotary—Wankel (6) Turbine (7) Other (B) Engine...

  10. TU-AB-204-04: Partnerships

    Energy Technology Data Exchange (ETDEWEB)

    Ochs, R. [Food & Drug Administration Center for Devices and Radiological Health (United States)

    2016-06-15

    The responsibilities of the Food and Drug Administration (FDA) have increased since the inception of the Food and Drugs Act in 1906. Medical devices first came under comprehensive regulation with the passage of the 1938 Food, Drug, and Cosmetic Act. In 1971 FDA also took on the responsibility for consumer protection against unnecessary exposure to radiation-emitting devices for home and occupational use. However it was not until 1976, under the Medical Device Regulation Act, that the FDA was responsible for the safety and effectiveness of medical devices. This session will be presented by the Division of Radiological Health (DRH) and the Division of Imaging, Diagnostics, and Software Reliability (DIDSR) from the Center for Devices and Radiological Health (CDRH) at the FDA. The symposium will discuss on how we protect and promote public health with a focus on medical physics applications organized into four areas: pre-market device review, post-market surveillance, device compliance, current regulatory research efforts and partnerships with other organizations. The pre-market session will summarize the pathways FDA uses to regulate the investigational use and commercialization of diagnostic imaging and radiation therapy medical devices in the US, highlighting resources available to assist investigators and manufacturers. The post-market session will explain the post-market surveillance and compliance activities FDA performs to monitor the safety and effectiveness of devices on the market. The third session will describe research efforts that support the regulatory mission of the Agency. An overview of our regulatory research portfolio to advance our understanding of medical physics and imaging technologies and approaches to their evaluation will be discussed. Lastly, mechanisms that FDA uses to seek public input and promote collaborations with professional, government, and international organizations, such as AAPM, International Electrotechnical Commission (IEC), Image Gently, and the Quantitative Imaging Biomarkers Alliance (QIBA) among others, to fulfill FDA’s mission will be discussed. Learning Objectives: Understand FDA’s pre-market and post-market review processes for medical devices Understand FDA’s current regulatory research activities in the areas of medical physics and imaging products Understand how being involved with AAPM and other organizations can also help to promote innovative, safe and effective medical devices J. Delfino, nothing to disclose.

  11. 48 CFR 204.604 - Responsibilities.

    Science.gov (United States)

    2010-10-01

    ... process for reporting contract actions to FPDS should, where possible, be automated by incorporating it... retrievable. Therefore, the contracting officer may reference the contract action report (CAR) approval date... submitted CAR in the file. Such reference satisfies contract file documentation requirements of FAR 4.803(a...

  12. 48 CFR 204.7001 - Policy.

    Science.gov (United States)

    2010-10-01

    ... the basic PII number unchanged for the life of the instrument unless the conditions in paragraph (c... not in the Government's best interest solely for administrative reasons (e.g., when the supplementary... predecessor contract once issued; and (iv) Shall not evade competition, expand the scope of work, or extend...

  13. 5 CFR 9901.204 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Administrative Personnel DEPARTMENT OF DEFENSE HUMAN RESOURCES MANAGEMENT AND LABOR RELATIONS SYSTEMS (DEPARTMENT OF DEFENSE-OFFICE OF PERSONNEL MANAGEMENT) DEPARTMENT OF DEFENSE NATIONAL SECURITY PERSONNEL SYSTEM... meaning given that term in § 9901.103. Classification, also referred to as job evaluation, means the...

  14. 9 CFR 204.2 - Organization.

    Science.gov (United States)

    2010-01-01

    ... Hampshire, New Jersey, New York, Pennsylvania, Rhode Island, Vermont) Omaha—909 Livestock Exchange Building..., Packers and Stockyards Administration (Packers and Stockyards Programs); review and evaluation of program... books, records, and reports of persons subject to the Act; conduct investigations to determine the...

  15. 23 CFR 646.204 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS RAILROADS Railroad... aspect upon the approach or presence of a train. Preliminary engineering shall mean the work necessary to... rapid transit, commuter and street railroads. Utility shall mean the lines and facilities for producing...

  16. 5 CFR 950.204 - Local eligibility.

    Science.gov (United States)

    2010-01-01

    ... electronic technology that allows removal of the need for geographic restrictions on giving as determined by... whose geographic border touches the geographic border of another local campaign. Participation in a... voluntary board of directors which serves without compensation and holds regular meetings. (4) Conduct its...

  17. 12 CFR 204.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... given by the depositor not less than seven days prior to withdrawal; (D) Held in club accounts (such as Christmas club accounts and vacation club accounts that are not maintained as savings deposits) that are... telephonic (including data transmission) agreement, order or instruction, or by check, draft, debit card, or...

  18. 48 CFR 952.204-2 - Security.

    Science.gov (United States)

    2010-10-01

    ... employee, and must test the individual for illegal drugs, prior to selecting the individual for a position... applicant or uncleared employee to a position requiring an access authorization, the Contractor must comply... Disabilities Act (ADA), and Health Insurance Portability and Accountability Act; and (B) prohibiting...

  19. 7 CFR 1205.204 - Voting.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... through the Internet during the voting period. A completed and signed CN-100 and supporting documentation.... Forms obtained via the Internet will be located at http://www.ams.usda.gov/Cotton. Upon request by...

  20. 7 CFR 20.4 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... buyer. (c) Commodity. Wheat and wheat flour, feed grains, oilseeds, cotton, rice, cattle hides and skins... agrees to export the commodity, (2) the foreign buyer agrees to receive the commodity, (3) a fixed price or an agreed upon mechanism by which such a price can be determined is established, and (4) payment...

  1. 48 CFR 17.204 - Contracts.

    Science.gov (United States)

    2010-10-01

    .... (f) Contracts may express options for increased quantities of supplies or services in terms of (1... identified as the option. (g) Contracts may express extensions of the term of the contract as an amended... on the purchase of additional supplies or services, or the overall duration of the term of the...

  2. TH-EF-204-06: Closing

    Energy Technology Data Exchange (ETDEWEB)

    Borras, C.

    2016-06-15

    Joanna E. Cygler, Jan Seuntjens, J. Daniel Bourland, M. Saiful Huq, Josep Puxeu Vaque, Daniel Zucca Aparicio, Tatiana Krylova, Yuri Kirpichev, Eric Ford, Caridad Borras Stereotactic Radiation Therapy (SRT) utilizes small static and dynamic (IMRT) fields, to successfully treat malignant and benign diseases using techniques such as Stereotactic Radiosurgery (SRS) and Stereotactic Body Radiation Therapy (SBRT). SRT is characterized by sharp dose gradients for individual fields and their resultant dose distributions. For appropriate targets, small field radiotherapy offers improved treatment quality by allowing better sparing of organs at risk while delivering the prescribed target dose. Specialized small field treatment delivery systems, such as robotic-controlled linear accelerators, gamma radiosurgery units, and dynamic arc linear accelerators may utilize rigid fixation, image guidance, and tumor tracking, to insure precise dose delivery to static or moving targets. However, in addition to great advantages, small field delivery techniques present special technical challenges for dose calibration due to unique geometries and small field sizes not covered by existing reference dosimetry protocols such as AAPM TG-51 or IAEA TRS 398. In recent years extensive research has been performed to understand small field dosimetry and measurement instrumentation. AAPM, IAEA and ICRU task groups are expected to provide soon recommendations on the dosimetry of small radiation fields. In this symposium we will: 1] discuss the physics, instrumentation, methodologies and challenges for small field radiation dose measurements; 2] review IAEA and ICRU recommendations on prescribing, recording and reporting of small field radiation therapy; 3] discuss selected clinical applications and technical aspects for specialized image-guided, small field, linear accelerator based treatment techniques such as IMRT and SBRT. Learning Objectives: To learn the physics of small fields in contrast to dosimetry of conventional fields To learn about detectors suitable for small fields To learn about the role of Monte Carlo simulations in determination of small field output factors To provide an overview of the IAEA small field dosimetry recommendations To provide an overview of the content of the ICRU report on Prescribing, Reporting and Recording of Small Field Radiation Therapy. To learn about special technical considerations in delivering IMRT and SBRT treatments To appreciate specific challenges of IMRT implementation J. Seuntjens, Natural Sciences and Engineering Research Council; Canadian Institutes of Health Research.

  3. TH-EF-204-01: Introduction

    Energy Technology Data Exchange (ETDEWEB)

    Cygler, J. [The Ottawa Hospital Cancer Centre (Canada)

    2016-06-15

    Joanna E. Cygler, Jan Seuntjens, J. Daniel Bourland, M. Saiful Huq, Josep Puxeu Vaque, Daniel Zucca Aparicio, Tatiana Krylova, Yuri Kirpichev, Eric Ford, Caridad Borras Stereotactic Radiation Therapy (SRT) utilizes small static and dynamic (IMRT) fields, to successfully treat malignant and benign diseases using techniques such as Stereotactic Radiosurgery (SRS) and Stereotactic Body Radiation Therapy (SBRT). SRT is characterized by sharp dose gradients for individual fields and their resultant dose distributions. For appropriate targets, small field radiotherapy offers improved treatment quality by allowing better sparing of organs at risk while delivering the prescribed target dose. Specialized small field treatment delivery systems, such as robotic-controlled linear accelerators, gamma radiosurgery units, and dynamic arc linear accelerators may utilize rigid fixation, image guidance, and tumor tracking, to insure precise dose delivery to static or moving targets. However, in addition to great advantages, small field delivery techniques present special technical challenges for dose calibration due to unique geometries and small field sizes not covered by existing reference dosimetry protocols such as AAPM TG-51 or IAEA TRS 398. In recent years extensive research has been performed to understand small field dosimetry and measurement instrumentation. AAPM, IAEA and ICRU task groups are expected to provide soon recommendations on the dosimetry of small radiation fields. In this symposium we will: 1] discuss the physics, instrumentation, methodologies and challenges for small field radiation dose measurements; 2] review IAEA and ICRU recommendations on prescribing, recording and reporting of small field radiation therapy; 3] discuss selected clinical applications and technical aspects for specialized image-guided, small field, linear accelerator based treatment techniques such as IMRT and SBRT. Learning Objectives: To learn the physics of small fields in contrast to dosimetry of conventional fields To learn about detectors suitable for small fields To learn about the role of Monte Carlo simulations in determination of small field output factors To provide an overview of the IAEA small field dosimetry recommendations To provide an overview of the content of the ICRU report on Prescribing, Reporting and Recording of Small Field Radiation Therapy. To learn about special technical considerations in delivering IMRT and SBRT treatments To appreciate specific challenges of IMRT implementation J. Seuntjens, Natural Sciences and Engineering Research Council; Canadian Institutes of Health Research.

  4. Inactivation of human osteosarcoma cells in vitro by 211At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    International Nuclear Information System (INIS)

    Larsen, R.H.; Bruland, O.S.; Hoff, P.; Alstad, J.; Lindmo, T.; Rofstad, E.K.

    1994-01-01

    The potential usefulness of α-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) 211 At-TP-3 of different specific activities, (b) 211 At-labeled bovine serum albumin (BSA), (c) free 211 At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, 211 At-BSA or free 211 At. The D o 's were lower for free 211 At than for 211 At-BSA. The survival curves for 211 At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to 211 At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to 211 At-TP-3 treatment was the antigen expression. Cell inactivation after 211 At-TP-3 treatment increased substantially with increasing specific activity of the 211 At-TP-3. At high specific activities, the cytotoxic effect of 211 At-TP-3 was significantly higher than that of 211 At-BSA. In conclusion, 211 At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs

  5. INCLUSIÓN Y ACUMULACIÓN DE NA+ EN DIFERENTES ÓRGANOS DE LA VARIEDAD DE TRIGO CUBA-C-204 COMO RESPUESTA AL ESTRÉS SALINO

    Directory of Open Access Journals (Sweden)

    Leandris Argentel

    2016-06-01

    Full Text Available Se determinó la capacidad de inclusión y los sitios de retención de cationes en una variedad de trigo harinero Cuba-C-204, como posible indicador de toxicidad iónica y daño celular después de tratamiento salino, mediante técnicas de espectrofotometría de absorción atómica, fijación y microanálisis en diferentes órganos de la planta. Plantas fueron cultivadas por 35 días en condiciones de hidroponía en solución nutritiva con dos tratamientos (salinizada y control, con 88 mM de NaCl y sin NaCl, respectivamente. Se cuantificó el contenido catiónico en raíces, vainas y hojas, y en una muestra aleatoria de cada órgano seccionado. Como resultado del tratamiento salino observase que hubo mayor acumulación de Na+ y Ca2+ en los diferentes órganos. En la parte de la raíz más próxima al tallo, y en la base y parte media de la vaina se observó inclusión y concentración significativas de Na+. En la hoja el Na+ se acumuló en la parte más próxima a la lígula y el ápice, estando ausente en la parte media de la hoja. La mayor interferencia nutricional obtenida fue Na+/K+ en las vainas de las hojas, con una relación iónica media de 0.45. El contenido de Ca2+ en todos los casos fue superior en las plantas que crecieron en el medio salino y su concentración aumentó desde la raíz hasta las hojas. Existió congruencia entre los análisis espectrofotométricos y lo observado por microscopía electrónica. Los resultados obtenidos permiten aumentar el conocimiento que se tiene de la variedad como fuente de resistencia al estrés salino.

  6. Arthroscopic management of traumatic anterior shoulder instability in collision athletes: analysis of 204 cases with a 4- to 9-year follow-up and results with the suture anchor technique.

    Science.gov (United States)

    Larrain, Mario Victor; Montenegro, Hugo Jorge; Mauas, David Marcelo; Collazo, Cristian Carlos; Pavón, Facundo

    2006-12-01

    The purpose of this study was to determine the effectiveness of arthroscopy in the selection of surgical procedure and treatment of both acute and recurrent traumatic anterior shoulder instability in rugby players by use of pre-established selection criteria. We describe the injury mechanisms, analyze the pathologic lesions and treatment indications based on surgical findings, and assess the results in patients treated with the arthroscopic suture anchor technique. From November 1996 to November 2001, 204 rugby players with acute or recurrent traumatic anterior instability underwent an initial arthroscopic examination. Criteria such as type of Bankart lesion, tissue quality, and presence of bony defects were evaluated and used to determine the method of stabilization: arthroscopy or open stabilization. Open surgery was indicated in patients with bone humeral deficiencies greater than one fourth of the articular humeral head, bone glenoid deficiencies greater than 25% of the glenoid extension, capsular laxity with poor tissue quality, and humeral avulsion of the glenohumeral ligament; all other patients underwent arthroscopic reconstruction via the bone suture anchor technique. The mean follow-up was 5.9 years (range, 3.9 to 8.9 years). We performed arthroscopic stabilization in 39 cases of acute instability; only 1 case (2.5%) required the mini-open technique for reinsertion of humeral avulsion of the glenohumeral ligament. Of 158 cases of recurrent instability, 121 underwent arthroscopic stabilization, and 37 (23.4%) required reconstruction with open surgery. The main cause was bony deficiency (treated with the Latarjet procedure). The results of the arthroscopic reconstructions were evaluated by use of the Rowe scale and analyzed according to stability and range of motion. Good or excellent results were found in 94.9% of cases in the acute instability group and in 91.8% in the recurrent instability group, the poor results were due to instability recurrence. In

  7. Lithium superionic conductor Li9.42Si1.02P2.1S9.96O2.04 with Li10GeP2S12-type structure in the Li2S–P2S5–SiO2 pseudoternary system: Synthesis, electrochemical properties, and structure–composition relationships

    Directory of Open Access Journals (Sweden)

    Satoshi Hori

    2016-12-01

    Full Text Available Lithium superionic conductors with the Li10GeP2S12 (LGPS-type structure are promising materials for use as solid electrolytes in next-generation lithium batteries. A novel member of the LGPS family, Li9.42Si1.02P2.1S9.96O2.04, and its solid solutions were synthesised by quenching from 1273 K in the Li2S–P2S5–SiO2 pseudoternary system. The material exhibited an ionic conductivity as high as 3.2×10−4 S cm−1 at 298 K, as well as the high electrochemical stability to lithium metal, which was improved by the introduction of oxygen into the LGPS-type structure. An all-solid-state cell with a lithium metal anode and Li9.42Si1.02P2.1S9.96O2.04 as the separator showed excellent performance with a high coulomb efficiency of 100%. Thus, oxygen doping is an effective way of improving the electrochemical stability of LGPS-type structure.

  8. 49 CFR 571.204 - Standard No. 204; Steering control rearward displacement.

    Science.gov (United States)

    2010-10-01

    ... September 1, 1991. When a passenger car or a truck, bus, or multipurpose passenger vehicle with a gross... manufactured on or after September 1, 1991. When a passenger car or a truck, bus or multipurpose passenger... the steering control into the passenger compartment to reduce the likelihood of chest, neck, or head...

  9. Lithium Superionic Conductor Li9.42Si1.02P2.1S9.96O2.04 with Li10GeP2S12-Type Structure in the Li2S–P2S5–SiO2 Pseudoternary System: Synthesis, Electrochemical Properties, and Structure–Composition Relationships

    International Nuclear Information System (INIS)

    Hori, Satoshi; Suzuki, Kota; Hirayama, Masaaki; Kato, Yuki; Kanno, Ryoji

    2016-01-01

    Lithium superionic conductors with the Li 10 GeP 2 S 12 (LGPS)-type structure are promising materials for use as solid electrolytes in the next-generation lithium batteries. A novel member of the LGPS family, Li 9.42 Si 1.02 P 2.1 S 9.96 O 2.04 (LSiPSO), and its solid solutions were synthesized by quenching from 1273 K in the Li 2 S–P 2 S 5 –SiO 2 pseudoternary system. The material exhibited an ionic conductivity as high as 3.2 × 10 −4 S cm −1 at 298 K, as well as the high electrochemical stability to lithium metal, which was improved by the introduction of oxygen into the LGPS-type structure. An all-solid-state cell with a lithium metal anode and LSiPSO as the separator showed excellent performance with a high reversibility of 100%. Thus, oxygen doping is an effective way of improving the electrochemical stability of LGPS-type structure.

  10. Iron and Sulfur Species and Sulfur Isotopic Compositions of Authigenic Pyrite in Gas Hydrate-Bearing Sediments from Hydrate Ridge, Cascadia Margin (ODP Leg 204): A Proposal of Conceptual Models to Indicate the Non-Steady State Depositional and Diagenetic Processes

    Science.gov (United States)

    Liu, C.; Jiang, S. Y.; Su, X.

    2017-12-01

    Two accretionary sediment sequences from Sites 1245 and 1252 recovered during Ocean Drilling Program (ODP) Leg 204 at Hydrate Ridge, Cascadia Margin were investigated to explore the non-steady state depositional and diagenetic history. Five iron species and three sulfur species were chemically extracted, and their concentrations and the sulfur isotopic compositions of pyrite were determined. After the mineral recognitions of these species and detailed comparative analyses, the aerobic history of bottom seawater has been determined. The formation of pyrite is thought to be controlled by the limited production of hydrogen sulfide relative to the supply of reactive iron. Also, the intrusion of oxygen by bioturbation would oxidize the reduced sulfur species and further suppress pyritization. To explain the geochemical relationship between pyrite and siderite and the sulfur isotope characteristics of pyrite, we propose seven conceptual models based on the variations in depositional rate and methane flux, and the models succeed in explaining the geochemical results and are validated by the observed non-steady state events. These models may contribute to the reconstruction of the non-steady state processes in other research areas in the future.

  11. 12 CFR 204.125 - Foreign, international, and supranational entities referred to in §§ 204.2(c)(1)(iv)(E) and 204.8...

    Science.gov (United States)

    2010-01-01

    ...'Afrique del'Ouest. Conseil de l'Entente. East African Community. Organisation Commune Africaine et Malagache. Organization of African Unity. Union des Etats de l'Afrique Centrale. Union Douaniere et... American General Treaty of Economic Integration. River Plate Basin Commission. Africa African Development...

  12. Measurement of dose speed absorbed in depth imparted by sources external secondary patterns of beta radiation. Part 1 Measurement of dose speed absorbed in the surface of soft fabric for isotopes of {sup 90}Sr/{sup 90}Y, {sup 147}Pm and {sup 204}TI; Medicion de rapidez de dosis absorbida en profundidad impartida por fuentes patrones secundarios de radiacion beta externos. Parte 1. Medicion de rapidez de dosis absorbida en la superficie de tejido blando para isotopos de {sup 90}Sr/{sup 90}Y, {sup 147}Pm y {sup 204}TI

    Energy Technology Data Exchange (ETDEWEB)

    Alvarez R, J T [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    1993-01-15

    The dose speed was measured absorbed for depth zero, (superficial) in soft equivalent fabric, for the secondary pattern{sup s} four sources of beta radiation, (Nr. 86): {sup 90}Sr/{sup 90}Y, (1850 MBq and 74 MBq respectively); {sup 147}Pm, (518 MBq) and {sup 204}TI, (18.5 MBq). The measurement is carried out to different distances of source-detecting separation, (11.0, 30.0 and 50.0 cm for the source of 1850 MBq, 30.0 cm for that of 74 MBq; 11.00 cm for the source of {sup 147}Pmand to contact for all the sources); maintaining the radiation sheaf aligned the one axis of symmetry of the detector, ({alpha} 0 degrees). The detector employed was a extrapolation chambers of variable electrodes and electrode fixed collector, (30 mm of diameter). In accordance with the principle of Bragg-Gray the volume of the chambers is varied and they register the variations of the current of collected ionization, correcting until for a maximum of thirteen correction factors that take into account the deviation to the suppositions that it establishes this principle. The certain values of the speed of superficial absorbed dose are in the following intervals: {sup 90}Sr/{sup 90}Y, (1850 MBq, 0.0, 11.0, 30.0 and 50.0 cm): 43.164 mGy S-t, 0.544 mGy s-1 ,0.075 mGy s{sup -1} and 0.027 mGy s{sup -1}, respectively, with a Global Analysis of the order of 1.17%, 1.17%, 1.14% and 1.66%, K J; {sup 90}Sr / {sup 90}Y, (74 MBq, 0.0 and 30 cm): 1.536 mGy s{sup -1} and 0.002 mGy s{sup -1}, with Global Analysis of 1.19.0% and 5.22%, (K = 1) respectively, for the {sup 147}Pm, (0.0 and 11.0 in the interval of: 0.36 {mu}Gy s{sup -1} and 0.43 {mu}Gy s{sup -1}, with one Global Analysis of 1 .42% and 4.28%, (K = 1), respectively; and finally for the {sup 204}TI, (0.0 cm) in the interval of 0.10 {mu}Gy s{sup -1} with a Global Analysis of 1.27%. He calculates of the Global Analysis one carries out of agreement with those recommendations of the BIPM. In all the cases of source-detecting arrangement with

  13. Measurement of dose speed absorbed in depth imparted by sources external secondary patterns of beta radiation. Part 1 Measurement of dose speed absorbed in the surface of soft fabric for isotopes of {sup 90}Sr/{sup 90}Y, {sup 147}Pm and {sup 204}TI; Medicion de rapidez de dosis absorbida en profundidad impartida por fuentes patrones secundarios de radiacion beta externos. Parte 1. Medicion de rapidez de dosis absorbida en la superficie de tejido blando para isotopos de {sup 90}Sr/{sup 90}Y, {sup 147}Pm y {sup 204}TI

    Energy Technology Data Exchange (ETDEWEB)

    Alvarez R, J.T. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    1993-01-15

    The dose speed was measured absorbed for depth zero, (superficial) in soft equivalent fabric, for the secondary pattern{sup s} four sources of beta radiation, (Nr. 86): {sup 90}Sr/{sup 90}Y, (1850 MBq and 74 MBq respectively); {sup 147}Pm, (518 MBq) and {sup 204}TI, (18.5 MBq). The measurement is carried out to different distances of source-detecting separation, (11.0, 30.0 and 50.0 cm for the source of 1850 MBq, 30.0 cm for that of 74 MBq; 11.00 cm for the source of {sup 147}Pmand to contact for all the sources); maintaining the radiation sheaf aligned the one axis of symmetry of the detector, ({alpha} 0 degrees). The detector employed was a extrapolation chambers of variable electrodes and electrode fixed collector, (30 mm of diameter). In accordance with the principle of Bragg-Gray the volume of the chambers is varied and they register the variations of the current of collected ionization, correcting until for a maximum of thirteen correction factors that take into account the deviation to the suppositions that it establishes this principle. The certain values of the speed of superficial absorbed dose are in the following intervals: {sup 90}Sr/{sup 90}Y, (1850 MBq, 0.0, 11.0, 30.0 and 50.0 cm): 43.164 mGy S-t, 0.544 mGy s-1 ,0.075 mGy s{sup -1} and 0.027 mGy s{sup -1}, respectively, with a Global Analysis of the order of 1.17%, 1.17%, 1.14% and 1.66%, K J; {sup 90}Sr / {sup 90}Y, (74 MBq, 0.0 and 30 cm): 1.536 mGy s{sup -1} and 0.002 mGy s{sup -1}, with Global Analysis of 1.19.0% and 5.22%, (K = 1) respectively, for the {sup 147}Pm, (0.0 and 11.0 in the interval of: 0.36 {mu}Gy s{sup -1} and 0.43 {mu}Gy s{sup -1}, with one Global Analysis of 1 .42% and 4.28%, (K = 1), respectively; and finally for the {sup 204}TI, (0.0 cm) in the interval of 0.10 {mu}Gy s{sup -1} with a Global Analysis of 1.27%. He calculates of the Global Analysis one carries out of agreement with those recommendations of the BIPM. In all the cases of source-detecting arrangement with

  14. Measurement of dose speed absorbed in depth imparted by sources external secondary patterns of beta radiation. Part 1 Measurement of dose speed absorbed in the surface of soft fabric for isotopes of 90Sr/90Y, 147Pm and 204TI

    International Nuclear Information System (INIS)

    Alvarez R, J.T.

    1993-01-01

    The dose speed was measured absorbed for depth zero, (superficial) in soft equivalent fabric, for the secondary pattern s four sources of beta radiation, (Nr. 86): 90 Sr/ 90 Y, (1850 MBq and 74 MBq respectively); 147 Pm, (518 MBq) and 204 TI, (18.5 MBq). The measurement is carried out to different distances of source-detecting separation, (11.0, 30.0 and 50.0 cm for the source of 1850 MBq, 30.0 cm for that of 74 MBq; 11.00 cm for the source of 147 Pmand to contact for all the sources); maintaining the radiation sheaf aligned the one axis of symmetry of the detector, (α 0 degrees). The detector employed was a extrapolation chambers of variable electrodes and electrode fixed collector, (30 mm of diameter). In accordance with the principle of Bragg-Gray the volume of the chambers is varied and they register the variations of the current of collected ionization, correcting until for a maximum of thirteen correction factors that take into account the deviation to the suppositions that it establishes this principle. The certain values of the speed of superficial absorbed dose are in the following intervals: 90 Sr/ 90 Y, (1850 MBq, 0.0, 11.0, 30.0 and 50.0 cm): 43.164 mGy S-t, 0.544 mGy s-1 ,0.075 mGy s -1 and 0.027 mGy s -1 , respectively, with a Global Analysis of the order of 1.17%, 1.17%, 1.14% and 1.66%, K J; 90 Sr / 90 Y, (74 MBq, 0.0 and 30 cm): 1.536 mGy s -1 and 0.002 mGy s -1 , with Global Analysis of 1.19.0% and 5.22%, (K = 1) respectively, for the 147 Pm, (0.0 and 11.0 in the interval of: 0.36 μGy s -1 and 0.43 μGy s -1 , with one Global Analysis of 1 .42% and 4.28%, (K = 1), respectively; and finally for the 204 TI, (0.0 cm) in the interval of 0.10 μGy s -1 with a Global Analysis of 1.27%. He calculates of the Global Analysis one carries out of agreement with those recommendations of the BIPM. In all the cases of source-detecting arrangement with separations different from zero, models of simple lineal regression were used. However for the case of the

  15. Weld solidification cracking in 304 to 204L stainless steel

    Energy Technology Data Exchange (ETDEWEB)

    Hochanadel, Patrick W [Los Alamos National Laboratory; Lienert, Thomas J [Los Alamos National Laboratory; Martinez, Jesse N [Los Alamos National Laboratory; Johnson, Matthew Q [Los Alamos National Laboratory

    2010-09-15

    A series of annulus welds were made between 304 and 304L stainless steel coaxial tubes using both pulsed laser beam welding (LBW) and pulsed gas tungsten arc welding (GTAW). In this application, a change in process from pulsed LBW to pulsed gas tungsten arc welding was proposed to limit the possibility of weld solidification cracking since weldability diagrams developed for GTAW display a greater range of compositions that are not crack susceptible relative to those developed for pulsed LBW. Contrary to the predictions of the GTAW weldability diagram, cracking was found.This result was rationalized in terms of the more rapid solidification rate of the pulsed gas tungsten arc welds. In addition, for the pulsed LBW conditions, the material compositions were predicted to be, by themselves, 'weldable' according to the pulsed LBW weldability diagram. However, the composition range along the tie line connecting the two compositions passed through the crack susceptible range. Microstructurally, the primary solidification mode (PSM) of the material processed with higher power LBW was determined to be austenite (A), while solidification mode of the materials processed with lower power LBW apparently exhibited a dual PSM of both austenite (A) and ferrite-austenite (FA) within the same weld. The materials processed by pulsed GTAW showed mostly primary austenite solidification, with some regions of either primary austenite-second phase ferrite (AF) solidification or primary ferrite-second phase austenite (FA) solidification. This work demonstrates that variations in crack susceptibility may be realized when welding different heats of 'weldable' materials together, and that slight variations in processing can also contribute to crack susceptibility.

  16. 41 CFR 50-204.1 - Scope and application.

    Science.gov (United States)

    2010-07-01

    ... in which the work or part thereof is to be performed shall be prima-facie evidence of compliance with... prima facie evidence of compliance with the safety and health requirements of the Act and of any... anyone from the obligation to provide protection for the health and safety of his employees in unusual...

  17. 24 CFR 3280.204 - Kitchen cabinet protection.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Kitchen cabinet protection. 3280... Kitchen cabinet protection. (a) The bottom and sides of combustible kitchen cabinets over cooking ranges... is designed for the future installation of a cooking range, the metal hood and cabinet protection...

  18. 48 CFR 243.204-70-6 - Allowable profit.

    Science.gov (United States)

    2010-10-01

    ... profit allowed reflects— (a) Any reduced cost risk to the contractor for costs incurred during contract performance before negotiation of the final price; (b) The contractor's reduced cost risk for costs incurred during performance of the remainder of the contract; and (c) The extent to which costs have been incurred...

  19. 14 CFR 415.204-415.400 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... Events 1.6Vehicle Performance Graphs 2.0Launch Operator Organization (§ 415.111) 2.1Launch Operator... applicable) 4.3Flight Safety Plan 4.3.1Flight Safety Personnel 4.3.2Flight Safety Rules 4.3.3Flight Safety... and Instrumentation Plan 6.2Configuration Management and Control Plan 6.3Frequency Management Plan 6...

  20. 48 CFR 1652.204-74 - Large provider agreements.

    Science.gov (United States)

    2010-10-01

    ... FEDERAL EMPLOYEES HEALTH BENEFITS ACQUISITION REGULATION CLAUSES AND FORMS CONTRACT CLAUSES Texts of FEHBP... Large Provider Agreement; and (ii) Not less than 60 days before exercising a renewal or other option, or... exercising a simple renewal or other option contemplated by a Large Provider Agreement that OPM previously...

  1. WE-E-204-01: ASTRO Based Journals

    Energy Technology Data Exchange (ETDEWEB)

    Klein, E. [Long Island Jewish Medical Center (United States)

    2016-06-15

    Research papers authored by Medical Physicists address a large spectrum of oncologic, imaging, or basic research problems; exploit a wide range of physical and engineering methodologies; and often describe the efforts of a multidisciplinary research team. Given dozens of competing journals accepting medical physics articles, it may not be clear to an individual author which journal is the best venue for disseminating their work to the scientific community. Relevant factors usually include the Journal’s audience and scientific impact, but also such factors as perceived acceptance rate, interest in their topic, and quality of service. The purpose of this symposium is to provide the medical physics community with an overview of scope, review processes, and article guidelines for the following journals: Radiology, Medical Physics, International Journal of Radiation Biology and Physics, Journal of Applied Clinical Medical Physics, and Practical Radiation Oncology. Senior members of the editorial board for each journal will provide details as to the journals review process, for example: single blind versus double blind reviews; open access policies, the hierarchy of the review process in terms of editorial board structure; the reality of acceptance, in terms of acceptance rate; and the types of research the journal prefers to publish. Other journals will be discussed as well. The goal is to provide for authors guidance before they begin to write their papers, not only for proper formatting, but also that the readership is appropriate for the particular paper, hopefully increasing the quality and impact of the paper and the likelihood of publication. Learning Objectives: To review each Journal’s submission and review process Guidance as to how to increase quality, impact and chances of acceptance To help decipher which journal is appropriate for a given work A. Karellas, Research collaboration with Koning, Corporation.

  2. MO-AB-204-01: IHE RO Overview

    International Nuclear Information System (INIS)

    Hadley, S.

    2016-01-01

    You’ve experienced the frustration: vendor A’s device claims to work with vendor B’s device, but the practice doesn’t match the promise. Getting devices working together is the hidden art that Radiology and Radiation Oncology staff have to master. To assist with that difficult process, the Integrating the Healthcare Enterprise (IHE) effort was established in 1998, with the coordination of the Radiological Society of North America. Integrating the Healthcare Enterprise (IHE) is a consortium of healthcare professionals and industry partners focused on improving the way computer systems interconnect and exchange information. This is done by coordinating the use of published standards like DICOM and HL7. Several clinical and operational IHE domains exist in the healthcare arena, including Radiology and Radiation Oncology. The ASTRO-sponsored IHE Radiation Oncology (IHE-RO) domain focuses on radiation oncology specific information exchange. This session will explore the IHE Radiology and IHE RO process for; IHE solicitation process for new profiles. Improving the way computer systems interconnect and exchange information in the healthcare enterprise Supporting interconnectivity descriptions and proof of adherence by vendors Testing and assuring the vendor solutions to connectivity problems. Including IHE profiles in RFPs for future software and hardware purchases. Learning Objectives: Understand IHE role in improving interoperability in health care. Understand process of profile development and implantation. Understand how vendors prove adherence to IHE RO profiles. S. Hadley, ASTRO Supported Activity

  3. 24 CFR 983.204 - When HAP contract is executed.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false When HAP contract is executed. 983... When HAP contract is executed. (a) PHA inspection of housing. (1) Before execution of the HAP contract... into a HAP contract for any contract unit until the PHA has determined that the unit complies with the...

  4. 17 CFR 12.204 - Amended and supplemental pleadings.

    Science.gov (United States)

    2010-04-01

    ... the express or implied consent of the parties, they shall be treated in all respects as if they had... pleadings. At any time before the parties have concluded their submissions of proof, and upon such terms as...

  5. 41 CFR 50-204.3 - Material handling and storage.

    Science.gov (United States)

    2010-07-01

    .... Bags, containers, bundles, etc. stored in tiers shall be stacked, blocked, interlocked and limited in... harborage. Vegetation control will be exercised when necessary. (d) Proper drainage shall be provided. (e...

  6. 40 CFR 243.204-2 - Recommended procedures: Operations.

    Science.gov (United States)

    2010-07-01

    ... achieve the most efficient compaction. (3) Compactor trucks should be used to reduce the number of trips... commercial wastes which do not contain food wastes, storage capacity should be increased in lieu of more...

  7. 8 CFR 204.311 - Convention adoption home study requirements.

    Science.gov (United States)

    2010-01-01

    ... training already provided to the applicant concerning the issues specified in 22 CFR 96.48(a) and (b), the plans for future preparation and training with respect to those issues, or with respect to a particular... obligations at work, school, or home, or creates other social or interpersonal problems that may adversely...

  8. WE-H-204-00: History Committee Symposium

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2016-06-15

    “William D. Coolidge, Inventor of the Modern X-ray Tube” David J. Allard, M.S., CHP - Director, PA DEP Bureau of Radiation Protection William David Coolidge 1873–1975 was a research scientist and inventor of the modern X-ray tube. Besides Roentgen, with his 1895 discovery and subsequent studies of X-rays, perhaps no other individual contributed more to the advancement of X-ray technology than did Coolidge. He was born in Hudson, MA and received his Bachelor of Science degree from MIT in 1896. That same year he went to Europe to study under renowned physicists of the time. Coolidge received his Ph.D. summa cum laude from the University of Leipzig in 1899 and soon after joined the staff of MIT. While studying at Leipzig, he met Roentgen. In 1905 he was asked to join the newly established General Electric Research Laboratory in Schenectady, NY. He promptly began fundamental work on the production of ductile tungsten filaments as a replacement for fragile carbon filaments used in incandescent light bulbs. This improved light bulb was brought to market by GE in 1911. It was subsequent application of his tungsten work that led Coolidge to his studies in X ray production. Circa 1910, the state-of-the-art X-ray tube was a “gas tube” or “cold cathode” type tube. These crude X-ray tubes relied on residual gas molecules as a source of electrons for bombardment of low to medium atomic number metal targets. In 1912 Coolidge described the use of tungsten as an improved anode target material for X-ray tubes. Shortly after in 1913 he published a paper in Physical Review describing “A Powerful Roentgen Ray Tube With a Pure Electron Discharge.” This tube used a tungsten filament as a thermionic source of electrons under high vacuum to bombard a tungsten anode target. Great improvements in X-ray tube stability, output and performance were obtained with the “hot cathode” or “Coolidge tube.” With some variation in filament and target geometry, this 100 year old invention is the same basic X-ray tube used today in medicine, research and industry. In 1932 Coolidge became Director of the GE Laboratory, then in 1940 Vice-President and Director of Research. In 1941 he was a member of a small committee, appointed by President Franklin D. Roosevelt, to evaluate the military importance of research on uranium. This committee’s report led to the establishment of the Manhattan Engineering District for nuclear weapons development during WWII. Coolidge lived to be over 100 years old, he had 83 patents to his credit, numerous awards and honorary degrees, and in 1975 was elected to the National Inventor’s Hall of Fame. At the time he was the only inventor to receive this honor in his lifetime. Dr. Coolidge was also the first recipient of the AAPM’s highest science award - named in his honor. From notes of a day-long interview with Coolidge’s son Lawrence in the mid-1990s, previous biographies, publications, books, GE literature, historic photographs, e.g., a wonderful 1874 photo stereoview card with 1 year old baby “Willie Coolidge”, and other artifacts in the author’s collection, this presentation will review Dr. Coolidge’s amazing life, work, accomplishments and awards. “History and Archives Resources at AIP for AAPM and its Members” Gregory A. Good, Ph.D. - Director, AIP Center for History of Physics Melanie J. Mueller, MLIS - Acting Director, AIP Niels Bohr Library & Archives The American Institute of Physics established the Center for History of Physics and the Niels Bohr Library & Archives in the 1960s. Our shared mission is: To preserve and make known the history of the physical sciences. This talk will explore the many ways that AIP’s two history programs support the historical and archival activities of AAPM. Topics will include our ongoing oral history program, web outreach through exhibits and teaching guides, and archiving for AAPM and other Member Societies. We will focus in particular on materials in our collections related to the history of medical physics and to the history of AAPM. We will unveil and demonstrate a new “Archives Portal” that we are designing specifically to be useful to AAPM and its members. Learning Objectives: Study the background of the medical physicist - William David Coolidge Examine the time-line for his success Review the publications conceptualizing his works and progressions Realize what he invented Evaluate the importance of the invention Relate the success to national prominence Uncover how he influenced medical physicists today Find out how he was celebrated by the AAPM View the AIP established Center for History of Physics Consider the significant efforts and vision to preserve the history of medical physics Learn about the Niels Bohr Library & Archives Look back in time at medical physics in the 1960s Unveil and demonstrate a new “Archives Portal” that will be useful to AAPM.

  9. 17 CFR 200.204 - Personnel, fiscal, and service functions.

    Science.gov (United States)

    2010-04-01

    ... ORGANIZATION; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Plan of Organization and Operation Effective... allocate positions to their proper grades, to issue travel orders, and to effect emergency purchases of...

  10. 14 CFR 204.7 - Revocation for dormancy.

    Science.gov (United States)

    2010-01-01

    .... Such filings shall be addressed to the Documentary Services Division, Department of Transportation... carrier by the FAA. (Approved by the Office of Management and Budget under control number 2106-0023) ...

  11. 40 CFR 6.204 - Categorical exclusions and extraordinary circumstances.

    Science.gov (United States)

    2010-07-01

    ... and engineering studies. These actions include those conducted directly by EPA and EPA actions... as wetlands, floodplains, significant agricultural lands, aquifer recharge zones, coastal zones..., commercial, agricultural, recreational, residential) or growth and distribution of population including...

  12. 48 CFR 204.805 - Disposal of contract files.

    Science.gov (United States)

    2010-10-01

    ... Schedule 3 (Procurement, Supply, and Grant Records) and General Records Schedule 6 (Accountable Officers... Defense Acquisition Regulatory Council. Forward requests for deviations to both the Government... 15.403-4), for six years. If it is impossible to determine the final payment date in order to measure...

  13. 40 CFR 92.204 - Designation of engine families.

    Science.gov (United States)

    2010-07-01

    ...., the deviation of the timing curves from the optimal fuel economy timing curve must be similar in... characteristics (e.g., approximate boost pressure, approximate response time, approximate size relative to engine...

  14. 40 CFR 94.204 - Designation of engine families.

    Science.gov (United States)

    2010-07-01

    ...., the deviation of the timing curves from the optimal fuel economy timing curve must be similar in... characteristics (e.g., approximate boost pressure, approximate response time, approximate size relative to engine...

  15. RCT: Module 2.04, Dosimetry, Course 8769

    Energy Technology Data Exchange (ETDEWEB)

    Hillmer, Kurt T. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-08-11

    This course will introduce the types of instruments used to measure external and internal radiation to people. Dosimetry is the quantitative assessment of radiation received by the human body. Several types of dosimeters are used worldwide. This information is valuable to all radiological control personnel because dosimeters are the only direct method to measure and document personnel radiation exposure and ensure regulatory compliance with applicable limits. This course will cover dosimetry terms, Department of Energy (DOE) limits, Los Alamos National Laboratory (LANL) administrative guidelines, thermoluminescent dosimeters (TLDs), LANL dosimetry, and bioassay assessment methods. This course will prepare the student with the skills necessary for radiological control technician (RCT) qualification by passing quizzes, tests, and the RCT Comprehensive Phase 1, Unit 2 Examination (TEST 27566) and providing in-thefield skills.

  16. JB 204.pdf | forthcoming | jbsc | Volumes | public | Indian Academy of ...

    Indian Academy of Sciences (India)

    error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held from 29–30 June 2018 in Infosys, Mysuru ...

  17. 28 CFR 2.204 - Conditions of supervised release.

    Science.gov (United States)

    2010-07-01

    ... releasee's residence, workplace, or vehicle. (v) The releasee shall submit to a drug or alcohol test... alcoholic beverages to excess and shall not illegally buy, possess, use, or administer a controlled... if the supervision officer finds that the releasee has tested positive for illegal drugs or has...

  18. 14 CFR 1274.204 - Costs and payments.

    Science.gov (United States)

    2010-01-01

    ... variety of factors. For example, while the future profitability of intellectual property may serve as an... solicitation and how the proposal accomplishes those objectives to such a degree that a share ratio of less... ratio of resource sharing agreed upon under the cooperative agreement (see paragraph (e)(2) of this...

  19. 15 CFR 2011.204 - Entry of specialty sugars.

    Science.gov (United States)

    2010-01-01

    ... UNITED STATES TRADE REPRESENTATIVE ALLOCATION OF TARIFF-RATE QUOTA ON IMPORTED SUGARS, SYRUPS AND... present a certificate to the appropriate customs official at the date of entry of specialty sugars. Entry...

  20. 9 CFR 204.3 - Delegation of authority.

    Science.gov (United States)

    2010-01-01

    ... redelegation). (b) Division Directors. The Directors of the Industry Analysis Staff, the Livestock Marketing... question as to the true ownership of livestock sold by any person, to disclose information relating to such...

  1. 8 CFR 204.6 - Petitions for employment creation aliens.

    Science.gov (United States)

    2010-01-01

    ... director, original documents may be required. (b) [Reserved] (c) Eligibility to file. A petition for... or labor for the new commercial enterprise and who receives wages or other remuneration directly from... the corporate board of directors; or (iii) If the new enterprise is a partnership, either limited or...

  2. 48 CFR 41.204 - GSA areawide contracts.

    Science.gov (United States)

    2010-10-01

    ... service suppliers for the provision of service within the supplier's franchise territory or service area... a requirement for utility services within an area covered by an areawide contract shall acquire... administrative requirements of the agency, applicable rate schedules, technical information and detailed maps or...

  3. 18 CFR 281.204 - Tariff filing requirements.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Tariff filing... COMMISSION, DEPARTMENT OF ENERGY OTHER REGULATIONS UNDER THE NATURAL GAS POLICY ACT OF 1978 AND RELATED AUTHORITIES NATURAL GAS CURTAILMENT UNDER THE NATURAL GAS POLICY ACT OF 1978 Permanent Curtailment Rule § 281...

  4. 38 CFR 3.204 - Evidence of dependents and age.

    Science.gov (United States)

    2010-07-01

    ... name and relationship of the other person to the claimant; and, where the claimant's dependent child... question of its validity; the claimant's statement conflicts with other evidence of record; or, there is a... relationship in question. (Authority: 38 U.S.C. 5124) (b) Marriage or birth. The classes of evidence to be...

  5. 32 CFR 204.3 - Policy and procedures.

    Science.gov (United States)

    2010-07-01

    ...., insuring deposits in commercial banks), or (3) Is performed at the request of or for the convenience of the... sovereign and is leasing or selling goods or resources, or is providing a service (e.g., leasing space in...

  6. 77 FR 204 - Federal Acquisition Regulation; Technical Amendments

    Science.gov (United States)

    2012-01-03

    ... Parts 4, 8, 15, 19, 22, 23, 28, 42, and 52 Government procurement. Dated: December 21, 2011. Laura... paragraph (a)(2) ``http:// www.sba.gov/GC/pcr.html'' and adding ``http://www.sba.gov/content/ procurement-center-representatives'' in its place. PART 22--APPLICATION OF LABOR LAWS TO GOVERNMENT ACQUISITIONS 22...

  7. 5 CFR 551.204 - Nonexemption of certain employees.

    Science.gov (United States)

    2010-01-01

    ..., technical skills and knowledge that can be acquired only through prolonged job training and experience, such... performing predominantly administrative functions rather than the technical work of the occupation. (b...

  8. 46 CFR 309.204 - Proof of loss.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION EMERGENCY OPERATIONS VALUES FOR WAR RISK INSURANCE Stores and... submitted by the owner to the Chief, Division of Insurance, Maritime Administration, Washington, DC 20590... owner and the Chief, Division of Insurance, Maritime Administration, have agreed, in advance of the loss...

  9. Growth of Enterococcus durans E204 producing bacteriocin-like ...

    African Journals Online (AJOL)

    El Ouardy

    2012-01-10

    Jan 10, 2012 ... inhibition of Enterococcus faecium 410 CECT in 6 h of incubation. The highest ... as natural food additives for the elimination of spoilage and pathogeinic ..... autohydrolysed fish viscera for nisin and pediocin production. J.

  10. 44 CFR 204.62 - Duplication and recovery of assistance.

    Science.gov (United States)

    2010-10-01

    .... (c) Negligence. We will provide no assistance to an applicant for costs attributable to applicant's own negligence. If the applicant suspects negligence by a third party for causing a condition for... reasonable steps to recover all costs attributable to the negligence of the third party. We generally...

  11. 29 CFR 1603.204 - Ex parte communications.

    Science.gov (United States)

    2010-07-01

    ... decision-making personnel of the Commission and an interested party to the adjudication without providing... purely procedural questions are permitted. (b) Decision-making personnel of the Commission include... EXEMPT STATE AND LOCAL GOVERNMENT EMPLOYEE COMPLAINTS OF EMPLOYMENT DISCRIMINATION UNDER SECTION 304 OF...

  12. 7 CFR 25.204 - Evaluation of the strategic plan.

    Science.gov (United States)

    2010-01-01

    ... development plan for the nominating localities and is consistent with broader regional development strategies... economic, human, physical, community development and other activities in a mutually reinforcing, synergistic way to achieve ultimate goals; (2) Creativity and innovation. The extent to which the activities...

  13. 37 CFR 41.204 - Notice of basis for relief.

    Science.gov (United States)

    2010-07-01

    ..., DEPARTMENT OF COMMERCE PRACTICE BEFORE THE BOARD OF PATENT APPEALS AND INTERFERENCES Patent Interferences... priority in addition to its accorded benefit unless it files a statement setting forth all bases on which... statement overcoming a senior party's accorded benefit, judgment shall be entered against the junior party...

  14. 10 CFR 490.204 - Process for granting exemptions.

    Science.gov (United States)

    2010-01-01

    ... year, or it may require a State to acquire all or some of the exempted vehicles in future model years...) Alternative fuels that meet the normal requirements and practices of the principal business of the State fleet... requirements and practices of the principal business of the State fleet are not available for purchase or lease...

  15. 41 CFR 105-54.204 - Advisory committee membership.

    Science.gov (United States)

    2010-07-01

    ... particular individual or group to obtain different points of view relevant to committee business. The... Administrator's signature to the GSA Committee Management Officer and to the Special Counsel for Ethics and... basis of race, color, age, national origin, religion, sex, or mental and physical handicap in selecting...

  16. MO-AB-204-04: Connectathons and Testing

    Energy Technology Data Exchange (ETDEWEB)

    Bosch, W. [Washington University (United States)

    2016-06-15

    You’ve experienced the frustration: vendor A’s device claims to work with vendor B’s device, but the practice doesn’t match the promise. Getting devices working together is the hidden art that Radiology and Radiation Oncology staff have to master. To assist with that difficult process, the Integrating the Healthcare Enterprise (IHE) effort was established in 1998, with the coordination of the Radiological Society of North America. Integrating the Healthcare Enterprise (IHE) is a consortium of healthcare professionals and industry partners focused on improving the way computer systems interconnect and exchange information. This is done by coordinating the use of published standards like DICOM and HL7. Several clinical and operational IHE domains exist in the healthcare arena, including Radiology and Radiation Oncology. The ASTRO-sponsored IHE Radiation Oncology (IHE-RO) domain focuses on radiation oncology specific information exchange. This session will explore the IHE Radiology and IHE RO process for; IHE solicitation process for new profiles. Improving the way computer systems interconnect and exchange information in the healthcare enterprise Supporting interconnectivity descriptions and proof of adherence by vendors Testing and assuring the vendor solutions to connectivity problems. Including IHE profiles in RFPs for future software and hardware purchases. Learning Objectives: Understand IHE role in improving interoperability in health care. Understand process of profile development and implantation. Understand how vendors prove adherence to IHE RO profiles. S. Hadley, ASTRO Supported Activity.

  17. MO-AB-204-02: IHE RAD [Health care

    Energy Technology Data Exchange (ETDEWEB)

    Seibert, J. [UC Davis Medical Center (United States)

    2016-06-15

    You’ve experienced the frustration: vendor A’s device claims to work with vendor B’s device, but the practice doesn’t match the promise. Getting devices working together is the hidden art that Radiology and Radiation Oncology staff have to master. To assist with that difficult process, the Integrating the Healthcare Enterprise (IHE) effort was established in 1998, with the coordination of the Radiological Society of North America. Integrating the Healthcare Enterprise (IHE) is a consortium of healthcare professionals and industry partners focused on improving the way computer systems interconnect and exchange information. This is done by coordinating the use of published standards like DICOM and HL7. Several clinical and operational IHE domains exist in the healthcare arena, including Radiology and Radiation Oncology. The ASTRO-sponsored IHE Radiation Oncology (IHE-RO) domain focuses on radiation oncology specific information exchange. This session will explore the IHE Radiology and IHE RO process for; IHE solicitation process for new profiles. Improving the way computer systems interconnect and exchange information in the healthcare enterprise Supporting interconnectivity descriptions and proof of adherence by vendors Testing and assuring the vendor solutions to connectivity problems. Including IHE profiles in RFPs for future software and hardware purchases. Learning Objectives: Understand IHE role in improving interoperability in health care. Understand process of profile development and implantation. Understand how vendors prove adherence to IHE RO profiles. S. Hadley, ASTRO Supported Activity.

  18. TU-AB-204-01: Device Approval Process

    International Nuclear Information System (INIS)

    Delfino, J.

    2016-01-01

    The responsibilities of the Food and Drug Administration (FDA) have increased since the inception of the Food and Drugs Act in 1906. Medical devices first came under comprehensive regulation with the passage of the 1938 Food, Drug, and Cosmetic Act. In 1971 FDA also took on the responsibility for consumer protection against unnecessary exposure to radiation-emitting devices for home and occupational use. However it was not until 1976, under the Medical Device Regulation Act, that the FDA was responsible for the safety and effectiveness of medical devices. This session will be presented by the Division of Radiological Health (DRH) and the Division of Imaging, Diagnostics, and Software Reliability (DIDSR) from the Center for Devices and Radiological Health (CDRH) at the FDA. The symposium will discuss on how we protect and promote public health with a focus on medical physics applications organized into four areas: pre-market device review, post-market surveillance, device compliance, current regulatory research efforts and partnerships with other organizations. The pre-market session will summarize the pathways FDA uses to regulate the investigational use and commercialization of diagnostic imaging and radiation therapy medical devices in the US, highlighting resources available to assist investigators and manufacturers. The post-market session will explain the post-market surveillance and compliance activities FDA performs to monitor the safety and effectiveness of devices on the market. The third session will describe research efforts that support the regulatory mission of the Agency. An overview of our regulatory research portfolio to advance our understanding of medical physics and imaging technologies and approaches to their evaluation will be discussed. Lastly, mechanisms that FDA uses to seek public input and promote collaborations with professional, government, and international organizations, such as AAPM, International Electrotechnical Commission (IEC), Image Gently, and the Quantitative Imaging Biomarkers Alliance (QIBA) among others, to fulfill FDA’s mission will be discussed. Learning Objectives: Understand FDA’s pre-market and post-market review processes for medical devices Understand FDA’s current regulatory research activities in the areas of medical physics and imaging products Understand how being involved with AAPM and other organizations can also help to promote innovative, safe and effective medical devices J. Delfino, nothing to disclose

  19. 7 CFR 3565.204 - Maximum loan amount.

    Science.gov (United States)

    2010-01-01

    ... project. The lender shall recommend to the Agency an adjustment in the loan amount if appropriate as a result of this review. (2) Where the project financing combines a guaranteed loan with Low-Income Housing Tax Credits or other Federal assistance, the project must conform to the policies regarding necessary...

  20. 12 CFR 204.5 - Maintenance of required reserves.

    Science.gov (United States)

    2010-01-01

    ... and Other Items by Federal Reserve Banks and Funds Transfers Through Fedwire” (12 CFR part 210). If a... collected funds. (d)(1) A depository institution, a U.S. branch or agency of a foreign bank, or an Edge or... institutions are Federal Home Loan Banks, the National Credit Union Administration Central Liquidity Facility...

  1. 48 CFR 1652.204-71 - Coordination of Benefits.

    Science.gov (United States)

    2010-10-01

    ... payment of benefits under this contract with the payment of benefits under Medicare, other group health benefits coverages, and the payment of medical and hospital costs under no-fault or other automobile... precedence established by the NAIC Model Guidelines for Coordination of Benefits (COB) as specified by OPM...

  2. TU-AB-204-01: Device Approval Process

    Energy Technology Data Exchange (ETDEWEB)

    Delfino, J. [Food & Drug Administration (United States)

    2016-06-15

    The responsibilities of the Food and Drug Administration (FDA) have increased since the inception of the Food and Drugs Act in 1906. Medical devices first came under comprehensive regulation with the passage of the 1938 Food, Drug, and Cosmetic Act. In 1971 FDA also took on the responsibility for consumer protection against unnecessary exposure to radiation-emitting devices for home and occupational use. However it was not until 1976, under the Medical Device Regulation Act, that the FDA was responsible for the safety and effectiveness of medical devices. This session will be presented by the Division of Radiological Health (DRH) and the Division of Imaging, Diagnostics, and Software Reliability (DIDSR) from the Center for Devices and Radiological Health (CDRH) at the FDA. The symposium will discuss on how we protect and promote public health with a focus on medical physics applications organized into four areas: pre-market device review, post-market surveillance, device compliance, current regulatory research efforts and partnerships with other organizations. The pre-market session will summarize the pathways FDA uses to regulate the investigational use and commercialization of diagnostic imaging and radiation therapy medical devices in the US, highlighting resources available to assist investigators and manufacturers. The post-market session will explain the post-market surveillance and compliance activities FDA performs to monitor the safety and effectiveness of devices on the market. The third session will describe research efforts that support the regulatory mission of the Agency. An overview of our regulatory research portfolio to advance our understanding of medical physics and imaging technologies and approaches to their evaluation will be discussed. Lastly, mechanisms that FDA uses to seek public input and promote collaborations with professional, government, and international organizations, such as AAPM, International Electrotechnical Commission (IEC), Image Gently, and the Quantitative Imaging Biomarkers Alliance (QIBA) among others, to fulfill FDA’s mission will be discussed. Learning Objectives: Understand FDA’s pre-market and post-market review processes for medical devices Understand FDA’s current regulatory research activities in the areas of medical physics and imaging products Understand how being involved with AAPM and other organizations can also help to promote innovative, safe and effective medical devices J. Delfino, nothing to disclose.

  3. 5 CFR 337.204 - Severe shortage of candidates.

    Science.gov (United States)

    2010-01-01

    ..., information about: (1) The results of workforce planning and analysis; (2) Employment trends including the...), effective Mar. 24, 2010. For the convenience of the user, the revised text is set forth as follows: § 337...

  4. 23 CFR 970.204 - Management systems requirements.

    Science.gov (United States)

    2010-04-01

    ... management system outputs to systematically operate, maintain, and upgrade existing transportation assets cost-effectively; (3) A description of each management system; (4) A process to operate and maintain the management systems and their associated databases; and (5) A process for data collection...

  5. 23 CFR 972.204 - Management systems requirements.

    Science.gov (United States)

    2010-04-01

    ... to operate and maintain the management systems and their associated databases; and (5) A process for... analyses and coordination of all management system outputs to systematically operate, maintain, and upgrade...) The management systems shall be operated so investment decisions based on management system outputs...

  6. 23 CFR 971.204 - Management systems requirements.

    Science.gov (United States)

    2010-04-01

    ... of all management systems outputs to systematically operate, maintain, and upgrade existing transportation assets cost-effectively; (3) A description of each management system; (4) A process to operate and maintain the management systems and their associated databases; and (5) A process for data collection...

  7. 29 CFR 1952.204 - Final approval determination.

    Science.gov (United States)

    2010-07-01

    ... production, or the post-harvest processing of agricultural or horticultural commodities. (c) Minnesota is... Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION... agricultural establishment where employees are engaged in “agricultural employment” within the meaning of the...

  8. 27 CFR 555.204 - Inspection of magazines.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Inspection of magazines... of magazines. Any person storing explosive materials shall inspect his magazines at least every seven... been unauthorized entry or attempted entry into the magazines, or unauthorized removal of the contents...

  9. 40 CFR 180.204 - Dimethoate; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... following food commodities: Commodity Parts per million Alfalfa, forage 2.0 Alfalfa, hay 2.0 Bean, dry, seed..., undelinted seed 0.1 Egg 0.02 Endive 2.0 Goat, meat byproducts 0.02 Grapefruit 2.0 Hog, meat byproducts 0.02 Horse, meat byproducts 0.02 Kale 2.0 Lemon 2.0 Lettuce, leaf 2.0 Melon 1.0 Milk 0.002 Mustard greens 2.0...

  10. 44 CFR 204.3 - Definitions used throughout this part.

    Science.gov (United States)

    2010-10-01

    .... The ranking official responsible for overseeing the management of fire operations, planning, logistics... D, E, and F of part 206. Local government. A local government is any county, municipality, city...

  11. All projects related to | Page 204 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-12-21

    Start Date: December 21, 2012. End Date: August 5, 2015. Topic: DATA PROTECTION, CONFIDENTIALITY, Internet, NEWLY INDUSTRIALIZING COUNTRIES, PRIVACY PROTECTION, REGIONAL ANALYSIS, CROSS CULTURAL ANALYSIS, LEGISLATION, POLICY MAKING. Region: North of Sahara, South of Sahara, ...

  12. 14 CFR 1216.204 - General implementation requirements.

    Science.gov (United States)

    2010-01-01

    ... the general public as well as employees. These plans will include the integration of adequate warning... new authorizations or appropriations transmitted to the Office of Management and Budget shall indicate... would not impact the floodplain or wetlands. (ii) The only alternative would be to construct new...

  13. 15 CFR 904.204 - Duties and powers of Judge.

    Science.gov (United States)

    2010-01-01

    ... discretion, having due regard for the convenience and necessity of the parties and witnesses; (d) Schedule... during the proceeding to state his or her position concerning any issue or his or her theory in support...

  14. 48 CFR 204.1202 - Solicitation provision and contract clause.

    Science.gov (United States)

    2010-10-01

    ..., Offeror Representations and Certifications—Commercial Items. (iii) 252.216-7003, Economic Price Adjustment..., Secondary Arab Boycott of Israel. (vii) 252.225-7035, Buy American Act—Free Trade Agreements—Balance of...

  15. WE-E-204-01: ASTRO Based Journals

    International Nuclear Information System (INIS)

    Klein, E.

    2016-01-01

    Research papers authored by Medical Physicists address a large spectrum of oncologic, imaging, or basic research problems; exploit a wide range of physical and engineering methodologies; and often describe the efforts of a multidisciplinary research team. Given dozens of competing journals accepting medical physics articles, it may not be clear to an individual author which journal is the best venue for disseminating their work to the scientific community. Relevant factors usually include the Journal’s audience and scientific impact, but also such factors as perceived acceptance rate, interest in their topic, and quality of service. The purpose of this symposium is to provide the medical physics community with an overview of scope, review processes, and article guidelines for the following journals: Radiology, Medical Physics, International Journal of Radiation Biology and Physics, Journal of Applied Clinical Medical Physics, and Practical Radiation Oncology. Senior members of the editorial board for each journal will provide details as to the journals review process, for example: single blind versus double blind reviews; open access policies, the hierarchy of the review process in terms of editorial board structure; the reality of acceptance, in terms of acceptance rate; and the types of research the journal prefers to publish. Other journals will be discussed as well. The goal is to provide for authors guidance before they begin to write their papers, not only for proper formatting, but also that the readership is appropriate for the particular paper, hopefully increasing the quality and impact of the paper and the likelihood of publication. Learning Objectives: To review each Journal’s submission and review process Guidance as to how to increase quality, impact and chances of acceptance To help decipher which journal is appropriate for a given work A. Karellas, Research collaboration with Koning, Corporation.

  16. 12 CFR 204.6 - Charges for reserve deficiencies.

    Science.gov (United States)

    2010-01-01

    ... negligence or conduct that is inconsistent with the principles and purposes of reserve requirements... individual case and the depository institution's reserve maintenance record. For example, a waiver may be... deficiency. (c) In individual cases, where a Federal supervisory authority waives a liquidity requirement, or...

  17. 48 CFR 52.204-3 - Taxpayer identification.

    Science.gov (United States)

    2010-10-01

    ... (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52... fiscal paying agent in the United States; □ Offeror is an agency or instrumentality of a foreign government; □ Offeror is an agency or instrumentality of the Federal Government. (e) Type of organization...

  18. MO-AB-204-04: Connectathons and Testing

    International Nuclear Information System (INIS)

    Bosch, W.

    2016-01-01

    You’ve experienced the frustration: vendor A’s device claims to work with vendor B’s device, but the practice doesn’t match the promise. Getting devices working together is the hidden art that Radiology and Radiation Oncology staff have to master. To assist with that difficult process, the Integrating the Healthcare Enterprise (IHE) effort was established in 1998, with the coordination of the Radiological Society of North America. Integrating the Healthcare Enterprise (IHE) is a consortium of healthcare professionals and industry partners focused on improving the way computer systems interconnect and exchange information. This is done by coordinating the use of published standards like DICOM and HL7. Several clinical and operational IHE domains exist in the healthcare arena, including Radiology and Radiation Oncology. The ASTRO-sponsored IHE Radiation Oncology (IHE-RO) domain focuses on radiation oncology specific information exchange. This session will explore the IHE Radiology and IHE RO process for; IHE solicitation process for new profiles. Improving the way computer systems interconnect and exchange information in the healthcare enterprise Supporting interconnectivity descriptions and proof of adherence by vendors Testing and assuring the vendor solutions to connectivity problems. Including IHE profiles in RFPs for future software and hardware purchases. Learning Objectives: Understand IHE role in improving interoperability in health care. Understand process of profile development and implantation. Understand how vendors prove adherence to IHE RO profiles. S. Hadley, ASTRO Supported Activity

  19. MO-AB-204-02: IHE RAD

    International Nuclear Information System (INIS)

    Seibert, J.

    2016-01-01

    You’ve experienced the frustration: vendor A’s device claims to work with vendor B’s device, but the practice doesn’t match the promise. Getting devices working together is the hidden art that Radiology and Radiation Oncology staff have to master. To assist with that difficult process, the Integrating the Healthcare Enterprise (IHE) effort was established in 1998, with the coordination of the Radiological Society of North America. Integrating the Healthcare Enterprise (IHE) is a consortium of healthcare professionals and industry partners focused on improving the way computer systems interconnect and exchange information. This is done by coordinating the use of published standards like DICOM and HL7. Several clinical and operational IHE domains exist in the healthcare arena, including Radiology and Radiation Oncology. The ASTRO-sponsored IHE Radiation Oncology (IHE-RO) domain focuses on radiation oncology specific information exchange. This session will explore the IHE Radiology and IHE RO process for; IHE solicitation process for new profiles. Improving the way computer systems interconnect and exchange information in the healthcare enterprise Supporting interconnectivity descriptions and proof of adherence by vendors Testing and assuring the vendor solutions to connectivity problems. Including IHE profiles in RFPs for future software and hardware purchases. Learning Objectives: Understand IHE role in improving interoperability in health care. Understand process of profile development and implantation. Understand how vendors prove adherence to IHE RO profiles. S. Hadley, ASTRO Supported Activity

  20. 42 CFR 51c.204 - Grant evaluation and award.

    Science.gov (United States)

    2010-10-01

    ... to be served; (ii) The nature of the organization applying; and (iii) The organizational structure..., taking into account: (1) The degree to which the proposed project satisfactorily provides for the... the project for development of new and effective methods for health services delivery and management...

  1. Dicty_cDB: SSI204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1997.12.25 Translated Amino Acid sequence itn*nkiny*i*k*nyy*fyylff*hfqywynlkkpill*kpiktmilfsn*LIQKKIQK ARDIL...iny*i*k*nyy*fyylff*hfqywynlkkpill*kpiktmilfsn*LIQKKIQK ARDILSGKETEEVHVMGRIRKSNKDYNPKYSFHIDPDTVTFFSMAIEVCDATA

  2. 41 CFR 50-204.5 - Machine guarding.

    Science.gov (United States)

    2010-07-01

    ... be such that it does not offer an accident hazard in itself. (c) Point of Operation Guarding. (1) Point of operation is the area on a machine where work is actually performed upon the material being... guarding device shall be so designed and constructed so as to prevent the operator from having any part of...

  3. WE-H-204-00: History Committee Symposium

    International Nuclear Information System (INIS)

    2016-01-01

    “William D. Coolidge, Inventor of the Modern X-ray Tube” David J. Allard, M.S., CHP - Director, PA DEP Bureau of Radiation Protection William David Coolidge 1873–1975 was a research scientist and inventor of the modern X-ray tube. Besides Roentgen, with his 1895 discovery and subsequent studies of X-rays, perhaps no other individual contributed more to the advancement of X-ray technology than did Coolidge. He was born in Hudson, MA and received his Bachelor of Science degree from MIT in 1896. That same year he went to Europe to study under renowned physicists of the time. Coolidge received his Ph.D. summa cum laude from the University of Leipzig in 1899 and soon after joined the staff of MIT. While studying at Leipzig, he met Roentgen. In 1905 he was asked to join the newly established General Electric Research Laboratory in Schenectady, NY. He promptly began fundamental work on the production of ductile tungsten filaments as a replacement for fragile carbon filaments used in incandescent light bulbs. This improved light bulb was brought to market by GE in 1911. It was subsequent application of his tungsten work that led Coolidge to his studies in X ray production. Circa 1910, the state-of-the-art X-ray tube was a “gas tube” or “cold cathode” type tube. These crude X-ray tubes relied on residual gas molecules as a source of electrons for bombardment of low to medium atomic number metal targets. In 1912 Coolidge described the use of tungsten as an improved anode target material for X-ray tubes. Shortly after in 1913 he published a paper in Physical Review describing “A Powerful Roentgen Ray Tube With a Pure Electron Discharge.” This tube used a tungsten filament as a thermionic source of electrons under high vacuum to bombard a tungsten anode target. Great improvements in X-ray tube stability, output and performance were obtained with the “hot cathode” or “Coolidge tube.” With some variation in filament and target geometry, this 100 year old invention is the same basic X-ray tube used today in medicine, research and industry. In 1932 Coolidge became Director of the GE Laboratory, then in 1940 Vice-President and Director of Research. In 1941 he was a member of a small committee, appointed by President Franklin D. Roosevelt, to evaluate the military importance of research on uranium. This committee’s report led to the establishment of the Manhattan Engineering District for nuclear weapons development during WWII. Coolidge lived to be over 100 years old, he had 83 patents to his credit, numerous awards and honorary degrees, and in 1975 was elected to the National Inventor’s Hall of Fame. At the time he was the only inventor to receive this honor in his lifetime. Dr. Coolidge was also the first recipient of the AAPM’s highest science award - named in his honor. From notes of a day-long interview with Coolidge’s son Lawrence in the mid-1990s, previous biographies, publications, books, GE literature, historic photographs, e.g., a wonderful 1874 photo stereoview card with 1 year old baby “Willie Coolidge”, and other artifacts in the author’s collection, this presentation will review Dr. Coolidge’s amazing life, work, accomplishments and awards. “History and Archives Resources at AIP for AAPM and its Members” Gregory A. Good, Ph.D. - Director, AIP Center for History of Physics Melanie J. Mueller, MLIS - Acting Director, AIP Niels Bohr Library & Archives The American Institute of Physics established the Center for History of Physics and the Niels Bohr Library & Archives in the 1960s. Our shared mission is: To preserve and make known the history of the physical sciences. This talk will explore the many ways that AIP’s two history programs support the historical and archival activities of AAPM. Topics will include our ongoing oral history program, web outreach through exhibits and teaching guides, and archiving for AAPM and other Member Societies. We will focus in particular on materials in our collections related to the history of medical physics and to the history of AAPM. We will unveil and demonstrate a new “Archives Portal” that we are designing specifically to be useful to AAPM and its members. Learning Objectives: Study the background of the medical physicist - William David Coolidge Examine the time-line for his success Review the publications conceptualizing his works and progressions Realize what he invented Evaluate the importance of the invention Relate the success to national prominence Uncover how he influenced medical physicists today Find out how he was celebrated by the AAPM View the AIP established Center for History of Physics Consider the significant efforts and vision to preserve the history of medical physics Learn about the Niels Bohr Library & Archives Look back in time at medical physics in the 1960s Unveil and demonstrate a new “Archives Portal” that will be useful to AAPM

  4. Dicty_cDB: VHL204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tkywdktsnih**ipqkvlvh*dsrtvamevgir*gvcnnspakwtspeng*r* qwmvdaqslkeviilltcrka*r*RXSLNVNSSGVVFSADLDGSSKYSKEFTL...: ilvpsckdnd*qfrgrnals*fsnservgiilihligf*n*iahvq*kigalsgpflvsr tgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir*gvcnns

  5. 19 CFR 204.1 - Applicability of part.

    Science.gov (United States)

    2010-04-01

    ... thereof no longer exist or may be modified by the President whenever he finds and proclaims that changed... the President, and, if the President agrees that there is reason for such belief, the President shall...

  6. Lithium Superionic Conductor Li{sub 9.42}Si{sub 1.02}P{sub 2.1}S{sub 9.96}O{sub 2.04} with Li{sub 10}GeP{sub 2}S{sub 12}-Type Structure in the Li{sub 2}S–P{sub 2}S{sub 5}–SiO{sub 2} Pseudoternary System: Synthesis, Electrochemical Properties, and Structure–Composition Relationships

    Energy Technology Data Exchange (ETDEWEB)

    Hori, Satoshi [Department of Electronic Chemistry, Interdisciplinary Graduate School of Science and Engineering, Tokyo Institute of Technology, Yokohama (Japan); Suzuki, Kota; Hirayama, Masaaki [Department of Electronic Chemistry, Interdisciplinary Graduate School of Science and Engineering, Tokyo Institute of Technology, Yokohama (Japan); Department of Chemical Science and Engineering, School of Materials and Chemical Technology, Tokyo Institute of Technology, Yokohama (Japan); Kato, Yuki [Department of Electronic Chemistry, Interdisciplinary Graduate School of Science and Engineering, Tokyo Institute of Technology, Yokohama (Japan); Battery Research Division, Higashifuji Technical Center, Toyota Motor Corporation, Susono, Shizuoka (Japan); Battery AT, Advanced Technology 1, Toyota Motor Europe NV/SA, Zaventem (Belgium); Kanno, Ryoji, E-mail: kanno@echem.titech.ac.jp [Department of Electronic Chemistry, Interdisciplinary Graduate School of Science and Engineering, Tokyo Institute of Technology, Yokohama (Japan); Department of Chemical Science and Engineering, School of Materials and Chemical Technology, Tokyo Institute of Technology, Yokohama (Japan)

    2016-12-07

    Lithium superionic conductors with the Li{sub 10}GeP{sub 2}S{sub 12} (LGPS)-type structure are promising materials for use as solid electrolytes in the next-generation lithium batteries. A novel member of the LGPS family, Li{sub 9.42}Si{sub 1.02}P{sub 2.1}S{sub 9.96}O{sub 2.04} (LSiPSO), and its solid solutions were synthesized by quenching from 1273 K in the Li{sub 2}S–P{sub 2}S{sub 5}–SiO{sub 2} pseudoternary system. The material exhibited an ionic conductivity as high as 3.2 × 10{sup −4} S cm{sup −1} at 298 K, as well as the high electrochemical stability to lithium metal, which was improved by the introduction of oxygen into the LGPS-type structure. An all-solid-state cell with a lithium metal anode and LSiPSO as the separator showed excellent performance with a high reversibility of 100%. Thus, oxygen doping is an effective way of improving the electrochemical stability of LGPS-type structure.

  7. MO-FG-204-04: How Iterative Reconstruction Algorithms Affect the NPS of CT Images

    International Nuclear Information System (INIS)

    Li, G; Liu, X; Dodge, C; Jensen, C; Rong, J

    2015-01-01

    Purpose: To evaluate how the third generation model based iterative reconstruction (MBIR) compares with filtered back-projection (FBP), adaptive statistical iterative reconstruction (ASiR), and the second generation MBIR based on noise power spectrum (NPS) analysis over a wide range of clinically applicable dose levels. Methods: The Catphan 600 CTP515 module, surrounded by an oval, fat-equivalent ring to mimic patient size/shape, was scanned on a GE HD750 CT scanner at 1, 2, 3, 6, 12 and 19mGy CTDIvol levels with typical patient scan parameters: 120kVp, 0.8s, 40mm beam width, large SFOV, 0.984 pitch and reconstructed thickness 2.5mm (VEO3.0: Abd/Pelvis with Texture and NR05). At each CTDIvol level, 10 repeated scans were acquired for achieving sufficient data sampling. The images were reconstructed using Standard kernel with FBP; 20%, 40% and 70% ASiR; and two versions of MBIR (VEO2.0 and 3.0). For evaluating the effect of the ROI spatial location to the Result of NPS, 4 ROI groups were categorized based on their distances from the center of the phantom. Results: VEO3.0 performed inferiorly comparing to VEO2.0 over all dose levels. On the other hand, at low dose levels (less than 3 mGy), it clearly outperformed ASiR and FBP, in NPS values. Therefore, the lower the dose level, the relative performance of MBIR improves. However, the shapes of the NPS show substantial differences in horizontal and vertical sampling dimensions. These differences may determine the characteristics of the noise/texture features in images, and hence, play an important role in image interpretation. Conclusion: The third generation MBIR did not improve over the second generation MBIR in term of NPS analysis. The overall performance of both versions of MBIR improved as compared to other reconstruction algorithms when dose was reduced. The shapes of the NPS curves provided additional value for future characterization of the image noise/texture features

  8. MO-DE-204-00: International Symposium: Patient Dose Reduction in Diagnostic Radiology

    International Nuclear Information System (INIS)

    2016-01-01

    The main topic of the session is to show how dose optimization is being implemented in various regions of the world, including Europe, Australia, North America and other regions. A multi-national study conducted under International Atomic Energy Agency (IAEA) across more than 50 less resourced countries gave insight into patient radiation doses and safety practices in CT, mammography, radiography and interventional procedures, both for children and adults. An important outcome was the capability development on dose assessment and management. An overview of recent European projects related to CT radiation dose and optimization both to adults and children will be presented. Existing data on DRLs together with a European methodology proposed on establishing and using DRLs for paediatric radiodiagnostic imaging and interventional radiology practices will be shown. Compared with much of Europe at least, many Australian imaging practices are relatively new to the task of diagnostic imaging dose optimisation. In 2008 the Australian Government prescribed a requirement to periodically compare patient radiation doses with diagnostic reference levels (DRLs), where DRLs have been established. Until recently, Australia had only established DRLs for computed tomography (CT). Regardless, both professional society and individual efforts to improved data collection and develop optimisation strategies across a range of modalities continues. Progress in this field, principally with respect to CT and interventional fluoroscopy will be presented. In the US, dose reduction and optimization efforts for computed tomography have been promoted and mandated by several organizations and accrediting entities. This presentation will cover the general motivation, implementation, and implications of such efforts. Learning Objectives: Understand importance of the dose optimization in Diagnostic Radiology. See how this goal is achieved in different regions of the World. Learn about the global trend in the dose optimization and future prospectives. M. Rehani, The work was a part of the work of IAEA where I was an employee and IAEA is a United Nations organization

  9. TH-EF-204-04: Experience of IMRT and Other Conformal Techniques in Russia

    International Nuclear Information System (INIS)

    Krylova, T.

    2016-01-01

    Joanna E. Cygler, Jan Seuntjens, J. Daniel Bourland, M. Saiful Huq, Josep Puxeu Vaque, Daniel Zucca Aparicio, Tatiana Krylova, Yuri Kirpichev, Eric Ford, Caridad Borras Stereotactic Radiation Therapy (SRT) utilizes small static and dynamic (IMRT) fields, to successfully treat malignant and benign diseases using techniques such as Stereotactic Radiosurgery (SRS) and Stereotactic Body Radiation Therapy (SBRT). SRT is characterized by sharp dose gradients for individual fields and their resultant dose distributions. For appropriate targets, small field radiotherapy offers improved treatment quality by allowing better sparing of organs at risk while delivering the prescribed target dose. Specialized small field treatment delivery systems, such as robotic-controlled linear accelerators, gamma radiosurgery units, and dynamic arc linear accelerators may utilize rigid fixation, image guidance, and tumor tracking, to insure precise dose delivery to static or moving targets. However, in addition to great advantages, small field delivery techniques present special technical challenges for dose calibration due to unique geometries and small field sizes not covered by existing reference dosimetry protocols such as AAPM TG-51 or IAEA TRS 398. In recent years extensive research has been performed to understand small field dosimetry and measurement instrumentation. AAPM, IAEA and ICRU task groups are expected to provide soon recommendations on the dosimetry of small radiation fields. In this symposium we will: 1] discuss the physics, instrumentation, methodologies and challenges for small field radiation dose measurements; 2] review IAEA and ICRU recommendations on prescribing, recording and reporting of small field radiation therapy; 3] discuss selected clinical applications and technical aspects for specialized image-guided, small field, linear accelerator based treatment techniques such as IMRT and SBRT. Learning Objectives: To learn the physics of small fields in contrast to dosimetry of conventional fields To learn about detectors suitable for small fields To learn about the role of Monte Carlo simulations in determination of small field output factors To provide an overview of the IAEA small field dosimetry recommendations To provide an overview of the content of the ICRU report on Prescribing, Reporting and Recording of Small Field Radiation Therapy. To learn about special technical considerations in delivering IMRT and SBRT treatments To appreciate specific challenges of IMRT implementation J. Seuntjens, Natural Sciences and Engineering Research Council; Canadian Institutes of Health Research

  10. TH-EF-204-04: Experience of IMRT and Other Conformal Techniques in Russia

    Energy Technology Data Exchange (ETDEWEB)

    Krylova, T. [Russian Research Cancer Center (Russian Federation)

    2016-06-15

    Joanna E. Cygler, Jan Seuntjens, J. Daniel Bourland, M. Saiful Huq, Josep Puxeu Vaque, Daniel Zucca Aparicio, Tatiana Krylova, Yuri Kirpichev, Eric Ford, Caridad Borras Stereotactic Radiation Therapy (SRT) utilizes small static and dynamic (IMRT) fields, to successfully treat malignant and benign diseases using techniques such as Stereotactic Radiosurgery (SRS) and Stereotactic Body Radiation Therapy (SBRT). SRT is characterized by sharp dose gradients for individual fields and their resultant dose distributions. For appropriate targets, small field radiotherapy offers improved treatment quality by allowing better sparing of organs at risk while delivering the prescribed target dose. Specialized small field treatment delivery systems, such as robotic-controlled linear accelerators, gamma radiosurgery units, and dynamic arc linear accelerators may utilize rigid fixation, image guidance, and tumor tracking, to insure precise dose delivery to static or moving targets. However, in addition to great advantages, small field delivery techniques present special technical challenges for dose calibration due to unique geometries and small field sizes not covered by existing reference dosimetry protocols such as AAPM TG-51 or IAEA TRS 398. In recent years extensive research has been performed to understand small field dosimetry and measurement instrumentation. AAPM, IAEA and ICRU task groups are expected to provide soon recommendations on the dosimetry of small radiation fields. In this symposium we will: 1] discuss the physics, instrumentation, methodologies and challenges for small field radiation dose measurements; 2] review IAEA and ICRU recommendations on prescribing, recording and reporting of small field radiation therapy; 3] discuss selected clinical applications and technical aspects for specialized image-guided, small field, linear accelerator based treatment techniques such as IMRT and SBRT. Learning Objectives: To learn the physics of small fields in contrast to dosimetry of conventional fields To learn about detectors suitable for small fields To learn about the role of Monte Carlo simulations in determination of small field output factors To provide an overview of the IAEA small field dosimetry recommendations To provide an overview of the content of the ICRU report on Prescribing, Reporting and Recording of Small Field Radiation Therapy. To learn about special technical considerations in delivering IMRT and SBRT treatments To appreciate specific challenges of IMRT implementation J. Seuntjens, Natural Sciences and Engineering Research Council; Canadian Institutes of Health Research.

  11. MO-FG-204-02: Reference Image Selection in the Presence of Multiple Scan Realizations

    Energy Technology Data Exchange (ETDEWEB)

    Ruan, D; Dou, T; Thomas, D; Low, D [Deparment of Radiation Oncology, University of California Los Angeles, Los Angeles, CA (United States)

    2015-06-15

    Purpose: Fusing information from multiple correlated realizations (e.g., 4DCT) can improve image quality. This process often involves ill-conditioned and asymmetric nonlinear registration and the proper selection of a reference image is important. This work proposes to examine post-registration variation indirectly for such selection, and develops further insights to reduce the number of cross-registrations needed. Methods: We consider each individual scan as a noisy point in the vicinity of an image manifold, related by motion. Nonrigid registration “transports” a scan along the manifold to the reference neighborhood, and the residual is a surrogate for local variation. To test this conjecture, 10 thoracic scans from the same session were reconstructed from a recently developed low-dose helical 4DCT protocol. Pairwise registration was repeated bi-directionally (81 times) and fusion was performed with each candidate reference. The fused image quality was assessed with SNR and CNR. Registration residuals in SSD, harmonic energy, and deformation Jacobian behavior were examined. The semi-symmetry is further utilized to reduce the number of registration needed. Results: The comparison of image quality between single image and fused ones identified reduction of local intensity variance as the major contributor of image quality, boosting SNR and CNR by 5 to 7 folds. This observation further suggests the criticality of good agreement across post-registration images. Triangle inequality on the SSD metric provides a proficient upper-bound and surrogate on such disagreement. Empirical observation also confirms that fused images with high residual SSD have lower SNR and CNR than the ones with low or intermediate SSDs. Registration SSD is structurally close enough to symmetry for reduced computation. Conclusion: Registration residual is shown to be a good predictor of post-fusion image quality and can be used to identify good reference centers. Semi-symmetry of the registration residual further reduces computation cost. Supported by in part by NIH R01 CA096679.

  12. 7 CFR 1744.204 - Rural development investments that do not meet the ratio requirements.

    Science.gov (United States)

    2010-01-01

    ... RUS's approval, the portion of any investment of funds or commitment to invest funds for any rural... loan, guarantee, stock purchase or equity investment; (2) A reasonable estimate of the amount the...

  13. Financing State Governments in Nigeria, 1980-2007 (Pp. 204-215)

    African Journals Online (AJOL)

    Nekky Umera

    distribution function of economics and it concerns itself with the way in .... State governments should not be discriminatory in bringing to book ... Baumol, William J. (1965), Welfare Economics 2nd Ed., Cambridge , Harvard University Press.

  14. TU-EF-204-02: Hiigh Quality and Sub-MSv Cerebral CT Perfusion Imaging

    International Nuclear Information System (INIS)

    Li, Ke; Niu, Kai; Wu, Yijing; Chen, Guang-Hong

    2015-01-01

    Purpose: CT Perfusion (CTP) imaging is of great importance in acute ischemic stroke management due to its potential to detect hypoperfused yet salvageable tissue and distinguish it from definitely unsalvageable tissue. However, current CTP imaging suffers from poor image quality and high radiation dose (up to 5 mSv). The purpose of this work was to demonstrate that technical innovations such as Prior Image Constrained Compressed Sensing (PICCS) have the potential to address these challenges and achieve high quality and sub-mSv CTP imaging. Methods: (1) A spatial-temporal 4D cascaded system model was developed to indentify the bottlenecks in the current CTP technology; (2) A task-based framework was developed to optimize the CTP system parameters; (3) Guided by (1) and (2), PICCS was customized for the reconstruction of CTP source images. Digital anthropomorphic perfusion phantoms, animal studies, and preliminary human subject studies were used to validate and evaluate the potentials of using these innovations to advance the CTP technology. Results: The 4D cascaded model was validated in both phantom and canine stroke models. Based upon this cascaded model, it has been discovered that, as long as the spatial resolution and noise properties of the 4D source CT images are given, the 3D MTF and NPS of the final CTP maps can be analytically derived for a given set of processing methods and parameters. The cascaded model analysis also identified that the most critical technical factor in CTP is how to acquire and reconstruct high quality source images; it has very little to do with the denoising techniques often used after parametric perfusion calculations. This explained why PICCS resulted in a five-fold dose reduction or substantial improvement in image quality. Conclusion: Technical innovations generated promising results towards achieving high quality and sub-mSv CTP imaging for reliable and safe assessment of acute ischemic strokes. K. Li, K. Niu, Y. Wu: Nothing to disclose. G.-H. Chen: Research funded, GE Healthcare; Research funded, Siemens AX

  15. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (204a-0613-332211)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  16. 25 CFR 161.204 - How are carrying capacities and stocking rates established?

    Science.gov (United States)

    2010-04-01

    ... be based on forage production, range utilization, the application of land management practices, and range improvements in place to achieve uniformity of grazing under sustained yield management principles... agricultural resource management plan and range unit management plan. (b) BIA, with the concurrence of the...

  17. CLOSURE REPORT FOR CORRECTIVE ACTION UNIT 204: STORAGE BUNKERS, NEVADA TEST SITE, NEVADA

    International Nuclear Information System (INIS)

    2006-01-01

    Corrective Action Unit (CAU) 330 consists of four Corrective Action Sites (CASs) located in Areas 6, 22, and 23 of the Nevada Test Site (NTS). The unit is listed in the Federal Facility Agreement and Consent Order (FFACO, 1996) as CAU 330: Areas 6, 22, and 23 Tanks and Spill Sites. CAU 330 consists of the following CASs: CAS 06-02-04, Underground Storage Tank (UST) and Piping CAS 22-99-06, Fuel Spill CAS 23-01-02, Large Aboveground Storage Tank (AST) Farm CAS 23-25-05, Asphalt Oil Spill/Tar Release

  18. WE-D-204-02: Errors and Process Improvements in Radiation Therapy

    International Nuclear Information System (INIS)

    Fontenla, D.

    2016-01-01

    Speakers in this session will present overview and details of a specific rotation or feature of their Medical Physics Residency Program that is particularly exceptional and noteworthy. The featured rotations include foundational topics executed with exceptional acumen and innovative educational rotations perhaps not commonly found in Medical Physics Residency Programs. A site-specific clinical rotation will be described, where the medical physics resident follows the physician and medical resident for two weeks into patient consultations, simulation sessions, target contouring sessions, planning meetings with dosimetry, patient follow up visits, and tumor boards, to gain insight into the thought processes of the radiation oncologist. An incident learning rotation will be described where the residents learns about and practices evaluating clinical errors and investigates process improvements for the clinic. The residency environment at a Canadian medical physics residency program will be described, where the training and interactions with radiation oncology residents is integrated. And the first month rotation will be described, where the medical physics resident rotates through the clinical areas including simulation, dosimetry, and treatment units, gaining an overview of the clinical flow and meeting all the clinical staff to begin the residency program. This session will be of particular interest to residency programs who are interested in adopting or adapting these curricular ideas into their programs and to residency candidates who want to learn about programs already employing innovative practices. Learning Objectives: To learn about exceptional and innovative clinical rotations or program features within existing Medical Physics Residency Programs. To understand how to adopt/adapt innovative curricular designs into your own Medical Physics Residency Program, if appropriate.

  19. WE-E-204-03: Radiology and Other Imaging Journals

    International Nuclear Information System (INIS)

    Karellas, A.

    2016-01-01

    Research papers authored by Medical Physicists address a large spectrum of oncologic, imaging, or basic research problems; exploit a wide range of physical and engineering methodologies; and often describe the efforts of a multidisciplinary research team. Given dozens of competing journals accepting medical physics articles, it may not be clear to an individual author which journal is the best venue for disseminating their work to the scientific community. Relevant factors usually include the Journal’s audience and scientific impact, but also such factors as perceived acceptance rate, interest in their topic, and quality of service. The purpose of this symposium is to provide the medical physics community with an overview of scope, review processes, and article guidelines for the following journals: Radiology, Medical Physics, International Journal of Radiation Biology and Physics, Journal of Applied Clinical Medical Physics, and Practical Radiation Oncology. Senior members of the editorial board for each journal will provide details as to the journals review process, for example: single blind versus double blind reviews; open access policies, the hierarchy of the review process in terms of editorial board structure; the reality of acceptance, in terms of acceptance rate; and the types of research the journal prefers to publish. Other journals will be discussed as well. The goal is to provide for authors guidance before they begin to write their papers, not only for proper formatting, but also that the readership is appropriate for the particular paper, hopefully increasing the quality and impact of the paper and the likelihood of publication. Learning Objectives: To review each Journal’s submission and review process Guidance as to how to increase quality, impact and chances of acceptance To help decipher which journal is appropriate for a given work A. Karellas, Research collaboration with Koning, Corporation.

  20. WE-E-204-00: Where to Send My Manuscript

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2016-06-15

    Research papers authored by Medical Physicists address a large spectrum of oncologic, imaging, or basic research problems; exploit a wide range of physical and engineering methodologies; and often describe the efforts of a multidisciplinary research team. Given dozens of competing journals accepting medical physics articles, it may not be clear to an individual author which journal is the best venue for disseminating their work to the scientific community. Relevant factors usually include the Journal’s audience and scientific impact, but also such factors as perceived acceptance rate, interest in their topic, and quality of service. The purpose of this symposium is to provide the medical physics community with an overview of scope, review processes, and article guidelines for the following journals: Radiology, Medical Physics, International Journal of Radiation Biology and Physics, Journal of Applied Clinical Medical Physics, and Practical Radiation Oncology. Senior members of the editorial board for each journal will provide details as to the journals review process, for example: single blind versus double blind reviews; open access policies, the hierarchy of the review process in terms of editorial board structure; the reality of acceptance, in terms of acceptance rate; and the types of research the journal prefers to publish. Other journals will be discussed as well. The goal is to provide for authors guidance before they begin to write their papers, not only for proper formatting, but also that the readership is appropriate for the particular paper, hopefully increasing the quality and impact of the paper and the likelihood of publication. Learning Objectives: To review each Journal’s submission and review process Guidance as to how to increase quality, impact and chances of acceptance To help decipher which journal is appropriate for a given work A. Karellas, Research collaboration with Koning, Corporation.

  1. WE-E-204-02: Journal of Medical Physics and JACMP

    Energy Technology Data Exchange (ETDEWEB)

    Williamson, J. [Virginia Commonwealth University (United States)

    2016-06-15

    Research papers authored by Medical Physicists address a large spectrum of oncologic, imaging, or basic research problems; exploit a wide range of physical and engineering methodologies; and often describe the efforts of a multidisciplinary research team. Given dozens of competing journals accepting medical physics articles, it may not be clear to an individual author which journal is the best venue for disseminating their work to the scientific community. Relevant factors usually include the Journal’s audience and scientific impact, but also such factors as perceived acceptance rate, interest in their topic, and quality of service. The purpose of this symposium is to provide the medical physics community with an overview of scope, review processes, and article guidelines for the following journals: Radiology, Medical Physics, International Journal of Radiation Biology and Physics, Journal of Applied Clinical Medical Physics, and Practical Radiation Oncology. Senior members of the editorial board for each journal will provide details as to the journals review process, for example: single blind versus double blind reviews; open access policies, the hierarchy of the review process in terms of editorial board structure; the reality of acceptance, in terms of acceptance rate; and the types of research the journal prefers to publish. Other journals will be discussed as well. The goal is to provide for authors guidance before they begin to write their papers, not only for proper formatting, but also that the readership is appropriate for the particular paper, hopefully increasing the quality and impact of the paper and the likelihood of publication. Learning Objectives: To review each Journal’s submission and review process Guidance as to how to increase quality, impact and chances of acceptance To help decipher which journal is appropriate for a given work A. Karellas, Research collaboration with Koning, Corporation.

  2. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (204c-0613-332211)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  3. 48 CFR 1852.204-76 - Security requirements for unclassified information technolocgy resources.

    Science.gov (United States)

    2010-10-01

    ... subcontractors must obtain physical or electronic (i.e., authentication level 2 and above as defined in National Institute of Standards and Technology (NIST) Special Publication (SP) 800-63, Electronic Authentication... shall be updated on a yearly basis. (iii) The FIPS 199 assessment shall identify all information types...

  4. Sexospécificités | Page 204 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Panama's Darién National Park is the largest national park in Central America and a UNESCO World Heritage site. Within the park three distinct groups of Indigenous people — the Emberá, the Kuna, and the Wounaan — live a lifestyle that has been largely unchanged for centuries. Catherine Potvin, a researcher at McGill ...

  5. TH-A-204-01: Part I - Key Data for Ionizing-Radiation Dosimetry

    Energy Technology Data Exchange (ETDEWEB)

    Seltzer, S. [National Institute of Standards & Technology (United States)

    2016-06-15

    The ICRU is currently finalizing a report on key data for radiation dosimetry. This multi-year review has resulted in a number of recommendations regarding “fundamental” data that are used in dosimetry related to radiation therapy. This educational session will explain the background for the ICRU committee’s work, the content and conclusions of the report and the impact on outputs, including NIST primary standards, ADCL calibration coefficients and clinical reference dosimetry. Parameters and beam modalities potentially affected by this report include: The mean excitation energy, I, for graphite, air, and water, The average energy required to create an ion pair in dry air (commonly referred to as W/e), The uncertainty in the determination of air kerma in kV x-rays The absolute value of Co-60 and Cs-137 primary standards and the dissemination of calibration coefficients, The determination of air kerma strength for Ir-192 HDR brachytherapy sources Ion chamber kQ factors for linac MV beams Ion chamber kQ factors for proton beams. The changes in reference dosimetry that would result from adoption of the ICRU recommendations are of the order of 0.5% to 1%, an effect that will not impact clinical dose delivery but will be detectable in the clinical setting. This session will also outline how worldwide metrology is coordinated through the Convention of the Meter and therefore how the international dosimetry community will proceed with adopting these recommendations so that uniformity from country to country in reference dosimetry is maintained. Timelines and communications methods will also be discussed to ensure that users, such as clinical medical physicists, are not surprised when their chamber’s calibration coefficient apparently changes. Learning Objectives: Understand the background for the ICRU committee’s work on key dosimetry data. Understand the proposed changes to key data and the impacts on reference dosimetry. Understand the methodology and timeline for adoption of the ICRU recommendations.

  6. TH-A-204-00: Key Dosimetry Data - Impact of New ICRU Recommendations

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2016-06-15

    The ICRU is currently finalizing a report on key data for radiation dosimetry. This multi-year review has resulted in a number of recommendations regarding “fundamental” data that are used in dosimetry related to radiation therapy. This educational session will explain the background for the ICRU committee’s work, the content and conclusions of the report and the impact on outputs, including NIST primary standards, ADCL calibration coefficients and clinical reference dosimetry. Parameters and beam modalities potentially affected by this report include: The mean excitation energy, I, for graphite, air, and water, The average energy required to create an ion pair in dry air (commonly referred to as W/e), The uncertainty in the determination of air kerma in kV xrays The absolute value of Co-60 and Cs-137 primary standards and the dissemination of calibration coefficients, The determination of air kerma strength for Ir-192 HDR brachytherapy sources Ion chamber kQ factors for linac MV beams Ion chamber kQ factors for proton beams. The changes in reference dosimetry that would result from adoption of the ICRU recommendations are of the order of 0.5% to 1%, an effect that will not impact clinical dose delivery but will be detectable in the clinical setting. This session will also outline how worldwide metrology is coordinated through the Convention of the Meter and therefore how the international dosimetry community will proceed with adopting these recommendations so that uniformity from country to country in reference dosimetry is maintained. Timelines and communications methods will also be discussed to ensure that users, such as clinical medical physicists, are not surprised when their chamber’s calibration coefficient apparently changes. Learning Objectives: Understand the background for the ICRU committee’s work on key dosimetry data. Understand the proposed changes to key data and the impacts on reference dosimetry. Understand the methodology and timeline for adoption of the ICRU recommendations.

  7. TH-A-204-02: Part II - Worldwide Radiation Metrology

    Energy Technology Data Exchange (ETDEWEB)

    McEwen, M. [National Research Council, Washington, DC (United States)

    2016-06-15

    The ICRU is currently finalizing a report on key data for radiation dosimetry. This multi-year review has resulted in a number of recommendations regarding “fundamental” data that are used in dosimetry related to radiation therapy. This educational session will explain the background for the ICRU committee’s work, the content and conclusions of the report and the impact on outputs, including NIST primary standards, ADCL calibration coefficients and clinical reference dosimetry. Parameters and beam modalities potentially affected by this report include: The mean excitation energy, I, for graphite, air, and water, The average energy required to create an ion pair in dry air (commonly referred to as W/e), The uncertainty in the determination of air kerma in kV x-rays The absolute value of Co-60 and Cs-137 primary standards and the dissemination of calibration coefficients, The determination of air kerma strength for Ir-192 HDR brachytherapy sources Ion chamber kQ factors for linac MV beams Ion chamber kQ factors for proton beams. The changes in reference dosimetry that would result from adoption of the ICRU recommendations are of the order of 0.5% to 1%, an effect that will not impact clinical dose delivery but will be detectable in the clinical setting. This session will also outline how worldwide metrology is coordinated through the Convention of the Meter and therefore how the international dosimetry community will proceed with adopting these recommendations so that uniformity from country to country in reference dosimetry is maintained. Timelines and communications methods will also be discussed to ensure that users, such as clinical medical physicists, are not surprised when their chamber’s calibration coefficient apparently changes. Learning Objectives: Understand the background for the ICRU committee’s work on key dosimetry data. Understand the proposed changes to key data and the impacts on reference dosimetry. Understand the methodology and timeline for adoption of the ICRU recommendations.

  8. TH-C-204-01: Vision for Medical Physics and Status of Current Initiatives

    International Nuclear Information System (INIS)

    Williamson, J.

    2016-01-01

    In this presentation, the Editors will outline our vision for the future of Medical Physics and review recent work-in-progress initiatives to implement this vision. Finally, we will close with guidance to authors on how to write a good Medical Physics paper. A major focus will be the transition to a new publisher in 2017 following a more than 40-year association with American Institute of Physics Publishing (AIPP). Vision for Medical Physics and status of current initiatives: Jeff Williamson, Editor-in-Chief The broad vision of Medical Physics is “to continue the Journal’s tradition of publishing the very best science that propels our discipline forward and improves our contribution to patient care.” More concretely, the Journal should be the preeminent forum for exchange of cutting edge medical physics science. We seek to identify the best contributions in (a) high impact clinical physics innovations; (b) clinical translation and validation of basic science innovations; and (c) cutting edge basic science developments with potential for patient care improvements. Among the challenges and opportunities, we face are: electronic-only and open access publishing; competition from new radiological science journals; trends towards more interactive, social-media based scientific communities; and diversification of the medical physics research, authorship, and readership domains, including clinical applications quite foreign to core ABR clinical competencies. Recently implemented and ongoing initiatives include: Revised Table of Contents (TOC) and more contemporary topical submission categories Structured review template in HTML format Comprehensive hierarchical taxonomy for identifying reviewer expertise Formal process for soliciting high quality and impact Review and Vision 20/20 Articles We have recruited four Review Article Co-editors: John Rowlands and Ingrid Reiser (imaging physics) and Joao Seco and Tim Zhu (therapy physics). The Co-Editors will identify timely topics and solicit high profile authors to submit review manuscripts. To submit an article, authors will need to work with an assigned Co-Editor to develop a mutually acceptable outline and abstract. 5) A new and exciting class of articles: Medical Physics Dataset Articles (MPDAs) MPDAs describe scientifically or clinically valuable open-access datasets with high potential for contributing to the research of medical physicists working on related problems. In contrast to Research Articles, MPDAs should not include hypothesis testing; or data analyses supporting generalizable conclusions. The publically accessible dataset must be permanently archived before the MPDA can be published. This initiative is being led by Joe Deasy. Update on new publisher transition: The transition of AAPM scientific publishing operations to a major publishing house is a major opportunity to expand Medical Physics readership and its scholarly impact. The advantages include: (a) common manuscript management and web hosting platforms for Medical Physics and its sister journal, JACMP; (b) greater than 4-fold expansion of subscribing institutions; and (c) resources to mount data-driven, highly targeted marketing campaigns to enhance citation and download rates. A transition update of this epochal development, which has only begun as of this writing (3/31/16), will be given. Improving manuscript quality via structured reviews, enhanced scientific category taxonomy, and outreach: Shiva Das, Therapy Physics Editor Medical Physics is committed to continuous improvement with the ultimate goal of improving the potential impact of accepted manuscripts. In order to do so, Medical Physics must be able to tap into important/emerging areas and be able to select high quality contributions consistently via discerning reviews. Improving the quality of reviews is crucial to selecting high quality manuscripts and also to improving manuscript impact via feedback in the review process. With this in mind, Medical Physics is in the process of: (a) fostering outreach to important areas that are currently underrepresented in Medical Physics; (b) implementing a structured template review form; and (c) implementing a comprehensive scientific category taxonomy to identify reviewers who are best suited to an article. Outreach efforts have begun to various scientific areas. Strategies to increase submissions from these areas will be discussed. As a consequence of this effort, a special issue on particle therapy is under development. A review template was implemented in late 2014 on a limited test basis. Based on reviewer feedback, the template was restructured and shortened to capture essential review elements. The restructured template is due to be released shortly. The new scientific category taxonomy is in the process of being deployed to reviewers and associate editors. Salient aspects of the structured review template and scientific category taxonomy will be discussed in this talk. Writing good scientific papers and responding to critiques: Mitch Goodsitt, Imaging Physics Editor The essential components of the abstract, introduction, methods, discussion and conclusion sections of manuscripts, as well as the desired writing style and style of the figures and tables will be reviewed. Publishable Medical Physics manuscripts must include clear and concise statements of the novelty and clinical and/or scientific importance of the authors’ work. Examples of novelty include: new technical solution to an important clinical problem; new generalizable knowledge; and first demonstration that an existing engineering solution solves a clinical problem. Please note that we encourage authors of recently published conference proceedings (e.g., SPIE, IEEE) papers on novel medical physics related work to submit more substantial versions of that work to our journal. All submissions must include: sufficient background information and rationale; enough detail for others to reproduce the authors’ work; sufficient statistical analysis to refute or validate the authors’ hypotheses; a description of how the present work compares to, is distinct from, and improves upon others’ work; and sections devoted to the limitations of the study and future directions. Writing should be polished. Poor wording, grammar and composition frustrate the review process. Our journal does not have copyeditors for revising manuscripts. When authors receive critiques from the referees and associate editor, the authors should provide a detailed point-by-point response to each comment. The authors’ rebuttal should include the text of the original criticism, the authors’ response, and a pasted copy of the modified text along with the line numbers in the revised article. The new text should be highlighted in a different font color in the revised submission. Following these recommendations will improve submissions and facilitate the review process.

  9. The critical release rates for the dissociating gas N204/N02/N0

    International Nuclear Information System (INIS)

    Porter, W.H.L.

    1979-03-01

    Dissociating vapour systems have certain characteristics which make them attractive as coolants, notably a large effective specific heat which is significantly greater than that for the individual components of the gas mixture, and also an enhanced boundary layer heat transfer coefficient resulting from the physical characteristics of thermal dissociation. In part these effects ensure that a dissociating gas has a greatly improved thermal capacity and heat transfer capability when compared with most inert gases. In this report the critical release rates for the dissociating vapour system N 2 0 4 -N0 2 -N0 are established, principally in the two phase region, and the thermodynamics of nitrogen tetroxide are examined. (U.K.)

  10. MO-F-204-03: Preparing for Part 3 of the ABR Diagnostic Physics Exam

    International Nuclear Information System (INIS)

    Zambelli, J.

    2016-01-01

    Adequate, efficient preparation for the ABR Diagnostic and Nuclear Medical Physics exams is key to successfully obtain ABR certification. Each part of the ABR exam presents its own challenges: Part I: Determine the scope of basic medical physics study material, efficiently review this material, and solve related written questions/problems. Part II: Understand imaging principles, modalities, and systems, including image acquisition, processing, and display. Understand the relationship between imaging techniques, image quality, patient dose and safety, and solve related written questions/problems. Part III: Gain crucial, practical, clinical medical physics experience. Effectively communicate and explain the practice, performance, and significance of all aspects of clinical medical physics. All parts of the ABR exam require specific skill sets and preparation: mastery of basic physics and imaging principles; written problem solving often involving rapid calculation; responding clearly and succinctly to oral questions about the practice, methods, and significance of clinical medical physics. This symposium focuses on the preparation necessary for each part of the ABR exam. Although there is some overlap, the nuclear exam covers a different body of knowledge than the diagnostic exam. A separate speaker will address those unique aspects of the nuclear exam, and how preparing for a second specialty differs from the first. Medical physicists who recently completed each ABR exam portion will share their experiences, insights, and preparation methods to help attendees best prepare for the challenges of each part of the ABR exam. In accordance with ABR exam security policy, no recalls or exam questions will be discussed. Learning Objectives: How to prepare for Part 1 of the ABR exam by determining the scope of basic medical physics study material and related problem solving/calculations How to prepare for Part 2 of the ABR exam by understanding diagnostic and/or nuclear imaging physics, systems, dosimetry, safety and related problem solving/calculations How to prepare for Part 3 of the ABR exam by effectively communicating the practice, methods, and significance of clinical diagnostic and/or nuclear medical physics.

  11. CWSP Certified Wireless Security Professional Official Study Guide, Exam PW0-204

    CERN Document Server

    Coleman, David D; Harkins, Bryan E

    2010-01-01

    Sybex is now the official publisher for Certified Wireless Network Professional, the certifying vendor for the CWSP program. This guide covers all exam objectives, including WLAN discovery techniques, intrusion and attack techniques, 802.11 protocol analysis. Wireless intrusion-prevention systems implementation, layer 2 and 3 VPNs used over 802.11 networks, and managed endpoint security systems. It also covers enterprise/SMB/SOHO/Public-Network Security design models and security solution implementation, building robust security networks, wireless LAN management systems, and much more.

  12. 41 CFR 101-39.204 - Obtaining motor vehicles for indefinite assignment.

    Science.gov (United States)

    2010-07-01

    ..., TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.2-GSA Interagency Fleet Management... related services of the GSA Interagency Fleet Management System (IFMS) are provided to requesting agencies... have been consolidated into the supporting GSA IFMS fleet management center, and no agency-owned...

  13. WE-E-204-02: Journal of Medical Physics and JACMP

    International Nuclear Information System (INIS)

    Williamson, J.

    2016-01-01

    Research papers authored by Medical Physicists address a large spectrum of oncologic, imaging, or basic research problems; exploit a wide range of physical and engineering methodologies; and often describe the efforts of a multidisciplinary research team. Given dozens of competing journals accepting medical physics articles, it may not be clear to an individual author which journal is the best venue for disseminating their work to the scientific community. Relevant factors usually include the Journal’s audience and scientific impact, but also such factors as perceived acceptance rate, interest in their topic, and quality of service. The purpose of this symposium is to provide the medical physics community with an overview of scope, review processes, and article guidelines for the following journals: Radiology, Medical Physics, International Journal of Radiation Biology and Physics, Journal of Applied Clinical Medical Physics, and Practical Radiation Oncology. Senior members of the editorial board for each journal will provide details as to the journals review process, for example: single blind versus double blind reviews; open access policies, the hierarchy of the review process in terms of editorial board structure; the reality of acceptance, in terms of acceptance rate; and the types of research the journal prefers to publish. Other journals will be discussed as well. The goal is to provide for authors guidance before they begin to write their papers, not only for proper formatting, but also that the readership is appropriate for the particular paper, hopefully increasing the quality and impact of the paper and the likelihood of publication. Learning Objectives: To review each Journal’s submission and review process Guidance as to how to increase quality, impact and chances of acceptance To help decipher which journal is appropriate for a given work A. Karellas, Research collaboration with Koning, Corporation.

  14. WE-E-204-00: Where to Send My Manuscript

    International Nuclear Information System (INIS)

    2016-01-01

    Research papers authored by Medical Physicists address a large spectrum of oncologic, imaging, or basic research problems; exploit a wide range of physical and engineering methodologies; and often describe the efforts of a multidisciplinary research team. Given dozens of competing journals accepting medical physics articles, it may not be clear to an individual author which journal is the best venue for disseminating their work to the scientific community. Relevant factors usually include the Journal’s audience and scientific impact, but also such factors as perceived acceptance rate, interest in their topic, and quality of service. The purpose of this symposium is to provide the medical physics community with an overview of scope, review processes, and article guidelines for the following journals: Radiology, Medical Physics, International Journal of Radiation Biology and Physics, Journal of Applied Clinical Medical Physics, and Practical Radiation Oncology. Senior members of the editorial board for each journal will provide details as to the journals review process, for example: single blind versus double blind reviews; open access policies, the hierarchy of the review process in terms of editorial board structure; the reality of acceptance, in terms of acceptance rate; and the types of research the journal prefers to publish. Other journals will be discussed as well. The goal is to provide for authors guidance before they begin to write their papers, not only for proper formatting, but also that the readership is appropriate for the particular paper, hopefully increasing the quality and impact of the paper and the likelihood of publication. Learning Objectives: To review each Journal’s submission and review process Guidance as to how to increase quality, impact and chances of acceptance To help decipher which journal is appropriate for a given work A. Karellas, Research collaboration with Koning, Corporation.

  15. TH-D-204-00: The Pursuit of Radiation Oncology Performance Excellence

    International Nuclear Information System (INIS)

    2016-01-01

    The Malcolm Baldrige National Quality Improvement Act was signed into law in 1987 to advance U.S. business competitiveness and economic growth. Administered by the National Institute of Standards and Technology NIST, the Act created the Baldrige National Quality Program, now renamed the Baldrige Performance Excellence Program. The comprehensive analytical approaches referred to as the Baldrige Healthcare Criteria, are very well suited for the evaluation and sustainable improvement of radiation oncology management and operations. A multidisciplinary self-assessment approach is used for radiotherapy program evaluation and development in order to generate a fact based knowledge driven system for improving quality of care, increasing patient satisfaction, building employee engagement, and boosting organizational innovation. The methodology also provides a valuable framework for benchmarking an individual radiation oncology practice against guidelines defined by accreditation and professional organizations and regulatory agencies. Learning Objectives: To gain knowledge of the Baldrige Performance Excellence Program as it relates to Radiation Oncology. To appreciate the value of a multidisciplinary self-assessment approach in the pursuit of Radiation Oncology quality care, patient satisfaction, and workforce commitment. To acquire a set of useful measurement tools with which an individual Radiation Oncology practice can benchmark its performance against guidelines defined by accreditation and professional organizations and regulatory agencies.

  16. 204: THE ROLE OF IMCI PROGRAM IN THE RATIONALIZATION OF MEDICAMENT USE IN PEDIATRICS

    Science.gov (United States)

    Ahmad, Chreitah

    2017-01-01

    Background and aims Integrated management of childhood illness (IMCI) is an EBM guideline prepared by WHO and UNICEF guideline in primary health care for better assessment and management in pediatrics. The study was carried out to demonstrate the reduction of medicament prescription by the application of IMCI program in two months up to five years old children presenting with an infectious disease. Methods Before and after study was carried out in July 2012 at a pediatric E.R children who met with the inclusion criteria were rolled in: ▸ Consulting for infectious disease. ▸ With no anterior treatment with antibiotics. ▸ No need of hospitalization. In total 112 patients were assessed separately by two groups of doctors (classical approach vs. IMCI guideline). The two prescriptions of each patient were analyzed using Mac Nemar, comparison of proportion tests. Results 112 patients (64 boys, 48 girls) with cough, diarrhea, sore throat, otalgia and fever were studied. In total 280 medicaments were prescribed firstly vs. 160 medicaments with IMCI guideline (P<0.0001). There were 103 oral antibiotics prescribed vs. 28 with IMCI guideline (P<0.0001). There were 20 intra muscular injections prescribed (15 antibiotics) vs. 9 with IMCI guideline (P<0.02). Only 37 antibiotics were justified vs. 82 non-justified (p<0.0001). Conclusion the assessment and management by IMCI program for children age 2 months up to 5 years in outpatient clinic may contribute for a better prescription with a significant reduction in total medicament prescribed, in oral antibiotics and intra muscular injections.

  17. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (204a-0613-272217)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  18. TU-EF-204-02: Hiigh Quality and Sub-MSv Cerebral CT Perfusion Imaging

    Energy Technology Data Exchange (ETDEWEB)

    Li, Ke; Niu, Kai; Wu, Yijing; Chen, Guang-Hong [University of Wisconsin, Madison, WI (United States)

    2015-06-15

    Purpose: CT Perfusion (CTP) imaging is of great importance in acute ischemic stroke management due to its potential to detect hypoperfused yet salvageable tissue and distinguish it from definitely unsalvageable tissue. However, current CTP imaging suffers from poor image quality and high radiation dose (up to 5 mSv). The purpose of this work was to demonstrate that technical innovations such as Prior Image Constrained Compressed Sensing (PICCS) have the potential to address these challenges and achieve high quality and sub-mSv CTP imaging. Methods: (1) A spatial-temporal 4D cascaded system model was developed to indentify the bottlenecks in the current CTP technology; (2) A task-based framework was developed to optimize the CTP system parameters; (3) Guided by (1) and (2), PICCS was customized for the reconstruction of CTP source images. Digital anthropomorphic perfusion phantoms, animal studies, and preliminary human subject studies were used to validate and evaluate the potentials of using these innovations to advance the CTP technology. Results: The 4D cascaded model was validated in both phantom and canine stroke models. Based upon this cascaded model, it has been discovered that, as long as the spatial resolution and noise properties of the 4D source CT images are given, the 3D MTF and NPS of the final CTP maps can be analytically derived for a given set of processing methods and parameters. The cascaded model analysis also identified that the most critical technical factor in CTP is how to acquire and reconstruct high quality source images; it has very little to do with the denoising techniques often used after parametric perfusion calculations. This explained why PICCS resulted in a five-fold dose reduction or substantial improvement in image quality. Conclusion: Technical innovations generated promising results towards achieving high quality and sub-mSv CTP imaging for reliable and safe assessment of acute ischemic strokes. K. Li, K. Niu, Y. Wu: Nothing to disclose. G.-H. Chen: Research funded, GE Healthcare; Research funded, Siemens AX.

  19. Setting up and Running a School Library. Information Collection and Exchange Publication No. ED204

    Science.gov (United States)

    Baird, Nicola

    2012-01-01

    This book explains how teachers can set up and run a successful school library. In it you will find advice and information on how to: (1) set up a small library and build bookshelves; (2) select books for your library; (3) make a written record of your school's books, pamphlets and other library stock such as newspapers, magazines, audio tapes and…

  20. 12 CFR 204.136 - Treatment of trust overdrafts for reserve requirement reporting purposes.

    Science.gov (United States)

    2010-01-01

    ... accounts under Regulation D. Unless the governing trust agreement or state law authorizes the depository... pursuant to trust law or written agreement, or where the amount that caused the overdraft is still... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Treatment of trust overdrafts for reserve...