WorldWideScience

Sample records for astatine 204

  1. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  2. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-09-15

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Discovery of the astatine, radon, francium, and radium isotopes

    Science.gov (United States)

    Fry, C.; Thoennessen, M.

    2013-09-01

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration

    2011-11-30

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  6. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Science.gov (United States)

    Uusitalo, J.; Jakobsson, U.

    2011-11-01

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  7. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy.

    Science.gov (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  9. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others

    2015-10-15

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  10. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Science.gov (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.

    2015-10-01

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  11. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  12. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  13. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  14. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  15. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  16. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  17. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  18. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study

    Science.gov (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi

    2018-01-01

    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).

  19. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  20. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  1. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  2. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  3. 40 CFR 243.204 - Collection management.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Collection management. 243.204 Section 243.204 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES... and Recommended Procedures § 243.204 Collection management. ...

  4. 22 CFR 204.43 - Governing law.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Governing law. 204.43 Section 204.43 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT HOUSING GUARANTY STANDARD TERMS AND CONDITIONS Administration § 204.43 Governing law. This Guaranty shall be governed by and construed in accordance with the laws of...

  5. 40 CFR 240.204 - Water quality.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Water quality. 240.204 Section 240.204 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE THERMAL PROCESSING OF SOLID WASTES Requirements and Recommended Procedures § 240.204 Water quality. ...

  6. 22 CFR 204.41 - Arbitration.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Arbitration. 204.41 Section 204.41 Foreign... § 204.41 Arbitration. Any controversy or claim between A.I.D. and the Lender or any Assignee arising out of this Guaranty shall be settled by arbitration to be held in Washington, DC in accordance with the...

  7. 14 CFR 302.204 - Responsive documents.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Responsive documents. 302.204 Section 302.204 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS... Foreign Air Carrier Permit Licensing Proceedings § 302.204 Responsive documents. (a) Any person may file...

  8. 9 CFR 204.2 - Organization.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Organization. 204.2 Section 204.2... STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE ORGANIZATION AND FUNCTIONS Public Information § 204.2 Organization. (a) The Grain Inspection, Packers and Stockyards Administration (Packers and Stockyards Programs...

  9. 27 CFR 31.204 - Mixed cocktails.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Mixed cocktails. 31.204 Section 31.204 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS ALCOHOL BEVERAGE DEALERS Reuse and Possession of Used Liquor Bottles § 31.204...

  10. 19 CFR 204.5 - Reports.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Reports. 204.5 Section 204.5 Customs Duties UNITED... ON AGRICULTURAL PROGRAMS § 204.5 Reports. After completion of its investigation, the Commission will transmit to the President a report of the results thereof, including its findings and recommendations based...

  11. 7 CFR 1416.204 - Application process.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Application process. 1416.204 Section 1416.204 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT... PROGRAMS Livestock Indemnity Program II § 1416.204 Application process. (a) Applicants must submit to CCC a...

  12. 40 CFR 204.57-4 - Testing.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Testing. 204.57-4 Section 204.57-4... STANDARDS FOR CONSTRUCTION EQUIPMENT Portable Air Compressors § 204.57-4 Testing. (a) The manufacturer shall... selected for testing pursuant to this subpart. (b) No maintenance will be performed on test compressors...

  13. 12 CFR 204.121 - Bankers' banks.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Bankers' banks. 204.121 Section 204.121 Banks... REQUIREMENTS OF DEPOSITORY INSTITUTIONS (REGULATION D) Interpretations § 204.121 Bankers' banks. (a)(1) The...' banks. (2) In its application of these requirements to specific institutions, the Board will use the...

  14. 48 CFR 243.204 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Administration. 243.204... OF DEFENSE CONTRACT MANAGEMENT CONTRACT MODIFICATIONS Change Orders 243.204 Administration. Follow the procedures at PGI 243.204 for administration of change orders. ...

  15. 31 CFR 800.204 - Control.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Control. 800.204 Section 800.204... FOREIGN PERSONS Definitions § 800.204 Control. (a) The term control means the power, direct or indirect... in paragraphs (a)(1) through (9) of this section. (b) In examining questions of control in situations...

  16. 5 CFR 845.204 - Processing.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Processing. 845.204 Section 845.204 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL EMPLOYEES RETIREMENT SYSTEM-DEBT COLLECTION Collection of Overpayment Debts § 845.204 Processing. (a) Notice...

  17. 40 CFR 204.55 - Requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirements. 204.55 Section 204.55 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS NOISE EMISSION STANDARDS FOR CONSTRUCTION EQUIPMENT Portable Air Compressors § 204.55 Requirements. ...

  18. 40 CFR 204.55-2 - Requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirements. 204.55-2 Section 204.55... NOISE EMISSION STANDARDS FOR CONSTRUCTION EQUIPMENT Portable Air Compressors § 204.55-2 Requirements. (a... requirements for purposes of testing by the Administrator and Selective Enforcement Auditing consist of: (1...

  19. 48 CFR 811.204 - Contract clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clause. 811.204 Section 811.204 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS COMPETITION AND ACQUISITION PLANNING DESCRIBING AGENCY NEEDS Using and Maintaining Requirements Documents 811.204 Contract...

  20. 42 CFR 93.204 - Contract.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Contract. 93.204 Section 93.204 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS... MISCONDUCT Definitions § 93.204 Contract. Contract means an acquisition instrument awarded under the HHS...

  1. 47 CFR 1.204 - Pleadings; definition.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Pleadings; definition. 1.204 Section 1.204....204 Pleadings; definition. As used in this subpart, the term pleading means any written notice, motion... paper filed with the Commission in a hearing proceeding. It does not include exhibits or documents...

  2. 32 CFR 204.4 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 204.4 Section 204.4 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS USER FEES § 204.4 Responsibilities. (a) The USD(C) shall develop and monitor policies governing user...

  3. Dicty_cDB: SHK204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHK204 (Link to dictyBase) - - - - SHK204P (Link to Original site) SHK204F 617 SHK204Z...(Link to library) Clone ID SHK204 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig...Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SH/SHK2-A/SHK204Q.Seq.d/ Representative...Representative seq. ID SHK204P (Link to Original site) Representative DNA sequence >SHK204 (SHK204Q) /CSM/SH/SHK2-A/SHK204Q...ACTGTTGGCCTACTGGNATTGACCCGCAATTAGTAATTAGTAAAGNAATGAAATTAAAAC ATTTAACTATTTTTTTATTTATTTTTATTTATAGGTTTTTATTTGTTAAATCGGATTGTT

  4. Dicty_cDB: VFB204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (Link to library) VFB204 (Link to dictyBase) - G22101 DDB0186614 Contig-U02050-1 VFB204P (Link to Original...Original site) VFB204F 594 VFB204Z 248 VFB204P 842 - - Show VFB204 Library VF (Link to library) Clone ID VFB204...VFB204 (Link to dictyBase) Atlas ID - NBRP ID G22101 dictyBase ID DDB0186614 Link to Contig Contig-U02050-1...Contig-U02050-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB2-A/VFB204Q.Seq.d/ Representative...Representative seq. ID VFB204P (Link to Original site) Representative DNA sequence >VFB204 (VFB204Q) /CSM/VF/VFB2-A/VFB204Q

  5. Dicty_cDB: CHR204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR204 (Link to dictyBase) - - - Contig-U16471-1 CHR204P (Link to Original site) CHR...204F 167 CHR204Z 819 CHR204P 966 - - Show CHR204 Library CH (Link to library) Clone ID CHR... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHR2-A/CHR204Q.Seq.d/ Representative seq. ID CHR...204P (Link to Original site) Representative DNA sequence >CHR204 (CHR204Q) /CSM/CH/CHR2-A/CHR2... significant alignments: (bits) Value CHR204 (CHR204Q) /CSM/CH/CHR2-A/CHR204Q.Seq

  6. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.

    2017-04-01

    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  7. 41 CFR 50-204.66 - Acetylene.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Acetylene. 50-204.66..., Vapors, Fumes, Dusts, and Mists § 50-204.66 Acetylene. (a) The in-plant transfer, handling, storage, and utilization of acetylene in cylinders shall be in accordance with Compressed Gas Association Pamphlet G-1-1966...

  8. 7 CFR 1205.204 - Voting.

    Science.gov (United States)

    2010-01-01

    ... through the Internet during the voting period. A completed and signed CN-100 and supporting documentation....C. or through the Internet during the voting period. In addition, before the referendum, USDA shall... 7 Agriculture 10 2010-01-01 2010-01-01 false Voting. 1205.204 Section 1205.204 Agriculture...

  9. 24 CFR 100.204 - Reasonable accommodations.

    Science.gov (United States)

    2010-04-01

    ... HOUSING DISCRIMINATORY CONDUCT UNDER THE FAIR HOUSING ACT Prohibition Against Discrimination Because of... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Reasonable accommodations. 100.204 Section 100.204 Housing and Urban Development Regulations Relating to Housing and Urban Development OFFICE...

  10. 41 CFR 50-204.68 - Hydrogen.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Hydrogen. 50-204.68..., Vapors, Fumes, Dusts, and Mists § 50-204.68 Hydrogen. The in-plant transfer, handling, storage, and utilization of hydrogen shall be in accordance with Compressed Gas Association Pamphlets G-5.1-1961 and G-5.2...

  11. 17 CFR 204.6 - Agency review.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Agency review. 204.6 Section... COLLECTION Administrative Offset § 204.6 Agency review. (a) To the extent that a debt owed has not been... request to review a disputed debt must be submitted to the Commission official who provided notification...

  12. 44 CFR 204.42 - Eligible costs.

    Science.gov (United States)

    2010-10-01

    ... are providing services directly associated with eligible fire-related activities may be eligible. (2... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Eligible costs. 204.42 Section 204.42 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF...

  13. 44 CFR 206.204 - Project performance.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Project performance. 206.204... § 206.204 Project performance. (a) General. This section describes the policies and procedures applicable during the performance of eligible work. (b) Advances of funds. Advances of funds will be made in...

  14. 22 CFR 204.42 - Notice.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Notice. 204.42 Section 204.42 Foreign Relations....42 Notice. Any communication to A.I.D. pursuant to this Guaranty shall be in writing in the English language, shall refer to the A.I.D. Housing Guaranty Project Number inscribed on the Eligible Note and...

  15. 13 CFR 400.204 - Loan terms.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Loan terms. 400.204 Section 400... PROGRAM Steel Guarantee Loans § 400.204 Loan terms. (a) All loans guaranteed under the Program shall be... States with remaining periods of maturity comparable to the term of the loan sought to be guaranteed. The...

  16. 13 CFR 500.204 - Loan terms.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Loan terms. 500.204 Section 500... GUARANTEED LOAN PROGRAM Oil and Gas Guaranteed Loans § 500.204 Loan terms. (a) All loans guaranteed under the... United States with remaining periods of maturity comparable to the term of the loan sought to be...

  17. 5 CFR 582.204 - Electronic disbursement.

    Science.gov (United States)

    2010-01-01

    ... 582.204 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS COMMERCIAL GARNISHMENT OF FEDERAL EMPLOYEES' PAY Service of Legal Process § 582.204 Electronic disbursement. The party... process will be honored beginning with the first remission of garnished funds. Written requests received...

  18. 22 CFR 204.12 - Guaranty eligibility.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Guaranty eligibility. 204.12 Section 204.12 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT HOUSING GUARANTY STANDARD TERMS AND CONDITIONS The... Investors only are entitled to the benefits of this Guaranty. Notes in order to achieve Eligible Note status...

  19. 22 CFR 204.11 - The Guaranty.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false The Guaranty. 204.11 Section 204.11 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT HOUSING GUARANTY STANDARD TERMS AND CONDITIONS The Guaranty... Investor compensation in Dollars equal to its Loss of Investment under the Eligible Note; provided, however...

  20. 17 CFR 204.75 - Collection services.

    Science.gov (United States)

    2010-04-01

    ... DEBT COLLECTION Miscellaneous: Credit Bureau Reporting, Collection Services § 204.75 Collection services. Section 13 of the Debt Collection Act (31 U.S.C. 3718) authorizes agencies to enter into... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Collection services. 204.75...

  1. 34 CFR 685.204 - Deferment.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false Deferment. 685.204 Section 685.204 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF POSTSECONDARY EDUCATION... dentistry. (iii)(A) For the purpose of paragraph (b)(1)(i)(A) of this section, the Secretary processes a...

  2. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination.

    Science.gov (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick

    2007-01-01

    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  3. Dicty_cDB: VHP204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP204 (Link to dictyBase) - - - - VHP204P (Link to Original site) VHP204F 644 VHP...204Z 767 VHP204P 1391 - - Show VHP204 Library VH (Link to library) Clone ID VHP204 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP...2-A/VHP204Q.Seq.d/ Representative seq. ID VHP204P (Link to... Original site) Representative DNA sequence >VHP204 (VHP204Q) /CSM/VH/VHP2-A/VHP204Q.Seq.d/ AACTCTCGAGTGCAAA

  4. 9 CFR 204.1 - Introduction.

    Science.gov (United States)

    2010-01-01

    ... Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE ORGANIZATION AND FUNCTIONS Public Information § 204.1 Introduction. The Grain Inspection, Packers and Stockyards Administration (Packers and Stockyards Programs...

  5. 41 CFR 109-50.204 - Limitations.

    Science.gov (United States)

    2010-07-01

    ... DISPOSAL AUTHORITIES 50.2-Math and Science Equipment Gift Program § 109-50.204 Limitations. (a) Excess and... (or unlimited) level of authority. (d) Gifts shall be serviceable and in working order. Disposal...

  6. 20 CFR 633.204 - Responsibility review.

    Science.gov (United States)

    2010-04-01

    ....204 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR MIGRANT AND...) Established fraud or criminal activity within the organization. (4) Wilfull obstruction of the audit process... hand. (11) Failure to procure or arrange for audit coverage for any two year period when required by...

  7. 48 CFR 49.204 - Deductions.

    Science.gov (United States)

    2010-10-01

    ... TERMINATION OF CONTRACTS Additional Principles for Fixed-Price Contracts Terminated for Convenience 49.204... agreed price for any part of the termination inventory purchased or retained by the contractor, and the..., as determined by the TCO, of any part of the termination inventory that, before transfer of title to...

  8. 50 CFR 216.204 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Construction and Operation of Offshore Oil and Gas Facilities in the U.S. Beaufort Sea § 216.204 Mitigation. The activity identified in § 216.200(a) must be conducted in...

  9. 50 CFR 223.204 - Tribal plans.

    Science.gov (United States)

    2010-10-01

    ... Threatened Marine and Anadromous Species § 223.204 Tribal plans. (a) Limits on the prohibitions. The... impact on the biological requirements of the species, and will assess the effect of the Tribal Plan on... or not implementation of a Tribal Plan will appreciably reduce the likelihood of survival and...

  10. 17 CFR 204.62 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... COLLECTION Administrative Wage Garnishment § 204.62 Definitions. The following definitions apply to this... taxes and withholding taxes, but do not include any amount withheld pursuant to a court order. Employer... agency of the Federal Government. Garnishment means the process of withholding amounts from an employee's...

  11. 19 CFR 10.204 - Imported directly.

    Science.gov (United States)

    2010-04-01

    ... country, the articles in the shipment did not enter into the commerce of the non-beneficiary country while... country except for the purpose of sale other than at retail, and the articles are imported into the United... ARTICLES CONDITIONALLY FREE, SUBJECT TO A REDUCED RATE, ETC. Andean Trade Preference § 10.204 Imported...

  12. 12 CFR 509.204 - Hearing Procedure.

    Science.gov (United States)

    2010-01-01

    ... PROCEDURE IN ADJUDICATORY PROCEEDINGS Special Rules § 509.204 Hearing Procedure. (a) (1) The Director shall... filings to the Office of the Chief Counsel, Business Transactions Division. The Office of the Chief Counsel, Business Transactions Division shall serve in the manner provided in § 509.11 of this part, each...

  13. 15 CFR 971.204 - Environmental and use conflict analysis.

    Science.gov (United States)

    2010-01-01

    ... particulate matter dispersion Sediment characteristics (mineralogy, particle size, shape and density, and... analysis. 971.204 Section 971.204 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign... Applications Contents § 971.204 Environmental and use conflict analysis. (a) Environmental information...

  14. 42 CFR 50.204 - Informed consent requirement.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Informed consent requirement. 50.204 Section 50.204... APPLICABILITY Sterilization of Persons in Federally Assisted Family Planning Projects § 50.204 Informed consent requirement. Informed consent does not exist unless a consent form is completed voluntarily and in accordance...

  15. 40 CFR 86.204-94 - Section numbering; construction.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Section numbering; construction. 86.204-94 Section 86.204-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... New Medium-Duty Passenger Vehicles; Cold Temperature Test Procedures § 86.204-94 Section numbering...

  16. 41 CFR 50-204.36 - Radiation standards for mining.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Radiation standards for mining. 50-204.36 Section 50-204.36 Public Contracts and Property Management Other Provisions Relating to... CONTRACTS Radiation Standards § 50-204.36 Radiation standards for mining. (a) For the purpose of this...

  17. 20 CFR 725.204 - Determination of relationship; spouse.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Determination of relationship; spouse. 725.204 Section 725.204 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR...) § 725.204 Determination of relationship; spouse. (a) For the purpose of augmenting benefits, an...

  18. 48 CFR 243.204-70-2 - Price ceiling.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Price ceiling. 243.204-70-2 Section 243.204-70-2 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT CONTRACT MODIFICATIONS Change Orders 243.204-70-2 Price ceiling...

  19. 23 CFR 972.204 - Management systems requirements.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Management systems requirements. 972.204 Section 972.204... WILDLIFE SERVICE MANAGEMENT SYSTEMS Fish and Wildlife Service Management Systems § 972.204 Management systems requirements. (a) The FWS shall develop, establish and implement the management systems as...

  20. 41 CFR 50-204.1a - Variances.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Variances. 50-204.1a Section 50-204.1a Public Contracts and Property Management Other Provisions Relating to Public Contracts PUBLIC CONTRACTS, DEPARTMENT OF LABOR 204-SAFETY AND HEALTH STANDARDS FOR FEDERAL SUPPLY CONTRACTS Scope...

  1. 41 CFR 50-204.1 - Scope and application.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Scope and application. 50-204.1 Section 50-204.1 Public Contracts and Property Management Other Provisions Relating to Public Contracts PUBLIC CONTRACTS, DEPARTMENT OF LABOR 204-SAFETY AND HEALTH STANDARDS FOR FEDERAL SUPPLY CONTRACTS...

  2. 12 CFR 204.8 - International banking facilities.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false International banking facilities. 204.8 Section 204.8 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM RESERVE REQUIREMENTS OF DEPOSITORY INSTITUTIONS (REGULATION D) § 204.8 International banking facilities...

  3. 40 CFR 204.3 - Number and gender.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Number and gender. 204.3 Section 204.3... STANDARDS FOR CONSTRUCTION EQUIPMENT General Provisions § 204.3 Number and gender. As used in this part, words in the singular shall be deemed to import the plural, and words in the masculine gender shall be...

  4. 46 CFR 309.204 - Proof of loss.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Proof of loss. 309.204 Section 309.204 Shipping MARITIME... Supplies § 309.204 Proof of loss. Claims for reimbursement for total loss of stores and supplies may be... owner and the Chief, Division of Insurance, Maritime Administration, have agreed, in advance of the loss...

  5. 29 CFR 20.4 - Determination of delinquency; notice.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Determination of delinquency; notice. 20.4 Section 20.4 Labor Office of the Secretary of Labor FEDERAL CLAIMS COLLECTION Disclosure of Information to Credit Reporting Agencies § 20.4 Determination of delinquency; notice. (a) The agency head (or designee...

  6. 5 CFR 2638.204 - Deputy ethics official.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Deputy ethics official. 2638.204 Section 2638.204 Administrative Personnel OFFICE OF GOVERNMENT ETHICS GOVERNMENT ETHICS OFFICE OF GOVERNMENT ETHICS AND EXECUTIVE AGENCY ETHICS PROGRAM RESPONSIBILITIES Designated Agency Ethics Official § 2638.204...

  7. 24 CFR 904.204 - General requirements and information.

    Science.gov (United States)

    2010-04-01

    ... successful participation in the homeownership development. (i) An overload of information should be avoided... information. 904.204 Section 904.204 Housing and Urban Development Regulations Relating to Housing and Urban... § 904.204 General requirements and information. (a) The counseling and training program shall be...

  8. 31 CFR 586.204 - Prohibited new investment within Serbia.

    Science.gov (United States)

    2010-07-01

    ... Serbia. 586.204 Section 586.204 Money and Finance: Treasury Regulations Relating to Money and Finance... (SERBIA & MONTENEGRO) KOSOVO SANCTIONS REGULATIONS Prohibitions § 586.204 Prohibited new investment within Serbia. Except as otherwise provided in regulations, orders, directives, or licenses that may hereafter...

  9. 7 CFR 22.204 - Rural development committees.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Rural development committees. 22.204 Section 22.204 Agriculture Office of the Secretary of Agriculture RURAL DEVELOPMENT COORDINATION Roles and Responsibilities of Federal Government § 22.204 Rural development committees. State rural development committees...

  10. 48 CFR 952.204-77 - Computer security.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Computer security. 952.204-77 Section 952.204-77 Federal Acquisition Regulations System DEPARTMENT OF ENERGY CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.204-77 Computer security. As prescribed in 904.404(d)(7), the...

  11. 40 CFR 2.204 - Initial action by EPA office.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Initial action by EPA office. 2.204 Section 2.204 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PUBLIC INFORMATION Confidentiality of Business Information § 2.204 Initial action by EPA office. (a) Situations requiring action...

  12. Standardization of a 204Tl radioactive solution.

    Science.gov (United States)

    Dias, Mauro S; Koskinas, Marina F

    2003-02-01

    The standardization of 204Tl is described. The efficiency tracing technique was applied using 134Cs as tracer. The 4(pi)beta-gamma coincidence system was used for the calibration. The (Laboratorio de Metrologia Nuclear) has participated in this comparison in collaboration with the Laboratório Nacional de Metrologia das Radiações Ionizantes, from Rio de Janeiro. Independent results using different techniques were developed by each of these laboratories and included in the comparison.

  13. 12 CFR 204.4 - Computation of required reserves.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Computation of required reserves. 204.4 Section... RESERVE REQUIREMENTS OF DEPOSITORY INSTITUTIONS (REGULATION D) § 204.4 Computation of required reserves... liabilities during a 14-day computation period ending every second Monday. (e) For institutions that file a...

  14. 14 CFR 415.204-415.400 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false 415.204-415.400 Section 415.204-415.400 Aeronautics and Space COMMERCIAL SPACE TRANSPORTATION, FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... Preflight Tests 4.3.4Trajectory and Debris Dispersion Data 4.3.5Flight Hazard Areas and Safety Clear Zones 4...

  15. 34 CFR 303.204 - Payments to the jurisdictions.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false Payments to the jurisdictions. 303.204 Section 303.204 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION EARLY INTERVENTION PROGRAM FOR INFANTS AND...

  16. 5 CFR 530.204 - Payment of excess amounts.

    Science.gov (United States)

    2010-01-01

    ... Section 530.204 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PAY RATES AND SYSTEMS (GENERAL) Aggregate Limitation on Pay § 530.204 Payment of excess amounts. (a) An agency must pay the amounts that were deferred because they were in excess of the aggregate limitation...

  17. 9 CFR 204.3 - Delegation of authority.

    Science.gov (United States)

    2010-01-01

    ... 204.3 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE ORGANIZATION AND FUNCTIONS Public Information § 204.3... Regional Supervisors of the Grain Inspection, Packers and Stockyards Administration (Packers and Stockyards...

  18. 14 CFR 125.204 - Portable electronic devices.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Portable electronic devices. 125.204... Equipment Requirements § 125.204 Portable electronic devices. (a) Except as provided in paragraph (b) of... operation of, any portable electronic device on any U.S.-registered civil aircraft operating under this part...

  19. 5 CFR 301.204 - Status and trial period.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Status and trial period. 301.204 Section... EMPLOYMENT Overseas Limited Appointment § 301.204 Status and trial period. (a) An overseas limited employee... she is required to serve a trial period of 1 year when given an overseas limited appointment of...

  20. 40 CFR 204.5-2 - National security exemptions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false National security exemptions. 204.5-2... PROGRAMS NOISE EMISSION STANDARDS FOR CONSTRUCTION EQUIPMENT General Provisions § 204.5-2 National security... for a national security exemption is required. (c) For purposes of section 11(d) of the Act, any...

  1. 41 CFR 50-204.69 - Nitrous oxide.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Nitrous oxide. 50-204.69..., Vapors, Fumes, Dusts, and Mists § 50-204.69 Nitrous oxide. The piped systems for the in-plant transfer and distribution of nitrous oxide shall be designed, installed, maintained, and operated in accordance...

  2. 41 CFR 105-72.204 - Special award conditions.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Special award conditions. 105-72.204 Section 105-72.204 Public Contracts and Property Management Federal Property Management... award conditions. If an applicant or recipient: (a) Has a history of poor performance, (b) Is not...

  3. 15 CFR 2011.204 - Entry of specialty sugars.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Entry of specialty sugars. 2011.204... UNITED STATES TRADE REPRESENTATIVE ALLOCATION OF TARIFF-RATE QUOTA ON IMPORTED SUGARS, SYRUPS AND MOLASSES Specialty Sugar § 2011.204 Entry of specialty sugars. An importer or the importer's agent must...

  4. 22 CFR 204.14 - Transferability of guaranty; Note Register.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Transferability of guaranty; Note Register. 204.14 Section 204.14 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT HOUSING GUARANTY STANDARD... Assignee may assign, transfer or pledge the Eligible Notes to any Eligible Investor. Any such assignment...

  5. 22 CFR 204.15 - Paying agent obligations.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Paying agent obligations. 204.15 Section 204.15 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT HOUSING GUARANTY STANDARD TERMS AND CONDITIONS The... pursuant to the Paying and Transfer Agency Agreement shall not impair the Investor's or any Assignee's...

  6. 14 CFR 1214.204 - Patent and data rights.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Patent and data rights. 1214.204 Section... Substantial Investment in the STS Program § 1214.204 Patent and data rights. (a) When accommodating missions... purposes rights to inventions, patents and data resulting from such missions, subject to the user's...

  7. 6 CFR 27.204 - Minimum concentration by security issue.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Minimum concentration by security issue. 27.204... FACILITY ANTI-TERRORISM STANDARDS Chemical Facility Security Program § 27.204 Minimum concentration by... is present in a mixture, and the concentration of the chemical is equal to or greater than one...

  8. 44 CFR 204.3 - Definitions used throughout this part.

    Science.gov (United States)

    2010-10-01

    .... The ranking official responsible for overseeing the management of fire operations, planning, logistics... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Definitions used throughout this part. 204.3 Section 204.3 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY...

  9. 36 CFR 20.4 - Revocation of permits; appeal.

    Science.gov (United States)

    2010-07-01

    ... INTERIOR ISLE ROYALE NATIONAL PARK; COMMERCIAL FISHING § 20.4 Revocation of permits; appeal. The Director... the Secretary, relating to the Park. A permittee, however, shall have the right to appeal to the...

  10. 9 CFR 113.204 - Mink Enteritis Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mink Enteritis Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.204 Mink Enteritis Vaccine, Killed Virus. Mink Enteritis Vaccine...

  11. 40 CFR 156.204 - Modification and waiver of requirements.

    Science.gov (United States)

    2010-07-01

    ... accordance with § 154.25(c) of this chapter that a pesticide should be placed in Special Review because the pesticide meets or exceeds the criteria for human health effects of § 154.7(a)(1)(2) or (6) of this chapter...) PESTICIDE PROGRAMS LABELING REQUIREMENTS FOR PESTICIDES AND DEVICES Worker Protection Statements § 156.204...

  12. 204 Chandra N Farm and Swapan K Ghosh

    Indian Academy of Sciences (India)

    204 Chandra N Farm and Swapan K Ghosh. Figure 4. Calculated density profiles of the ions and the solvent molecules at selected values of wall separation; ( ----- ' -): counter-ions, (--~-~-~»): co—ions, ( ): solvent molecules. (system parameters as in figure 3). experimentally observed forces in neutral liquids. With a view to ...

  13. 41 CFR 50-204.75 - Transportation safety.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Transportation safety. 50... Transportation Safety § 50-204.75 Transportation safety. Any requirements of the U.S. Department of Transportation under 49 CFR Parts 171-179 and Parts 390-397 and 14 CFR Part 103 shall be applied to...

  14. 41 CFR 50-204.5 - Machine guarding.

    Science.gov (United States)

    2010-07-01

    .... Milling machines. Power saws. Jointers. Portable power tools. Forming rolls and calenders. (d) Revolving...) Machines designed for a fixed location shall be securely anchored to prevent walking or moving. ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Machine guarding. 50-204...

  15. 23 CFR 230.204 - Implementation of supportive services.

    Science.gov (United States)

    2010-04-01

    ... 230.204 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CIVIL RIGHTS EXTERNAL... the State highway agency provides supportive services by contract, formal advertising is not required by FHWA; however, the State highway agency shall solicit proposals from such qualified sources as...

  16. 44 CFR 204.53 - Certifying costs and payments.

    Science.gov (United States)

    2010-10-01

    ... Procedures § 204.53 Certifying costs and payments. (a) By submitting applicants' Project Worksheets to us, the Grantee is certifying that all costs reported on applicant Project Worksheets were incurred for work that was performed in compliance with FEMA laws, regulations, policy and guidance applicable to...

  17. 48 CFR 204.470-2 - National security exclusion.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false National security... Within Industry 204.470-2 National security exclusion. (a) The U.S.-IAEA AP permits the United States... associated with such activities, with direct national security significance. (b) In order to ensure that all...

  18. 14 CFR 1216.204 - General implementation requirements.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false General implementation requirements. 1216... QUALITY Floodplain and Wetlands Management § 1216.204 General implementation requirements. (a) Each NASA... roadways, bridges and utility systems in coastal floodplains or wetlands which provide long-term support...

  19. 5 CFR 870.204 - Annual rates of pay.

    Science.gov (United States)

    2010-01-01

    ..., subpart M, of this chapter. (b) To convert a pay rate of other than annual salary to an annual rate... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Annual rates of pay. 870.204 Section 870... rates of pay. (a) (1) An insured employee's annual pay is his/her annual rate of basic pay as fixed by...

  20. 41 CFR 50-204.10 - Occupational noise exposure.

    Science.gov (United States)

    2010-07-01

    ... CONTRACTS General Safety and Health Standards § 50-204.10 Occupational noise exposure. (a) Protection against the effects of noise exposure shall be provided when the sound levels exceed those shown in Table... conservation program shall be administered. Table I permissible noise exposures 1 Duration per day, hours Sound...

  1. 15 CFR 970.204 - Environmental and use conflict analysis.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Environmental and use conflict... REGULATIONS OF THE ENVIRONMENTAL DATA SERVICE DEEP SEABED MINING REGULATIONS FOR EXPLORATION LICENSES Applications Contents § 970.204 Environmental and use conflict analysis. (a) Environmental information. To...

  2. 5 CFR 734.204 - Participation in political organizations.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Participation in political organizations... SERVICE REGULATIONS (CONTINUED) POLITICAL ACTIVITIES OF FEDERAL EMPLOYEES Permitted Activities § 734.204 Participation in political organizations. An employee may: (a) Be a member of a political party or other...

  3. 31 CFR 587.204 - Evasions; attempts; conspiracies.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Evasions; attempts; conspiracies. 587... MONTENEGRO) MILOSEVIC SANCTIONS REGULATIONS Prohibitions § 587.204 Evasions; attempts; conspiracies. (a... after the effective date that evades or avoids, has the purpose of evading or avoiding, or attempts to...

  4. 31 CFR 541.204 - Evasions; attempts; conspiracies.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Evasions; attempts; conspiracies. 541... § 541.204 Evasions; attempts; conspiracies. (a) Except as otherwise authorized, and notwithstanding any... the purpose of evading or avoiding, or attempts to violate any of the prohibitions set forth in this...

  5. 31 CFR 588.204 - Evasions; attempts; conspiracies.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Evasions; attempts; conspiracies. 588... Prohibitions § 588.204 Evasions; attempts; conspiracies. (a) Except as otherwise authorized, and... avoids, has the purpose of evading or avoiding, or attempts to violate any of the prohibitions set forth...

  6. 31 CFR 536.204 - Evasions; attempts; conspiracies.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Evasions; attempts; conspiracies. 536... Prohibitions § 536.204 Evasions; attempts; conspiracies. Any transaction for the purpose of, or which has the... set forth in this part, is hereby prohibited. Any attempt to violate the prohibitions set forth in...

  7. 31 CFR 597.204 - Evasions; attempts; conspiracies.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Evasions; attempts; conspiracies. 597... REGULATIONS Prohibitions § 597.204 Evasions; attempts; conspiracies. Any transaction for the purpose of, or... the prohibitions set forth in this part, is hereby prohibited. Any attempt to violate the prohibitions...

  8. 31 CFR 598.204 - Evasions; attempts; conspiracies.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Evasions; attempts; conspiracies. 598... REGULATIONS Prohibitions § 598.204 Evasions; attempts; conspiracies. Except to the extent provided in... the effect of evading or avoiding, and any endeavor, attempt, or conspiracy to violate any of the...

  9. 48 CFR 52.204-8 - Annual Representations and Certifications.

    Science.gov (United States)

    2010-10-01

    ..., Central Contractor Registration. (iv) 52.204-5, Women-Owned Business (Other Than Small Business). This... will exceed the simplified acquisition threshold and the contract is not for acquisition of commercial...) Alternate I. ___(x) 52.227-15, Representation of Limited Rights Data and Restricted Computer Software. (d...

  10. 42 CFR 460.204 - Financial recordkeeping and reporting requirements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Financial recordkeeping and reporting requirements...-INCLUSIVE CARE FOR THE ELDERLY (PACE) Data Collection, Record Maintenance, and Reporting § 460.204 Financial... financial statements. (c) Accepted reporting practices. Except as specified under Medicare principles of...

  11. 17 CFR 204.77 - Referrals to collection agencies.

    Science.gov (United States)

    2010-04-01

    ... RELATING TO DEBT COLLECTION Miscellaneous: Credit Bureau Reporting, Collection Services § 204.77 Referrals to collection agencies. (a) The Commission has authority to contract for collection services to... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Referrals to collection...

  12. Ginseng Purified Dry Extract, BST204, Improved Cancer Chemotherapy-Related Fatigue and Toxicity in Mice

    National Research Council Canada - National Science Library

    Park, Hyun-Jung; Shim, Hyun Soo; Kim, Jeom Yong; Kim, Joo Young; Park, Sun Kyu; Shim, Insop

    2015-01-01

    .... BST204 was prepared by incubating crude ginseng extract with ginsenoside-β-glucosidase. The purpose of the present study was to examine the effects of BST204, mixture of ginsenosides on 5-fluorouracil...

  13. 41 CFR 50-204.6 - Medical services and first aid.

    Science.gov (United States)

    2010-07-01

    ... first aid. 50-204.6 Section 50-204.6 Public Contracts and Property Management Other Provisions Relating... SUPPLY CONTRACTS General Safety and Health Standards § 50-204.6 Medical services and first aid. (a) The... trained to render first aid. First aid supplies approved by the consulting physician shall be readily...

  14. 40 CFR 204.57-7 - Acceptance and rejection of batch sequence.

    Science.gov (United States)

    2010-07-01

    ... sequence. 204.57-7 Section 204.57-7 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... § 204.57-7 Acceptance and rejection of batch sequence. (a) The manufacturer will continue to inspect consecutive batches until the batch sequence is accepted or rejected. The batch sequence will be accepted or...

  15. 41 CFR 50-204.35 - Application for variations from radiation levels.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Application for variations from radiation levels. 50-204.35 Section 50-204.35 Public Contracts and Property Management Other... FOR FEDERAL SUPPLY CONTRACTS Radiation Standards § 50-204.35 Application for variations from radiation...

  16. 12 CFR 204.122 - Secondary market activities of international banking facilities.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Secondary market activities of international banking facilities. 204.122 Section 204.122 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF...) Interpretations § 204.122 Secondary market activities of international banking facilities. (a) Questions have been...

  17. 40 CFR 721.4587 - Lithium manganese oxide (LiMn204) (generic name).

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Lithium manganese oxide (LiMn204... Specific Chemical Substances § 721.4587 Lithium manganese oxide (LiMn204) (generic name). (a) Chemical... as lithium manganese oxide (LiMn204) (P-96-175) is subject to reporting under this section for the...

  18. 31 CFR 538.204 - Prohibited importation of goods or services from Sudan.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Prohibited importation of goods or services from Sudan. 538.204 Section 538.204 Money and Finance: Treasury Regulations Relating to Money and... REGULATIONS Prohibitions § 538.204 Prohibited importation of goods or services from Sudan. Except as otherwise...

  19. 44 CFR 204.23 - Processing a request for a fire management assistance declaration.

    Science.gov (United States)

    2010-10-01

    ... ASSISTANCE GRANT PROGRAM Declaration Process § 204.23 Processing a request for a fire management assistance... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Processing a request for a fire management assistance declaration. 204.23 Section 204.23 Emergency Management and Assistance...

  20. 12 CFR 747.204 - Notice of intention to terminate insured status.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Notice of intention to terminate insured status. 747.204 Section 747.204 Banks and Banking NATIONAL CREDIT UNION ADMINISTRATION REGULATIONS AFFECTING... Status § 747.204 Notice of intention to terminate insured status. Unless correction of the practices...

  1. 48 CFR 52.204-5 - Women-Owned Business (Other Than Small Business).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Women-Owned Business (Other Than Small Business). 52.204-5 Section 52.204-5 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.204-5 Women-Owned Business (Other Than Small Business). As prescribed in 4.607(b...

  2. 41 CFR 109-38.204-50 - Records of exempted motor vehicles.

    Science.gov (United States)

    2010-07-01

    ... motor vehicles. 109-38.204-50 Section 109-38.204-50 Public Contracts and Property Management Federal... AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 38-MOTOR EQUIPMENT MANAGEMENT 38.2-Registration, Identification, and Exemptions § 109-38.204-50 Records of exempted motor vehicles. The Director, Office of...

  3. 48 CFR 25.204 - Evaluating offers of foreign construction material.

    Science.gov (United States)

    2010-10-01

    ... foreign construction material. 25.204 Section 25.204 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Buy American Act-Construction Materials 25.204 Evaluating offers of foreign construction material. (a) Offerors proposing to use foreign...

  4. 48 CFR 1325.204 - Evaluating offers of foreign construction material.

    Science.gov (United States)

    2010-10-01

    ... foreign construction material. 1325.204 Section 1325.204 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Buy American Act-Construction Materials 1325.204 Evaluating offers of foreign construction material. The designee authorized to specify a...

  5. 48 CFR 625.204 - Evaluating offers of foreign construction material.

    Science.gov (United States)

    2010-10-01

    ... foreign construction material. 625.204 Section 625.204 Federal Acquisition Regulations System DEPARTMENT OF STATE SOCIOECONOMIC PROGRAMS FOREIGN ACQUISITION Buy American Act-Construction Materials 625.204 Evaluating offers of foreign construction material. (b) The head of the contracting activity is the agency...

  6. 48 CFR 204.7205 - Novation agreements, mergers and sales of assets.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Novation agreements, mergers and sales of assets. 204.7205 Section 204.7205 Federal Acquisition Regulations System DEFENSE... 204.7205 Novation agreements, mergers and sales of assets. Contracting officers shall process and...

  7. 48 CFR 204.7206 - Using CAGE codes to identify agents and brokers.

    Science.gov (United States)

    2010-10-01

    ... identify agents and brokers. 204.7206 Section 204.7206 Federal Acquisition Regulations System DEFENSE... 204.7206 Using CAGE codes to identify agents and brokers. Authorized agents and brokers are entities... code will be assigned to the agent/broker establishment in addition to any codes assigned to the...

  8. 5 CFR 2610.204 - When an application may be filed.

    Science.gov (United States)

    2010-01-01

    ....204 Section 2610.204 Administrative Personnel OFFICE OF GOVERNMENT ETHICS ORGANIZATION AND PROCEDURES IMPLEMENTATION OF THE EQUAL ACCESS TO JUSTICE ACT Information Required From Applicants § 2610.204 When an... the Office of Government Ethics' final disposition of the proceeding. (b) For purposes of this rule...

  9. 41 CFR 50-204.72 - Safe practices for welding and cutting on containers which have held combustibles.

    Science.gov (United States)

    2010-07-01

    ... welding and cutting on containers which have held combustibles. 50-204.72 Section 50-204.72 Public... OF LABOR 204-SAFETY AND HEALTH STANDARDS FOR FEDERAL SUPPLY CONTRACTS Gases, Vapors, Fumes, Dusts, and Mists § 50-204.72 Safe practices for welding and cutting on containers which have held...

  10. 48 CFR 53.204-1 - Safeguarding classified information within industry (DD Form 254, DD Form 441).

    Science.gov (United States)

    2010-10-01

    ... information within industry (DD Form 254, DD Form 441). 53.204-1 Section 53.204-1 Federal Acquisition....204-1 Safeguarding classified information within industry (DD Form 254, DD Form 441). The following... specified in subpart 4.4 and the clause at 52.204-2: (a) DD Form 254 (Department of Defense (DOD)), Contract...

  11. Molecular characterization of the 17D-204 yellow fever vaccine.

    Science.gov (United States)

    Salmona, Maud; Gazaigne, Sandrine; Mercier-Delarue, Severine; Garnier, Fabienne; Korimbocus, Jehanara; Colin de Verdière, Nathalie; LeGoff, Jerome; Roques, Pierre; Simon, François

    2015-10-05

    The worldwide use of yellow fever (YF) live attenuated vaccines came recently under close scrutiny as rare but serious adverse events have been reported. The population identified at major risk for these safety issues were extreme ages and immunocompromised subjects. Study NCT01426243 conducted by the French National Agency for AIDS research is an ongoing interventional study to evaluate the safety of the vaccine and the specific immune responses in HIV-infected patients following 17D-204 vaccination. As a preliminary study, we characterized the molecular diversity from E gene of the single 17D-204 vaccine batch used in this clinical study. Eight vials of lyophilized 17D-204 vaccine (Stamaril, Sanofi-Pasteur, Lyon, France) of the E5499 batch were reconstituted for viral quantification, cloning and sequencing of C/prM/E region. The average rate of virions per vial was 8.68 ± 0.07 log₁₀ genome equivalents with a low coefficient of variation (0.81%). 246 sequences of the C/prM/E region (29-33 per vials) were generated and analyzed for the eight vials, 25 (10%) being defective and excluded from analyses. 95% of sequences had at least one nucleotide mutation. The mutations were observed on 662 variant sites distributed through all over the 1995 nucleotides sequence and were mainly non-synonymous (66%). Genome variability between vaccine vials was highly homogeneous with a nucleotide distance ranging from 0.29% to 0.41%. Average p-distances observed for each vial were also homogeneous, ranging from 0.15% to 0.31%. This study showed a homogenous YF virus RNA quantity in vaccine vials within a single lot and a low clonal diversity inter and intra vaccine vials. These results are consistent with a recent study showing that the main mechanism of attenuation resulted in the loss of diversity in the YF virus quasi-species. Copyright © 2015 Elsevier Ltd. All rights reserved.

  12. 29 CFR 778.204 - “Clock pattern” premium pay.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false âClock patternâ premium pay. 778.204 Section 778.204 Labor... Excluded From the âRegular Rateâ Extra Compensation Paid for Overtime § 778.204 “Clock pattern” premium pay... pursuance of an applicable employment contract or collective bargaining agreement,” and the rates of pay and...

  13. 48 CFR 52.204-9 - Personal Identity Verification of Contractor Personnel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Personal Identity Verification of Contractor Personnel. 52.204-9 Section 52.204-9 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of...

  14. 7 CFR 205.204 - Seeds and planting stock practice standard.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Seeds and planting stock practice standard. 205.204... Requirements § 205.204 Seeds and planting stock practice standard. (a) The producer must use organically grown seeds, annual seedlings, and planting stock: Except, That, (1) Nonorganically produced, untreated seeds...

  15. 17 CFR 275.204A-1 - Investment adviser codes of ethics.

    Science.gov (United States)

    2010-04-01

    ... ethics. 275.204A-1 Section 275.204A-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... codes of ethics. (a) Adoption of code of ethics. If you are an investment adviser registered or required... enforce a written code of ethics that, at a minimum, includes: (1) A standard (or standards) of business...

  16. 40 CFR 204.58-3 - Instructions for maintenance, use, and repair.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Instructions for maintenance, use, and repair. 204.58-3 Section 204.58-3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... to secure an unfair competitive advantage. They should not restrict replacement equipment to original...

  17. 28 CFR 301.204 - Continuation of lost-time wages.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Continuation of lost-time wages. 301.204... ACCIDENT COMPENSATION Lost-Time Wages § 301.204 Continuation of lost-time wages. (a) Once approved, the inmate shall receive lost-time wages until the inmate: (1) Is released; (2) Is transferred to another...

  18. 42 CFR 3.204 - Privilege of patient safety work product.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Privilege of patient safety work product. 3.204... PROVISIONS PATIENT SAFETY ORGANIZATIONS AND PATIENT SAFETY WORK PRODUCT Confidentiality and Privilege Protections of Patient Safety Work Product § 3.204 Privilege of patient safety work product. (a) Privilege...

  19. Assessment of the myostatin Q204X allele using an allelic discrimination assay

    Directory of Open Access Journals (Sweden)

    Ana M. Sifuentes-Rincón

    2006-01-01

    Full Text Available An allelic discrimination assay was designed and used to determine the genotypic and allelic frequencies of the myostatin (MSTN gene Q204X allele from two Mexican Full-French herds. The assay is a simple high throughput genotyping method that could be applied to investigate the effect of the Q204X allele on the Charolais breed.

  20. 48 CFR 3052.204-70 - Security requirements for unclassified information technology resources.

    Science.gov (United States)

    2010-10-01

    ... unclassified information technology resources. 3052.204-70 Section 3052.204-70 Federal Acquisition Regulations... for unclassified information technology resources. As prescribed in (HSAR) 48 CFR 3004.470-3, insert a clause substantially the same as follows: Security Requirements for Unclassified Information Technology...

  1. 17 CFR 204.55 - Change in notification to Financial Management Service.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Change in notification to Financial Management Service. 204.55 Section 204.55 Commodity and Securities Exchanges SECURITIES AND... Financial Management Service. After the Commission sends FMS notification of an individual's liability for a...

  2. 7 CFR 1710.204 - Filing requirements for borrowers that must maintain an approved load forecast on an ongoing basis.

    Science.gov (United States)

    2010-01-01

    ... an approved load forecast on an ongoing basis. 1710.204 Section 1710.204 Agriculture Regulations of... AND PRE-LOAN POLICIES AND PROCEDURES COMMON TO ELECTRIC LOANS AND GUARANTEES Load Forecasts § 1710.204 Filing requirements for borrowers that must maintain an approved load forecast on an ongoing basis. (a...

  3. 8 CFR 204.7 - Preservation of benefits contained in savings clause of Immigration and Nationality Act...

    Science.gov (United States)

    2010-01-01

    ... savings clause of Immigration and Nationality Act Amendments of 1976. 204.7 Section 204.7 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS IMMIGRANT PETITIONS Immigrant Visa Petitions § 204.7 Preservation of benefits contained in savings clause of Immigration and Nationality Act...

  4. 24 CFR 960.204 - Denial of admission for criminal activity or drug abuse by household members.

    Science.gov (United States)

    2010-04-01

    ... activity or drug abuse by household members. 960.204 Section 960.204 Housing and Urban Development... HOUSING Admission § 960.204 Denial of admission for criminal activity or drug abuse by household members...) Persons subject to sex offender registration requirement. The PHA must establish standards that prohibit...

  5. miR-204-5p suppresses cell proliferation by inhibiting IGFBP5 in papillary thyroid carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Lianyong; Wang, Jingnan; Li, Xiangqi; Ma, Junhua; Shi, Chao; Zhu, Hongling; Xi, Qian; Zhang, Jichen; Zhao, Xuemei; Gu, Mingjun, E-mail: mjgugonglihos@yeah.net

    2015-02-20

    microRNAs (miRNAs) are frequently dysregulated in human malignancies. It was recently shown that miR-204-5p is downregulated in papillary thyroid carcinoma (PTC); however, the functional significance of this observation is not known. This study investigated the role of miR-204-5p in PTC. Overexpressing miR-204-5p suppressed PTC cell proliferation and induced cell cycle arrest and apoptosis. The results of a luciferase reporter assay showed that miR-204-5p can directly bind to the 3′ untranslated region (UTR) of insulin-like growth factor-binding protein 5 (IGFBP5) mRNA, and IGFBP5 overexpression partially reversed the growth-inhibitory effects of miR-204-5p. These results indicate that miR-204-5p acts as a tumor suppressor in PTC by regulating IGFBP5 expression and that miR-204-5p can potentially serve as an antitumorigenic agent in the treatment of PTC. - Highlights: • miR-204-5p expression is downregulated in PTC tissues and cell lines. • miR-204-5p suppresses proliferation and promotes apoptosis in PTC cells. • miR-204-5p suppresses IGFBP5 expression by direct binding to the 3′-UTR. • IGFBP5 overexpression reverses the effects of miR-204-5p.

  6. Yeast Interacting Proteins Database: YMR204C, YJL185C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YMR204C INP1 Peripheral membrane protein of peroxisomes involved in peroxisomal inheritance... of peroxisomes involved in peroxisomal inheritance Rows with this bait as bait Rows with this bait as bait

  7. Tank characterization report for single-shell tank 241-C-204

    Energy Technology Data Exchange (ETDEWEB)

    Conner, J.M.

    1996-09-12

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-C-204. This report supports the requirements of Tri Party Agreement Milestone M 44 09.

  8. Yeast Interacting Proteins Database: YPL204W, YER095W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YPL204W HRR25 Protein kinase involved in regulating diverse events including vesicu... gene name HRR25 Bait description Protein kinase involved in regulating diverse events including vesicular t

  9. Tank 241-T-204, core 188 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Nuzum, J.L.

    1997-07-24

    TANK 241-T-204, CORE 188, ANALYTICAL RESULTS FOR THE FINAL REPORT. This document is the final laboratory report for Tank 241 -T-204. Push mode core segments were removed from Riser 3 between March 27, 1997, and April 11, 1997. Segments were received and extruded at 222-8 Laboratory. Analyses were performed in accordance with Tank 241-T-204 Push Mode Core Sampling and analysis Plan (TRAP) (Winkleman, 1997), Letter of instruction for Core Sample Analysis of Tanks 241-T-201, 241- T-202, 241-T-203, and 241-T-204 (LAY) (Bell, 1997), and Safety Screening Data Qual@ Objective (DO) ODukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DC) analyses exceeded the notification limits stated in DO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group and are not considered in this report.

  10. Ginseng Purified Dry Extract, BST204, Improved Cancer Chemotherapy-Related Fatigue and Toxicity in Mice.

    Science.gov (United States)

    Park, Hyun-Jung; Shim, Hyun Soo; Kim, Jeom Yong; Kim, Joo Young; Park, Sun Kyu; Shim, Insop

    2015-01-01

    Cancer related fatigue (CRF) is one of the most common side effects of cancer and its treatments. A large proportion of cancer patients experience cancer-related physical and central fatigue so new strategies are needed for treatment and improved survival of these patients. BST204 was prepared by incubating crude ginseng extract with ginsenoside-β-glucosidase. The purpose of the present study was to examine the effects of BST204, mixture of ginsenosides on 5-fluorouracil (5-FU)-induced CRF, the glycogen synthesis, and biochemical parameters in mice. The mice were randomly divided into the following groups: the naïve normal (normal), the HT-29 cell inoculated (xenograft), xenograft and 5-FU treated (control), xenograft + 5-FU + BST204-treated (100 and 200 mg/kg) (BST204), and xenograft + 5-FU + modafinil (13 mg/kg) treated group (modafinil). Running wheel activity and forced swimming test were used for evaluation of CRF. Muscle glycogen, serum inflammatory cytokines, aspartic aminotransferase (AST), alanine aminotransferase (ALT), creatinine (CRE), white blood cell (WBC), neutrophil (NEUT), red blood cell (RBC), and hemoglobin (HGB) were measured. Treatment with BST204 significantly increased the running wheel activity and forced swimming time compared to the control group. Consistent with the behavioral data, BST204 markedly increased muscle glycogen activity and concentrations of WBC, NEUT, RBC, and HGB. Also, tumor necrosis factor-α (TNF-α) and interleukin-6 (IL-6), AST, ALT, and CRE levels in the serum were significantly reduced in the BST204-treated group compared to the control group. This result suggests that BST204 may improve chemotherapy-related fatigue and adverse toxic side effects.

  11. Ginseng Purified Dry Extract, BST204, Improved Cancer Chemotherapy-Related Fatigue and Toxicity in Mice

    Directory of Open Access Journals (Sweden)

    Hyun-Jung Park

    2015-01-01

    Full Text Available Cancer related fatigue (CRF is one of the most common side effects of cancer and its treatments. A large proportion of cancer patients experience cancer-related physical and central fatigue so new strategies are needed for treatment and improved survival of these patients. BST204 was prepared by incubating crude ginseng extract with ginsenoside-β-glucosidase. The purpose of the present study was to examine the effects of BST204, mixture of ginsenosides on 5-fluorouracil (5-FU-induced CRF, the glycogen synthesis, and biochemical parameters in mice. The mice were randomly divided into the following groups: the naïve normal (normal, the HT-29 cell inoculated (xenograft, xenograft and 5-FU treated (control, xenograft + 5-FU + BST204-treated (100 and 200 mg/kg (BST204, and xenograft + 5-FU + modafinil (13 mg/kg treated group (modafinil. Running wheel activity and forced swimming test were used for evaluation of CRF. Muscle glycogen, serum inflammatory cytokines, aspartic aminotransferase (AST, alanine aminotransferase (ALT, creatinine (CRE, white blood cell (WBC, neutrophil (NEUT, red blood cell (RBC, and hemoglobin (HGB were measured. Treatment with BST204 significantly increased the running wheel activity and forced swimming time compared to the control group. Consistent with the behavioral data, BST204 markedly increased muscle glycogen activity and concentrations of WBC, NEUT, RBC, and HGB. Also, tumor necrosis factor-α (TNF-α and interleukin-6 (IL-6, AST, ALT, and CRE levels in the serum were significantly reduced in the BST204-treated group compared to the control group. This result suggests that BST204 may improve chemotherapy-related fatigue and adverse toxic side effects.

  12. Pax6 regulates gene expression in the vertebrate lens through miR-204.

    Science.gov (United States)

    Shaham, Ohad; Gueta, Karen; Mor, Eyal; Oren-Giladi, Pazit; Grinberg, Dina; Xie, Qing; Cvekl, Ales; Shomron, Noam; Davis, Noa; Keydar-Prizant, Maya; Raviv, Shaul; Pasmanik-Chor, Metsada; Bell, Rachel E; Levy, Carmit; Avellino, Raffaella; Banfi, Sandro; Conte, Ivan; Ashery-Padan, Ruth

    2013-01-01

    During development, tissue-specific transcription factors regulate both protein-coding and non-coding genes to control differentiation. Recent studies have established a dual role for the transcription factor Pax6 as both an activator and repressor of gene expression in the eye, central nervous system, and pancreas. However, the molecular mechanism underlying the inhibitory activity of Pax6 is not fully understood. Here, we reveal that Trpm3 and the intronic microRNA gene miR-204 are co-regulated by Pax6 during eye development. miR-204 is probably the best known microRNA to function as a negative modulator of gene expression during eye development in vertebrates. Analysis of genes altered in mouse Pax6 mutants during lens development revealed significant over-representation of miR-204 targets among the genes up-regulated in the Pax6 mutant lens. A number of new targets of miR-204 were revealed, among them Sox11, a member of the SoxC family of pro-neuronal transcription factors, and an important regulator of eye development. Expression of Trpm/miR-204 and a few of its targets are also Pax6-dependent in medaka fish eyes. Collectively, this study identifies a novel evolutionarily conserved mechanism by which Pax6 controls the down-regulation of multiple genes through direct up-regulation of miR-204.

  13. Pax6 regulates gene expression in the vertebrate lens through miR-204.

    Directory of Open Access Journals (Sweden)

    Ohad Shaham

    Full Text Available During development, tissue-specific transcription factors regulate both protein-coding and non-coding genes to control differentiation. Recent studies have established a dual role for the transcription factor Pax6 as both an activator and repressor of gene expression in the eye, central nervous system, and pancreas. However, the molecular mechanism underlying the inhibitory activity of Pax6 is not fully understood. Here, we reveal that Trpm3 and the intronic microRNA gene miR-204 are co-regulated by Pax6 during eye development. miR-204 is probably the best known microRNA to function as a negative modulator of gene expression during eye development in vertebrates. Analysis of genes altered in mouse Pax6 mutants during lens development revealed significant over-representation of miR-204 targets among the genes up-regulated in the Pax6 mutant lens. A number of new targets of miR-204 were revealed, among them Sox11, a member of the SoxC family of pro-neuronal transcription factors, and an important regulator of eye development. Expression of Trpm/miR-204 and a few of its targets are also Pax6-dependent in medaka fish eyes. Collectively, this study identifies a novel evolutionarily conserved mechanism by which Pax6 controls the down-regulation of multiple genes through direct up-regulation of miR-204.

  14. Genetic variation of the gene coding for microRNA-204 (miR-204) is a risk factor in acute myeloid leukaemia.

    Science.gov (United States)

    Butrym, Aleksandra; Łacina, Piotr; Kuliczkowski, Kazimierz; Bogunia-Kubik, Katarzyna; Mazur, Grzegorz

    2018-01-30

    MicroRNAs (miRNAs or miRs) are small molecules known to be involved in post-transcriptional gene expression. Many of them have been shown to influence risk for various diseases. Recent studies suggest that lower expression of miR-204, a gene coding for miRNA-204, is correlated with shorter survival in patients with acute myeloid leukaemia (AML). This observation prompted us to analyse the effect of two polymorphisms of the miR-204 gene, one in the upstream flanking region (rs718447 A > G) and the other inside the gene itself (rs112062096 A > G), both also in intron 3 of the TRPM3 gene. The study was conducted on DNA samples isolated from AML patients (n = 95) and healthy individuals (n = 148), who were genotyped using the Light SNiP assays. The miR-204 rs718447 GG homozygosity was found to constitute a risk factor associated with susceptibility to AML (73/95 vs 92/148, AML patients vs healthy controls, OR = 2.020, p = 0.017). Additionally, this genotype was more frequent in patients with subtypes M0-M1 in the French-American-British (FAB) classification as compared to patients with subtypes M2-M7 (23/25 vs 39/57, p = 0.026). We also found that presence of allele A was linked to longer survival of AML patients. Our results show that polymorphism in miR-204 flanking region may constitute a risk and prognostic factor in AML.

  15. 14 CFR 204.6 - Certificated and commuter air carriers proposing a change in operations, ownership, or management...

    Science.gov (United States)

    2010-01-01

    ... proposing a change in operations, ownership, or management which is not substantial. 204.6 Section 204.6... carriers proposing a change in operations, ownership, or management which is not substantial. Carriers proposing to make a change which would not substantially affect their operations, management, or ownership...

  16. 12 CFR 204.131 - Participation by a depository institution in the secondary market for its own time deposits.

    Science.gov (United States)

    2010-01-01

    ... the secondary market for its own time deposits. 204.131 Section 204.131 Banks and Banking FEDERAL... secondary market for its own time deposits. (a) Background. In 1982, the Board issued an interpretation concerning the effect of a member bank's purchase of its own time deposits in the secondary market in order...

  17. 30 CFR 204.215 - Are the information collection requirements in this subpart approved by the Office of Management...

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Are the information collection requirements in this subpart approved by the Office of Management and Budget (OMB)? 204.215 Section 204.215 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT ALTERNATIVES...

  18. 45 CFR 2540.204 - What procedures must I follow in conducting a National Service Criminal History Check for a...

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false What procedures must I follow in conducting a National Service Criminal History Check for a covered position? 2540.204 Section 2540.204 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE GENERAL ADMINISTRATIVE PROVISIONS Requirements...

  19. 75 FR 12731 - Foreign-Trade Zone 204-Tri-Cities Area, Tennessee/Virginia; Application for Expansion

    Science.gov (United States)

    2010-03-17

    ... Foreign-Trade Zones Board Foreign-Trade Zone 204--Tri-Cities Area, Tennessee/Virginia; Application for Expansion An application has been submitted to the Foreign-Trade Zones (FTZ) Board (the Board) by the Tri-Cities Airport Commission, grantee of FTZ 204, requesting authority to expand its zone to include a site...

  20. 75 FR 38979 - Expansion/Reorganization of Foreign-Trade Zone 204, Tri-Cities Area, TN/VA

    Science.gov (United States)

    2010-07-07

    ... Foreign-Trade Zones Board Expansion/Reorganization of Foreign-Trade Zone 204, Tri-Cities Area, TN/VA...), the Foreign-Trade Zones Board (the Board) adopts the following Order: Whereas, the Tri-Cities Airport... FTZ 204 to include a site in Bristol, Tennessee, adjacent to the Tri-Cities Customs and Border...

  1. 8 CFR 204.307 - Who may file a Form I-800A or Form I-800.

    Science.gov (United States)

    2010-01-01

    .... immigration law. If an alien spouse is present in a lawful status other than the status of an alien lawfully... alien who, if living in the United States, holds a lawful status under U.S. immigration law; and (3) The.... 204.307 Section 204.307 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS...

  2. Survival of Cochlear Spiral Ganglion Neurons Improved In vivo by Anti-miR204 via TMPRSS3.

    Science.gov (United States)

    Peng, A; Li, Y; Pan, X; Ge, S; Wang, Q; Li, S; Zhu, G; Liu, J

    2015-05-08

    Sensorineural hearing loss (SNHL) is caused by damage to hair cells followed by degeneration of the spiral ganglion neurons (SGNs), and cochlear implanting is an effective treatment. Unfortunately, the progressive hearing loss is still found due to ongoing degeneration of cochlear SGNs. The aim of this study was to investigate the neuroprotective effect of anti-miR204 on SGNs in vivo. Our recent in vitro work suggested that anti-miR204 could be a potential therapeutic strategy in SNHL via rescue cochlear SGNs. In order to further our knowledge of miR204 on SGNs in vivo, we made a kanamycin ototoxicity model and then virus containing the anti-miR204 gene (AAV1-anti-miR204) was microinjected into the cochlear of the model to monitor the effect. The SGNs were rescued by anti-miR204 in the kanamycin ototoxicity mouse group compared to the sham group. Moreover, expression of TMPRSS3 in SGNs was saved by anti-miR204 treatment. Anti-miR204 might be an alternate way to alleviate the degeneration of cochlear SGNs of kanamycin ototoxicity mice.

  3. 33 CFR 165.T14-204 - Safety Zone; fixed mooring balls, south of Barbers Pt Harbor Channel, Oahu, Hawaii.

    Science.gov (United States)

    2010-07-01

    ..., south of Barbers Pt Harbor Channel, Oahu, Hawaii. 165.T14-204 Section 165.T14-204 Navigation and... Pt Harbor Channel, Oahu, Hawaii. (a) Location. The following area is a safety zone: All waters... position is approximately 2,500 yards south of Barbers Point Harbor channel buoy #2, Oahu, Hawaii. This...

  4. 20 CFR 702.204 - Employer's report; penalty for failure to furnish and or falsifying.

    Science.gov (United States)

    2010-04-01

    ... AND PROCEDURE Claims Procedures Employer's Reports § 702.204 Employer's report; penalty for failure to furnish and or falsifying. Any employer, insurance carrier, or self-insured employer who knowingly and... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Employer's report; penalty for failure to...

  5. A JESD204B-Compliant Architecture for Remote and Deterministic-Latency Operation

    Science.gov (United States)

    Giordano, Raffaele; Izzo, Vincenzo; Perrella, Sabrina; Aloisio, Alberto

    2017-06-01

    High-speed analog-to-digital converters (ADCs) are key components in a huge variety of systems, including trigger and data acquisition (TDAQ) systems of nuclear and subnuclear physics experiments. Over the last decades, the sample rate and dynamic range of high-speed ADCs underwent a continuous growth, and it required the development of suitable interface protocols, such as the new JESD204B serial interface protocol. In this paper, we present an original JESD204B-compliant architecture we designed, which is able to operate an ADC in a remote fashion. Our design includes a deterministic-latency high-speed serial link, which is the only connection between the local and remote logic of the architecture and which preserves the deterministic timing features of the protocol. By means of our solution, it is possible to read data out of several converters, even remote to each other, and keep them operating synchronously. Our link also supports forward error correction (FEC) capabilities, in the view of the operation in radiation areas (e.g., on-detector in TDAQ systems). We describe an implementation of our concept in a latest generation field programmable gate array (Xilinx Kintex-7 325T) for reading data from a high-speed JESD204B-compliant ADC. We present measurements of the jitter of JESD204B timing-critical signals forwarded over the link and of latency determinism of the FEC-protected link.

  6. RESULTS OF AIRPLANE TU-204-300 OPERATED BY "VLADIVOSTOK AVIA" COMPANY FUEL FLOW MONITIRING

    Directory of Open Access Journals (Sweden)

    G. E. Maslennikova

    2014-01-01

    Full Text Available This article describes the results obtained from continuous monitoring of fuel flow on the airplanes Tu-204-300, operated by the aircompany "Vladivostok Avia". The reasons for the change in the cost of each copy of airplane and changes in fuel characteristics due to pilots manner of flying.

  7. 42 CFR 412.204 - Payment to hospitals located in Puerto Rico.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Payment to hospitals located in Puerto Rico. 412... Payment System for Inpatient Operating Costs for Hospitals Located in Puerto Rico § 412.204 Payment to hospitals located in Puerto Rico. (a) FY 1988 through FY 1997. For discharges occurring on or after October...

  8. 13 CFR 126.204 - May a qualified HUBZone SBC have affiliates?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false May a qualified HUBZone SBC have... PROGRAM Requirements to be a Qualified HUBZone SBC § 126.204 May a qualified HUBZone SBC have affiliates? A concern may have affiliates provided that the aggregate size of the concern and all of its...

  9. 40 CFR 141.204 - Tier 3 Public Notice-Form, manner, and frequency of notice.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Tier 3 Public Notice-Form, manner, and... Drinking Water Violations § 141.204 Tier 3 Public Notice—Form, manner, and frequency of notice. (a) Which violations or situations require a Tier 3 public notice? Table 1 of this section lists the violation...

  10. 10 CFR 35.204 - Permissible molybdenum-99, strontium-82, and strontium-85 concentrations.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Permissible molybdenum-99, strontium-82, and strontium-85... Unsealed Byproduct Material-Written Directive Not Required § 35.204 Permissible molybdenum-99, strontium-82, and strontium-85 concentrations. (a) A licensee may not administer to humans a radiopharmaceutical...

  11. 8 CFR 204.310 - Filing requirements for Form I-800A.

    Science.gov (United States)

    2010-01-01

    ... States national or an alien who holds a lawful status under U.S. immigration law. (iv) A copy of the....310 Section 204.310 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS... the operation of State law must be noted and explained when the Form I-800A is filed. (viii) A home...

  12. 48 CFR 51.204 - Use of interagency fleet management system (IFMS) vehicles and related services.

    Science.gov (United States)

    2010-10-01

    ... Contractor Use of Interagency Fleet Management System (IFMS) 51.204 Use of interagency fleet management system (IFMS) vehicles and related services. Contractors authorized to use interagency fleet management... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Use of interagency fleet...

  13. 45 CFR 46.204 - Research involving pregnant women or fetuses.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Research involving pregnant women or fetuses. 46... PROTECTION OF HUMAN SUBJECTS Additional Protections for Pregnant Women, Human Fetuses and Neonates Involved in Research § 46.204 Research involving pregnant women or fetuses. Pregnant women or fetuses may be...

  14. 7 CFR 1744.204 - Rural development investments that do not meet the ratio requirements.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Rural development investments that do not meet the... GUARANTEED AND INSURED TELEPHONE LOANS Borrower Investments § 1744.204 Rural development investments that do... consider, on a case-by-case basis, requests for approval of rural development investments not constituting...

  15. 42 CFR 420.204 - Principals convicted of a program-related crime.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Principals convicted of a program-related crime... and Control Information § 420.204 Principals convicted of a program-related crime. (a) Information... the facts and circumstances of the specific case, including the nature and severity of the crime...

  16. 5 CFR 430.204 - Agency performance appraisal system(s).

    Science.gov (United States)

    2010-01-01

    ... Other Employees § 430.204 Agency performance appraisal system(s). (a) Each agency as defined at section... parameters for the application and operation of performance appraisal within the agency for the employees...) Communicating performance plans to employees at the beginning of an appraisal period; (iii) Evaluating each...

  17. 31 CFR 500.803 - Customs procedures; merchandise specified in § 500.204.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Customs procedures; merchandise... CONTROL REGULATIONS Procedures § 500.803 Customs procedures; merchandise specified in § 500.204. (a) With... United States, directors of customs shall not accept or allow any: (1) Entry for consumption (including...

  18. 31 CFR 515.803 - Customs procedures; merchandise specified in § 515.204.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Customs procedures; merchandise... CONTROL REGULATIONS Procedures § 515.803 Customs procedures; merchandise specified in § 515.204. (a) With... thereto) whether or not such merchandise has been imported into the United States, collectors of customs...

  19. 41 CFR 109-38.204-4 - Report of exempted motor vehicles.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Report of exempted motor..., TRANSPORTATION, AND MOTOR VEHICLES 38-MOTOR EQUIPMENT MANAGEMENT 38.2-Registration, Identification, and Exemptions § 109-38.204-4 Report of exempted motor vehicles. DOE offices shall provide upon request the...

  20. 29 CFR 779.204 - Common types of “enterprise.”

    Science.gov (United States)

    2010-07-01

    ... Business Unit § 779.204 Common types of “enterprise.” (a) The single establishment business. In the... purpose and there is both unified operation and common control. The entire business is the unit for... control into a unified business system or economic unit to serve a common business purpose. (S. Rept. 145...

  1. 7 CFR 810.204 - Grades and grade requirements for Six-rowed Malting barley and Six-rowed Blue Malting barley.

    Science.gov (United States)

    2010-01-01

    ... barley and Six-rowed Blue Malting barley. 810.204 Section 810.204 Agriculture Regulations of the... Standards for Barley Principles Governing the Application of Standards § 810.204 Grades and grade requirements for Six-rowed Malting barley and Six-rowed Blue Malting barley. Grade Minimum limits of— Test...

  2. Deep Ly alpha imaging of two z=2.04 GRB host galaxy fields

    DEFF Research Database (Denmark)

    Fynbo, J.P.U.; Møller, Per; Thomsen, Bente

    2002-01-01

    We report on the results of deep narrow-band Lyalpha and broad-band U and I imaging of the fields of two Gamma-Ray bursts at redshift z = 2.04 (GRB 000301C and GRB 000926). We find that the host galaxy of GRB 000926 is an extended (more than 2 arcsec), strong Lyalpha emitter with a rest-frame equ......We report on the results of deep narrow-band Lyalpha and broad-band U and I imaging of the fields of two Gamma-Ray bursts at redshift z = 2.04 (GRB 000301C and GRB 000926). We find that the host galaxy of GRB 000926 is an extended (more than 2 arcsec), strong Lyalpha emitter with a rest...

  3. Neutron capture at the s-process branching points $^{171}$Tm and $^{204}$Tl

    CERN Multimedia

    Branching points in the s-process are very special isotopes for which there is a competition between the neutron capture and the subsequent b-decay chain producing the heavy elements beyond Fe. Typically, the knowledge on the associated capture cross sections is very poor due to the difficulty in obtaining enough material of these radioactive isotopes and to measure the cross section of a sample with an intrinsic activity; indeed only 2 out o the 21 ${s}$-process branching points have ever been measured by using the time-of-flight method. In this experiment we aim at measuring for the first time the capture cross sections of $^{171}$Tm and $^{204}$Tl, both of crucial importance for understanding the nucleosynthesis of heavy elements in AGB stars. The combination of both (n,$\\gamma$) measurements on $^{171}$Tm and $^{204}$Tl will allow one to accurately constrain neutron density and the strength of the 13C(α,n) source in low mass AGB stars. Additionally, the cross section of $^{204}$Tl is also of cosmo-chrono...

  4. Histological and Pathological Assessment of miR-204 and SOX4 Levels in Gastric Cancer Patients.

    Science.gov (United States)

    Yuan, Xiao; Wang, Shuanhu; Liu, Mulin; Lu, Zhen; Zhan, Yanqing; Wang, Wenbin; Xu, A-Man

    2017-01-01

    Gastric cancer is one of the most common cancers and the efficient therapeutic methods are limited. Further study of the exact molecular mechanism of gastric cancer to develop novel targeted therapies is necessary and urgent. We herein systematically examined that miR-204 suppressed both proliferation and metastasis of gastric cancer AGS cells. miR-204 directly targeted SOX4. In clinical tissue research, we determined that miR-204 was expressed much lower and SOX4 expressed much higher in gastric cancer tissues compared with normal gastric tissues. Associated analysis with clinicopathological parameters in gastric cancer patients showed miR-204 was associated with no lymph node metastasis and early tumor stages whereas SOX4 was associated with lymph node metastasis and advanced tumor stages. In addition, miR-204 and SOX4 were negatively correlated in tissues from gastric cancer patients. Our findings examined the important role of miR-204 and SOX4 played in gastric cancer, and they could be used as candidate therapeutic targets for gastric cancer therapy.

  5. Comparison of plateletpheresis on the Fresenius AS.TEC 204 and Haemonetics MCS 3p.

    Science.gov (United States)

    Ranganathan, Sudha

    2007-02-01

    This is an attempt at comparing two cell separators for plateletpheresis, namely the Fresenius AS.TEC 204 and Haemonetics MCS 3p, at a tertiary care center in India. Donors who weighed between 55-75 kg, who had a hematocrit of 41-43%, and platelet counts of 250x10(3)-400x10(3)/microl were selected for the study. The comparability of the donors who donated on the two cell separators were analysed by t-test independent samples and no significant differences were found (P>0.05). The features compared were time taken for the procedure, volume processed on the separators, adverse reactions of the donors, quality control of the product, separation efficiency of the separators, platelet loss in the donors after the procedure, and the predictor versus the actual yield of platelets given by the cell separator. The volume processed to get a target yield of >3x10(11) was equal to 2.8-3.2 l and equal in both the cell separators. Symptoms of citrate toxicity were seen in 4 and 2.5% of donors who donated on the MCS 3p and the AS.TEC 204, respectively, and 3 and 1% of donors, respectively, had vasovagal reactions. All the platelet products collected had a platelet count of >3x10(11); 90% of the platelet products collected on the AS.TEC 204 attained the predicted yield that was set on the cell separator where as 75% of the platelet products collected on the MCS 3p attained the target yield. Quality control of the platelets collected on both the cell separators complied with the standards except that 3% of the platelets collected on the MCS 3p had a visible red cell contamination. The separation efficiency of the MCS 3p was higher, 50-52% as compared to the 40-45% on the AS.TEC 204. A provision of double venous access, less adverse reactions, negligible RBC contamination with a better predictor yield of platelets makes the AS.TEC 204 a safer and more reliable alternative than the widely used Haemonetics MCS 3p. Copyright (c) 2006 Wiley-Liss, Inc.

  6. Networking automation of ECI’s G-204 electronic engineering laboratory

    Directory of Open Access Journals (Sweden)

    Hernán Paz Penagos

    2010-04-01

    Full Text Available Increased use (by students and teachers of the “Escuela Colombiana de Ingeniería Julio Garavito” Electronic Engineering laboratories during the last year has congested access to these laboratories; the School’s Electronic Engineering (Ecitronica programme’s applied Electronic studies’ centre research group thus proposed, designed and developed a research prolect taking advantage of G building’s electrical distribution to offer access facilities, laboratory equipment control, energy saving and improved service quality. The G-204 laboratory’s network sys- tem will have an access control subsystem with client–main computer architecture. The latter consists of a user, schedule, group and work-bank database; the user is connected from any computer (client to the main computer through Internet to reserve his/her turn at laboratory practice by selecting the schedule, group, work-bank, network type required (1Ф or 3Ф and registering co-workers. Access to the G-204 laboratory on the day and time of practice is made by means of an intelligent card reader. Information of public interest produced and controlled by the main computer is displayed on three LCD screens located on one of G building’s second floor walls, as is an electronic clock. The G-204 laboratory temperature and time are continually updated. Work-banks are enabled or disabled by the main computer; the work banks are provided with power (beginning of practice or disconnected (end of practice or due to eventualities to protect the equipment, save energy, facilitate monitors and supervise the logistics of the state of the equipment at the end of each practice. The research group was organised into Transmission Line and Applications sub-groups. Power Line Communications PLC technology was used for to exploring digital modulation alternatives, coding and detecting errors, coupling, data transmission protocols and new applications, all based on channel estimation (networking

  7. MiR-204 silencing in intraepithelial to invasive cutaneous squamous cell carcinoma progression

    OpenAIRE

    Toll, Agust?; Salgado, Roc?o; Espinet, Blanca; D?az-Lagares, Angel; Hern?ndez-Ruiz, Eugenia; Andrades, Evelyn; Sandoval, Juan; Esteller, Manel; Pujol, Ram?n M; Hern?ndez-Mu?oz, Inmaculada

    2016-01-01

    Background Cutaneous squamous cell carcinoma (cSCC) is the second most common skin cancer and frequently progresses from an actinic keratosis (AK), a sun-induced keratinocyte intraepithelial neoplasia (KIN). Epigenetic mechanisms involved in the phenomenon of progression from AK to cSCC remain to be elicited. Methods Expression of microRNAs in sun-exposed skin, AK and cSCC was analysed by Agilent microarrays. DNA methylation of miR-204 promoter was determined by bisulphite treatment and pyros...

  8. Report of Apollo 204 Review Board to the Administrator, National Aeronautics and Space Administration . Appendix F ; Schedule of Physical Evidence

    Science.gov (United States)

    1967-01-01

    Immediately following the Apollo 204 accident of January 27, 1961. all associated equipment and material were impounded. Release of this equipment and material for normal use was under the close control of the Apollo 204 Review Board. Apollo Review Board Administrative Procedure No. 11, February 11, 1961, established the Apollo 204 Review Board Material Release Record (MRR). This MRR was the official form used to release material from full impoundment and was valid only after being approved by the Board and signed by a Member. The form was used as the authority to place any impounded item into one of the three Categories defined in Administrative Procedure No. 11. This appendix contains all of the authorized MRR's. Each item submitted on an MRR was given a control number; a description, including the part number and serial number; the relevance and location to the accident; any constraints before release; and the control category. The categories placed on the equipment were as follows: Category A - Items which may have a significant influence or bearing on the results or findings of the Apollo 204 Review Board; Category B - All material other than Category A which is considered relevant to the Apollo 204 Review Board investigation; Category C - Material released from Board jurisdiction. Several classes of equipment were released by special Board action prior to the establishment of the MRR system. The operating procedure for release of these classes is Enclosure F-l to this appendix.

  9. An activin A/BMP2 chimera, AB204, displays bone-healing properties superior to those of BMP2.

    Science.gov (United States)

    Yoon, Byung-Hak; Esquivies, Luis; Ahn, Chihoon; Gray, Peter C; Ye, Sang-Kyu; Kwiatkowski, Witek; Choe, Senyon

    2014-09-01

    Recombinant bone morphogenetic protein 2 (rhBMP2) has been used clinically to treat bone fractures in human patients. However, the high doses of rhBMP2 required for a therapeutic response can cause undesirable side effects. Here, we demonstrate that a novel Activin A/BMP2 (AB2) chimera, AB204, promotes osteogenesis and bone healing much more potently and effectively than rhBMP2. Remarkably, 1 month of AB204 treatment completely heals tibial and calvarial defects of critical size in mice at a concentration 10-fold lower than a dose of rhBMP2 that only partially heals the defect. We determine the structure of AB204 to 2.3 Å that reveals a distinct BMP2-like fold in which the Activin A sequence segments confer insensitivity to the BMP2 antagonist Noggin and an affinity for the Activin/BMP type II receptor ActRII that is 100-fold greater than that of BMP2. The structure also led to our identification of a single Activin A-derived amino acid residue, which, when mutated to the corresponding BMP2 residue, resulted in a significant increase in the affinity of AB204 for its type I receptor BMPRIa and a further enhancement in AB204's osteogenic potency. Together, these findings demonstrate that rationally designed AB2 chimeras can provide BMP2 substitutes with enhanced potency for treating non-union bone fractures. © 2014 American Society for Bone and Mineral Research.

  10. Corrective Action Decision Document for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada, Rev. No. 0

    Energy Technology Data Exchange (ETDEWEB)

    Robert Boehlecke

    2004-04-01

    The six bunkers included in CAU 204 were primarily used to monitor atmospheric testing or store munitions. The ''Corrective Action Investigation Plan (CAIP) for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada'' (NNSA/NV, 2002a) provides information relating to the history, planning, and scope of the investigation; therefore, it will not be repeated in this CADD. This CADD identifies potential corrective action alternatives and provides a rationale for the selection of a recommended corrective action alternative for each CAS within CAU 204. The evaluation of corrective action alternatives is based on process knowledge and the results of investigative activities conducted in accordance with the CAIP (NNSA/NV, 2002a) that was approved prior to the start of the Corrective Action Investigation (CAI). Record of Technical Change (ROTC) No. 1 to the CAIP (approval pending) documents changes to the preliminary action levels (PALs) agreed to by the Nevada Division of Environmental Protection (NDEP) and DOE, National Nuclear Security Administration Nevada Site Office (NNSA/NSO). This ROTC specifically discusses the radiological PALs and their application to the findings of the CAU 204 corrective action investigation. The scope of this CADD consists of the following: (1) Develop corrective action objectives; (2) Identify corrective action alternative screening criteria; (3) Develop corrective action alternatives; (4) Perform detailed and comparative evaluations of corrective action alternatives in relation to corrective action objectives and screening criteria; and (5) Recommend and justify a preferred corrective action alternative for each CAS within CAU 204.

  11. 41 CFR 302-9.204 - What is the “authorized point of origin” when I transport my POV from my post of duty?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 4 2010-07-01 2010-07-01 false What is the âauthorized point of originâ when I transport my POV from my post of duty? 302-9.204 Section 302-9.204 Public Contracts and Property Management Federal Travel Regulation System RELOCATION ALLOWANCES TRANSPORTATION AND...

  12. 25 CFR 900.204 - Is FTCA the exclusive remedy for a non-medical related tort claim arising out of the performance...

    Science.gov (United States)

    2010-04-01

    ... HEALTH AND HUMAN SERVICES CONTRACTS UNDER THE INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT... contractor or employee based upon performance of non-medical-related functions under a self-determination... tort claim arising out of the performance of a self-determination contract? 900.204 Section 900.204...

  13. 41 CFR 302-4.204 - If my spouse does not accompany me but travels unaccompanied at a different time, what per diem...

    Science.gov (United States)

    2010-07-01

    ... accompany me but travels unaccompanied at a different time, what per diem rate will he/she receive? 302-4.204 Section 302-4.204 Public Contracts and Property Management Federal Travel Regulation System... my spouse does not accompany me but travels unaccompanied at a different time, what per diem rate...

  14. 42 CFR 495.204 - Incentive payments to qualifying MA organizations for MA-EPs and MA-affiliated eligible hospitals.

    Science.gov (United States)

    2010-10-01

    ... for MA-EPs and MA-affiliated eligible hospitals. 495.204 Section 495.204 Public Health CENTERS FOR... CERTIFICATION STANDARDS FOR THE ELECTRONIC HEALTH RECORD TECHNOLOGY INCENTIVE PROGRAM Requirements Specific to...-EPs and MA-affiliated eligible hospitals. (a) General rule. A qualifying MA organization receives an...

  15. Breakup mechanisms for 7Li + 197Au, 204Pb systems at sub-barrier energies

    Directory of Open Access Journals (Sweden)

    Luong D.H.

    2013-12-01

    Full Text Available Coincidence measurements of breakup fragments were carried out for the 7Li + 197Au and 204Pb systems at sub-barrier energies. The mechanisms triggering breakup, and time-scales of each process, were identified through the reaction Q-values and the relative energy of the breakup fragments. Binary breakup of 7Li were found to be predominantly triggered by nucleon transfer, with p-pickup leading to 8Be → α + α decay being the preferred breakup mode. From the time-scales of each process, the coincidence yields were separated into prompt and delayed components, allowing the identification of breakup process important in the suppression of complete fusion of 7Li at above-barrier energies.

  16. Cortical Morphogenesis during Embryonic Development Is Regulated by miR-34c and miR-204

    DEFF Research Database (Denmark)

    Veno, Morten T.; Veno, Susanne T.; Rehberg, Kati

    2017-01-01

    The porcine brain closely resembles the human brain in aspects such as development and morphology. Temporal miRNA profiling in the developing embryonic porcine cortex revealed a distinct set of miRNAs, including miR-34c and miR-204, which exhibited a highly specific expression profile across...

  17. 78 FR 12716 - Reorganization of Foreign-Trade Zone 204 Under Alternative Site Framework Tri-Cities, Tennessee...

    Science.gov (United States)

    2013-02-25

    ... Foreign-Trade Zones Board Reorganization of Foreign-Trade Zone 204 Under Alternative Site Framework Tri-Cities, Tennessee/Virginia Pursuant to its authority under the Foreign-Trade Zones Act of June 18, 1934, as amended (19 U.S.C. 81a-81u), the Foreign-Trade Zones Board (the Board) adopts the following Order...

  18. The 17D-204 and 17DD yellow fever vaccines: an overview of major similarities and subtle differences.

    Science.gov (United States)

    Ferreira, Clarissa de Castro; Campi-Azevedo, Ana Carolina; Peruhype-Magalhāes, Vanessa; Costa-Pereira, Christiane; Albuquerque, Cleandro Pires de; Muniz, Luciana Feitosa; Yokoy de Souza, Talita; Oliveira, Ana Cristina Vanderley; Martins-Filho, Olindo Assis; da Mota, Licia Maria Henrique

    2017-11-27

    The yellow fever vaccine is a live attenuated virus vaccine that is considered one of the most efficient vaccines produced to date. The original 17D strain generated the substrains 17D-204 and 17DD, which are used for the current production of vaccines against yellow fever. The 17D-204 and 17DD substrains present subtle differences in their nucleotide compositions, which can potentially lead to variations in immunogenicity and reactogenicity. We will address the main changes in the immune responses induced by the 17D-204 and 17DD yellow fever vaccines and report similarities and differences between these vaccines in cellular and humoral immunity . This is a relevant issue in view of the re-emergence of yellow fever in Uganda in 2016 and in Brazil in the beginning of 2017. Areas covered: This article will be divided into 8 sections that will analyze the innate immune response, adaptive immune response, humoral response, production of cytokines, immunity in children, immunity in the elderly, gene expression and adverse reactions. Expert commentary: The 17D-204 and 17DD yellow fever vaccines present similar immunogenicity, with strong activation of the cellular and humoral immune responses. Additionally, both vaccines have similar adverse effects, which are mostly mild and thus are considered safe.

  19. 5 CFR 894.204 - May I be enrolled in more than one dental or vision plan at a time?

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false May I be enrolled in more than one dental... PROGRAM Coverage and Types of Enrollment § 894.204 May I be enrolled in more than one dental or vision plan at a time? You may be enrolled in a FEDVIP dental plan and a separate FEDVIP vision plan at the...

  20. 20 CFR 718.204 - Total disability and disability causation defined; criteria for determining total disability and...

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Total disability and disability causation defined; criteria for determining total disability and total disability due to pneumoconiosis. 718.204... MINE HEALTH AND SAFETY ACT OF 1969, AS AMENDED STANDARDS FOR DETERMINING COAL MINERS' TOTAL DISABILITY...

  1. Micro-RNA-204 Participates in TMPRSS2/ERG Regulation and Androgen Receptor Reprogramming in Prostate Cancer.

    Science.gov (United States)

    Todorova, Krassimira; Metodiev, Metodi V; Metodieva, Gergana; Mincheff, Milcho; Fernández, Nelson; Hayrabedyan, Soren

    2017-02-01

    Cancer progression is driven by genome instability incurred rearrangements such as transmembrane protease, serine 2 (TMPRSS2)/v-ets erythroblastosis virus E26 oncogene (ERG) that could possibly turn some of the tumor suppressor micro-RNAs into pro-oncogenic ones. Previously, we found dualistic miR-204 effects, acting either as a tumor suppressor or as an oncomiR in ERG fusion-dependent manner. Here, we provided further evidence for an important role of miR-204 for TMPRSS2/ERG and androgen receptor (AR) signaling modulation and fine tuning that prevents TMPRSS2/ERG overexpression in prostate cancer. Based on proximity-based ligation assay, we designed a novel method for detection of TMPRSS2/ERG protein products. We found that miR-204 is TMPRSS2/ERG oncofusion negative regulator, and this was mediated by DNA methylation of TMPRSS2 promoter. Transcriptional factors runt-related transcription factor 2 (RUNX2) and ETS proto-oncogene 1 (ETS1) were positive regulators of TMPRSS2/ERG expression and promoter hypo-methylation. Clustering of patients' sera for fusion protein, transcript expression, and wild-type ERG transcript isoforms, demonstrated not all patients harboring fusion transcripts had fusion protein products, and only few fusion positive ones exhibited increased wild-type ERG transcripts. miR-204 upregulated AR through direct promoter hypo-methylation, potentiated by the presence of ERG fusion and RUNX2 and ETS1. Proteomics studies provided evidence that miR-204 has dualistic role in AR cancer-related reprogramming, promoting prostate cancer-related androgen-responsive genes and AR target genes, as well as AR co-regulatory molecules. miR-204 methylation regulation was supported by changes in molecules responsible for chromatin remodeling, DNA methylation, and its regulation. In summary, miR-204 is a mild regulator of the AR function during the phase of preserved AR sensitivity as the latter one is required for ERG-fusion translocation.

  2. Genomic loss of tumor suppressor miRNA-204 promotes cancer cell migration and invasion by activating AKT/mTOR/Rac1 signaling and actin reorganization.

    Directory of Open Access Journals (Sweden)

    J Saadi Imam

    Full Text Available Increasing evidence suggests that chromosomal regions containing microRNAs are functionally important in cancers. Here, we show that genomic loci encoding miR-204 are frequently lost in multiple cancers, including ovarian cancers, pediatric renal tumors, and breast cancers. MiR-204 shows drastically reduced expression in several cancers and acts as a potent tumor suppressor, inhibiting tumor metastasis in vivo when systemically delivered. We demonstrated that miR-204 exerts its function by targeting genes involved in tumorigenesis including brain-derived neurotrophic factor (BDNF, a neurotrophin family member which is known to promote tumor angiogenesis and invasiveness. Analysis of primary tumors shows that increased expression of BDNF or its receptor tropomyosin-related kinase B (TrkB parallel a markedly reduced expression of miR-204. Our results reveal that loss of miR-204 results in BDNF overexpression and subsequent activation of the small GTPase Rac1 and actin reorganization through the AKT/mTOR signaling pathway leading to cancer cell migration and invasion. These results suggest that microdeletion of genomic loci containing miR-204 is directly linked with the deregulation of key oncogenic pathways that provide crucial stimulus for tumor growth and metastasis. Our findings provide a strong rationale for manipulating miR-204 levels therapeutically to suppress tumor metastasis.

  3. Pharmacokinetics and tissue distribution of ginsenoside Rh2 and Rg3 epimers after oral administration of BST204, a purified ginseng dry extract, in rats.

    Science.gov (United States)

    Bae, Soo Hyeon; Park, Jung Bae; Zheng, Yu Fen; Jang, Min Jung; Kim, Sun Ok; Kim, Jeom Yong; Yoo, Young Hyo; Yoon, Kee Dong; Oh, Euichaul; Bae, Soo Kyung

    2014-12-01

    1. BST204, a purified ginseng dry extract containing a high concentration of racemic Rh2 and Rg3 mixtures, is being developed for supportive care use in cancer patients in Korea. This study investigates the pharmacokinetics and tissue distribution of BST204 in rats. 2. After oral administration of BST204, only the S epimers, S-Rh2 and S-Rg3, could be determined in rat plasma. The poor absorption of the R-epimers, R-Rh2 and R-Rg3, may be attributed to lower membrane permeability and extensive intestinal oxygenation and/or deglycosylation into metabolites. The AUC and Cmax values of both S-Rh2 and S-Rg3 after BST204 oral administration were proportional to the administered BST204 doses ranged from 400 mg/kg to 2000 mg/kg, which suggested linear pharmacokinetic properties. 3. There were no statistically significant differences in the pharmacokinetics of S-Rh2 and S-Rg3 after oral administration of pure S-Rh2 (31.5 mg/kg) and S-Rg3 (68 mg/kg) compared with oral administration of BST204, 1000 mg/kg. These indicated that the presence of other components of BST204 extract did not influence the pharmacokinetic behavior of S-Rh2 and S-Rg3. 4. After oral dosing of BST204, S-Rh2 and S-Rg3 were distributed mainly to the liver and gastrointestinal tract in rats. 5. Our finding may help to understand pharmacokinetic characteristics of S-Rh2, R-Rh2, S-Rg3, and R-Rg3, comprehensively, and provide useful information in clinical application of BST204.

  4. Evaluation of Energy-Related Inventions Program: An Empirical Analysis of 204 Inventions

    Energy Technology Data Exchange (ETDEWEB)

    Brown, M.A.

    1987-01-01

    This report is an evaluation of the Energy-Related Inventions Program (ERIP). It assesses the program's effectiveness and impacts, characterizes participating inventions and inventors, and identifies correlates of successful commercialization in order to suggest possible improvements. Seventy of the 204 ERIP inventions that were studied were successfully introduced into the market, accounting for more than $200M in sales from 1976 through 1984. During 1984, 921 full-time equivalent employees were supported directly by ERIP inventors or their licensees. (Estimates of indirect economic impacts are also contained in the report.) Data on patterns of fund raising clearly show a need for assistance by programs like ERIP. Commercially successful inventors shared several traits. They had less formal education, fewer patents, more work experience in small firms, more outside funding early in their work, more shared responsibility with others for invention development, more management experience, and greater previous experience with starting new businesses. Recommendations are made regarding: (1) priorities for allocating ERIP grants; (2) improved efficiency of the NBS/DOE operations; (3) delivery of technical and commercialization assistance to grant recipients; and (4) further evaluation research.

  5. Identification of vortex structures in a cohort of 204 intracranial aneurysms.

    Science.gov (United States)

    Varble, Nicole; Trylesinski, Gabriel; Xiang, Jianping; Snyder, Kenneth; Meng, Hui

    2017-05-01

    An intracranial aneurysm (IA) is a cerebrovascular pathology that can lead to death or disability if ruptured. Abnormal wall shear stress (WSS) has been associated with IA growth and rupture, but little is known about the underlying flow physics related to rupture-prone IAs. Previous studies, based on analysis of a few aneurysms or partial views of three-dimensional vortex structures, suggest that rupture is associated with complex vortical flow inside IAs. To further elucidate the relevance of vortical flow in aneurysm pathophysiology, we studied 204 patient IAs (56 ruptured and 148 unruptured). Using objective quantities to identify three-dimensional vortex structures, we investigated the characteristics associated with aneurysm rupture and if these features correlate with previously proposed WSS and morphological characteristics indicative of IA rupture. Based on the Q-criterion definition of a vortex, we quantified the degree of the aneurysmal region occupied by vortex structures using the volume vortex fraction (vVF) and the surface vortex fraction (sVF). Computational fluid dynamics simulations showed that the sVF, but not the vVF, discriminated ruptured from unruptured aneurysms. Furthermore, we found that the near-wall vortex structures co-localized with regions of inflow jet breakdown, and significantly correlated to previously proposed haemodynamic and morphologic characteristics of ruptured IAs. © 2017 The Author(s).

  6. Skin Cancer: ClinicoPathological Study of 204 Patients in Southern Governorates of Yemen.

    Science.gov (United States)

    AlZou, Amer Bin; Thabit, Mazen Abood Bin; AlSakkaf, Khalid Abdulla; Basaleem, Huda Omer

    2016-01-01

    Skin cancer is a group of heterogeneous malignancies, in general classified into nonmelanoma skin cancer (NMSC) and melanoma skin cancer (MSC). Incidences are high in many parts in the world with considerable geographical and racial variation. In the Yemen, there has been scarce information about skin cancer. The aim of this study was to evaluate the demographic characteristics and histological trend of skin cancer in Southern Governorates of Yemen. This retrospective study covered 204 cases of skin cancer at the Modern Histopathology Laboratory and Aden Cancer Registry and Research Center, Faculty of Medicine and Health Sciences, University of Aden, for the period 20062013. Data were classified regarding different demographic and tumor related variables and analyzed using CanReg4 for cancer registry and SPSS (version 21). The commonest encountered skin cancer was NMSC (93.1%). Generally, skin cancer appears slightly more frequently in females than males with a 1:1.06 male: female ratio, with a mean age of 62.9 years. Slightly higher than onethird (36.3%) were from Aden governorate. The head and neck proved to be the most common site in both males and females (58%). Basal cell carcinoma (BCC) is the most common histological type of skin cancer (50.5%). Skin cancer is a common cancer in patients living in southern governorates of Yemen. The pattern appears nearly similar to the international figures with a low incidence of MSC.

  7. The VIMOS Public Extragalactic Survey (VIPERS). First Data Release of 57 204 spectroscopic measurements

    Science.gov (United States)

    Garilli, B.; Guzzo, L.; Scodeggio, M.; Bolzonella, M.; Abbas, U.; Adami, C.; Arnouts, S.; Bel, J.; Bottini, D.; Branchini, E.; Cappi, A.; Coupon, J.; Cucciati, O.; Davidzon, I.; De Lucia, G.; de la Torre, S.; Franzetti, P.; Fritz, A.; Fumana, M.; Granett, B. R.; Ilbert, O.; Iovino, A.; Krywult, J.; Le Brun, V.; Le Fèvre, O.; Maccagni, D.; Małek, K.; Marulli, F.; McCracken, H. J.; Paioro, L.; Polletta, M.; Pollo, A.; Schlagenhaufer, H.; Tasca, L. A. M.; Tojeiro, R.; Vergani, D.; Zamorani, G.; Zanichelli, A.; Burden, A.; Di Porto, C.; Marchetti, A.; Marinoni, C.; Mellier, Y.; Moscardini, L.; Nichol, R. C.; Peacock, J. A.; Percival, W. J.; Phleps, S.; Wolk, M.

    2014-02-01

    We present the first Public Data Release (PDR-1) of the VIMOS Public Extragalactic Survey (VIPERS). It comprises 57 204 spectroscopic measurements together with all additional information necessary for optimal scientific exploitation of the data, in particular the associated photometric measurements and quantification of the photometric and survey completeness. VIPERS is an ESO Large Programme designed to build a spectroscopic sample of ≃100 000 galaxies with iAB accessing the data through the survey database (http://vipers.inaf.it) where all information can be queried interactively. Based on observations collected at the European Southern Observatory, Cerro Paranal, Chile, using the Very Large Telescope under programs 182.A-0886 and partly 070.A-9007. Also based on observations obtained with MegaPrime/MegaCam, a joint project of CFHT and CEA/DAPNIA, at the Canada-France-Hawaii Telescope (CFHT), which is operated by the National Research Council (NRC) of Canada, the Institut National des Sciences de l'Univers of the Centre National de la Recherche Scientifique (CNRS) of France, and the University of Hawaii. This work is based in part on data products produced at TERAPIX and the Canadian Astronomy Data Centre as part of the Canada-France-Hawaii Telescope Legacy Survey, a collaborative project of NRC and CNRS. The VIPERS web site is http://vipers.inaf.it/

  8. [Disability evaluation of 204 cases of children with brain injury in road traffic accidents].

    Science.gov (United States)

    Liu, Kuan-lin; Zhang, Xian-guo; Kong, Bin; Huang, Si-xing

    2010-08-01

    To study the types, characteristics and common complications as well as disability assessment for the children with craniocerebral injury in the road traffic accidents. Data from 204 cases of children with cranio-injury in road traffic accidents were collected and were statistically analyzed according to the location injured, complication, the type of complication and the severity of disability. There were 64 cases of simple diffuse primary craniocerebral injury, 80 cases of simple local primary cranio-injury, 24 cases of diffuse secondary craniocerebral injury and 36 cases of local secondary cranio-injury. The main complications included traumatic epilepsy (14, 6.9%), traumatic cerebral infarction (9, 4.4%), traumatic hydrocephalus (7, 3.4%) and traumatic mental disorder (5, 2.5%). Among the children with cranio-injury due to road traffic accidents, simple primary cranio-injury was the most common result, whereas the traumatic epilepsy and traumatic cerebral infarction were the major types of complications. The assessment criteria for body impairment of the children with craniocerebral injury in the road traffic accidents should be broadened accordingly, with addition of certain specific items for children.

  9. Studies of photon spectra from a thallium-204 foil source as an aid to dosimetry and shielding

    CERN Document Server

    Francis, T M

    1976-01-01

    Beta ray foil sources incorporating nuclides such as thallium-204, promethium-147 and strontium-90 plus yttrium-90 ar increasingly used in industrial devices such as thickness gauges. These sources are so constructed that they give rise to complex photon spectra containing low energy Bremsstrahlung and X-rays characteristic of the constructional materials. The energy response of practical monitoring instruments is such that they are likely to underestimate the dose due to such spectra unless they are calibrated using appropriate spectra. This report describes a series of measurements carried out on a commercially available thallium-204 foil source and five commonly used shielding materials. The measurements made with a NaI(T1) spectrometer have been corrected for instrumental distortions to obtain the photon spectra in air. These spectra are presented and have been used to compute dose in air with the help of published data on mass energy-absorption coefficients. Also included in the report are data derived f...

  10. β-delayed γ-ray spectroscopy of 203,204Au and 200-202Pt

    Science.gov (United States)

    Morales, A. I.; Benlliure, J.; Górska, M.; Grawe, H.; Verma, S.; Regan, P. H.; Podolyák, Zs.; Pietri, S.; Kumar, R.; Casarejos, E.; Algora, A.; Alkhomashi, N.; Álvarez-Pol, H.; Benzoni, G.; Blazhev, A.; Boutachkov, P.; Bruce, A. M.; Cáceres, L. S.; Cullen, I. J.; Denis Bacelar, A. M.; Doornenbal, P.; Estévez-Aguado, M. E.; Farrelly, G.; Fujita, Y.; Garnsworthy, A. B.; Gelletly, W.; Gerl, J.; Grebosz, J.; Hoischen, R.; Kojouharov, I.; Kurz, N.; Lalkovski, S.; Liu, Z.; Mihai, C.; Molina, F.; Mücher, D.; Prokopowicz, W.; Rubio, B.; Schaffner, H.; Steer, S. J.; Tamii, A.; Tashenov, S.; Valiente-Dobón, J. J.; Walker, P. M.; Wollersheim, H. J.; Woods, P. J.

    2013-07-01

    The β decay of five heavy, neutron-rich nuclei, 203,204Pt and 200-202Ir, has been investigated following relativistic cold fragmentation reactions of lead projectiles using the FRS+RISING setup at GSI. This paper reports on the study of the low-lying states in the decay daughter nuclei 203,204Au and 200-202Pt. The characteristic γ rays for each nucleus have been determined using β-delayed γ-ray spectroscopy. Tentative level schemes, relative intensities, and apparent β feedings are provided. These data are compared with shell-model calculations, which indicate a substantial contribution to the total β strength from high-energy first-forbidden β-decay transitions in this mass region.

  11. Genome Sequence of Vibrio campbellii Strain UMTGB204, a Marine Bacterium Isolated from a Green Barrel Tunicate

    Science.gov (United States)

    Gan, Huan You; Noor, Mohd Ezhar Mohd; Saari, Nur Azna; Musa, Najiah; Mustapha, Baharim; Usup, Gires

    2015-01-01

    Vibrio campbellii strain UMTGB204 was isolated from a green barrel tunicate. The genome of this strain comprises 5,652,224 bp with 5,014 open reading frames, 9 rRNAs, and 116 tRNAs. It contains genes related to virulence and environmental tolerance. Gene clusters for the biosynthesis of nonribosomal peptides and bacteriocin were also identified. PMID:25814609

  12. Coupled-channel analysis for 20.4 MeV energy of p-64 Zn inelastic ...

    Indian Academy of Sciences (India)

    In this study, a coupled-channel (CC) analysis of the elastic and the inelastic scattering of 20.4 MeV polarized protons from a 64Zn target leading to the deformed 2+, 3 − , 2 2 + states was performed. The CC potential parameters and the deformation parameters of the excited states corresponding to the best fit to the ...

  13. Corrective Action Decision Document for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada: Revision 0, Including Errata Sheet

    Energy Technology Data Exchange (ETDEWEB)

    U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office

    2004-04-01

    This Corrective Action Decision Document identifies the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office's corrective action alternative recommendation for each of the corrective action sites (CASs) within Corrective Action Unit (CAU) 204: Storage Bunkers, Nevada Test Site (NTS), Nevada, under the Federal Facility Agreement and Consent Order. An evaluation of analytical data from the corrective action investigation, review of current and future operations at each CAS, and a detailed comparative analysis of potential corrective action alternatives were used to determine the appropriate corrective action for each CAS. There are six CASs in CAU 204, which are all located between Areas 1, 2, 3, and 5 on the NTS. The No Further Action alternative was recommended for CASs 01-34-01, 02-34-01, 03-34-01, and 05-99-02; and a Closure in Place with Administrative Controls recommendation was the preferred corrective action for CASs 05-18-02 and 05-33-01. These alternatives were judged to meet all requirements for the technical components evaluated as well as applicable state and federal regulations for closure of the sites and will eliminate potential future exposure pathways to the contaminated media at CAU 204.

  14. miR-10a and miR-204 as a Potential Prognostic Indicator in Low-Grade Gliomas

    Directory of Open Access Journals (Sweden)

    Ju Cheol Son

    2017-04-01

    Full Text Available This study aimed to identify and characterize microRNAs (miRNAs that are related to radiosensitivity in low-grade gliomas (LGGs. The miRNA expression levels in radiosensitive and radioresistant LGGs were compared using The Cancer Genome Atlas database, and differentially expressed miRNAs were identified using the EBSeq package. The miRNA target genes were predicted using Web databases. Fifteen miRNAs were differentially expressed between the groups, with miR-10a and miR-204 being related to overall survival (OS of patients with LGG. Patients with upregulated miR-10a expression had a higher mortality rate and shorter OS time, whereas patients with downregulated miR-204 expression had a lower mortality rate and longer OS time. Two genes, HSP90AA1 and CREB5 , were targets for both miRNAs. Thus, this study suggests that expression of miR-10a and miR-204 is significantly related to both radiosensitivity and the survival of patients with LGG. These miRNAs could therefore act as clinical biomarkers for LGG prognosis and diagnosis.

  15. Hanford Tanks 241-C-203 and 241 C 204: Residual Waste Contaminant Release Model and Supporting Data

    Energy Technology Data Exchange (ETDEWEB)

    Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.

    2007-05-23

    This report was revised in May 2007 to correct 90Sr values in Chapter 3. The changes were made on page 3.9, paragraph two and Table 3.10; page 3.16, last paragraph on the page; and Tables 3.21 and 3.31. The rest of the text remains unchanged from the original report issued in October 2004. This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy.

  16. Hanford Tanks 241-C-203 and 241-C-204: Residual Waste Contaminant Release Model and Supporting Data

    Energy Technology Data Exchange (ETDEWEB)

    Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.

    2004-10-28

    This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy.

  17. Comparison of the osteogenesis and fusion rates between activin A/BMP-2 chimera (AB204) and rhBMP-2 in a beagle's posterolateral lumbar spine model.

    Science.gov (United States)

    Zheng, Guang Bin; Yoon, Byung-Hak; Lee, Jae Hyup

    2017-10-01

    Activin A/BMP-2 chimera (AB204) could promote bone healing more effectively than recombinant bone morphogenetic protein 2 (rhBMP-2) with much lower dose in a rodent model, but there is no report about the effectiveness of AB204 in a large animal model. The purpose of this study was to compare the osteogenesis and fusion rate between AB204 and rhBMP-2 using biphasic calcium phosphate (BCP) as a carrier in a beagle's posterolateral lumbar fusion model. This is a randomized control animal study. Seventeen male beagle dogs were included. Bilateral posterolateral fusion was performed at the L1-L2 and L4-L5 levels. Biphasic calcium phosphate (2 cc), rhBMP-2 (50 µg)+BCP (2 cc), or AB204 (50 µg)+BCP (2 cc) were implanted into the intertransverse space randomly. X-ray was performed at 4 and 8 weeks. After 8 weeks, the animals were sacrificed, and new bone formation and fusion rate were evaluated by manual palpation, computed tomography (CT), and undecalcified histology. The AB204 group showed significantly higher fusion rate (90%) than the rhBMP-2 group (15%) or the Osteon group (6.3%) by manual palpation. On x-ray and CT assessment, fusion rate and the volume of newly formed bone were also significantly higher in AB204 group than other groups. In contrast, more osteolysis was found in rhBMP-2 group (40%) than in AB204 group (10%) on CT study. In histologic results, new bone formation was sufficient between transverse processes in AB204 group, and obvious trabeculation and bone remodeling were observed. But in rhBMP-2 group, new bone formation was less than AB204 group and osteolysis was observed between the intertransverse spaces. A low dose of AB204 with BCP as a carrier significantly promotes the fusion rate in a large animal model when compared with the rhBMP-2. These findings demonstrate that AB204 could be an alternative to rhBMP-2 to improve fusion rate. Copyright © 2017 Elsevier Inc. All rights reserved.

  18. Network modeling identifies molecular functions targeted by miR-204 to suppress head and neck tumor metastasis.

    Directory of Open Access Journals (Sweden)

    Younghee Lee

    2010-04-01

    Full Text Available Due to the large number of putative microRNA gene targets predicted by sequence-alignment databases and the relative low accuracy of such predictions which are conducted independently of biological context by design, systematic experimental identification and validation of every functional microRNA target is currently challenging. Consequently, biological studies have yet to identify, on a genome scale, key regulatory networks perturbed by altered microRNA functions in the context of cancer. In this report, we demonstrate for the first time how phenotypic knowledge of inheritable cancer traits and of risk factor loci can be utilized jointly with gene expression analysis to efficiently prioritize deregulated microRNAs for biological characterization. Using this approach we characterize miR-204 as a tumor suppressor microRNA and uncover previously unknown connections between microRNA regulation, network topology, and expression dynamics. Specifically, we validate 18 gene targets of miR-204 that show elevated mRNA expression and are enriched in biological processes associated with tumor progression in squamous cell carcinoma of the head and neck (HNSCC. We further demonstrate the enrichment of bottleneckness, a key molecular network topology, among miR-204 gene targets. Restoration of miR-204 function in HNSCC cell lines inhibits the expression of its functionally related gene targets, leads to the reduced adhesion, migration and invasion in vitro and attenuates experimental lung metastasis in vivo. As importantly, our investigation also provides experimental evidence linking the function of microRNAs that are located in the cancer-associated genomic regions (CAGRs to the observed predisposition to human cancers. Specifically, we show miR-204 may serve as a tumor suppressor gene at the 9q21.1-22.3 CAGR locus, a well established risk factor locus in head and neck cancers for which tumor suppressor genes have not been identified. This new strategy

  19. EFFECT OF UV IRRADIATION ON THE DYEING OF COTTON FABRIC WITH REACTIVE BLUE 204

    Directory of Open Access Journals (Sweden)

    ROŞU Liliana

    2017-05-01

    Full Text Available Reactive dyes are synthetic organic compounds used on a wide scale in textile industry, for painting materials of different types and compositions (e.g. 100% cotton, wool, natural satin, viscose, synthetic fibres. Reactive dyes are solid compounds (powders completely water soluble at normal temperature and pressure conditions. Their structures contain chromophore groups, which generate colour, and auxochrome groups, which determine the compounds water solubility and the capacity to fix to the textile fiber. Such organic compounds absorb UV-Vis radiations at specific wavelengths, corresponding to maximum absorbtion peaks, in both solution and dyed fiber. The human organism, through the dyed clothing, comes in direct contact with those dyes which can undergo modifications once exposed to UV radiations, having the posibility to reach the organism via cutanated transport. As it is known, the provoked negative effects are stronger during summer when UV radiations are more intense and in order to reduce their intensity dark coloured clothing is avoided. Dyes can be transformed in compounds which are easily absorbed into the skin. Some of these metabolites can be less toxic than the original corresponding dye, whilst others, such as free radicals, are potentially cancerous. Knowledge of the biological effects of the organic dyes, reactive dyes in particular, correlated with their structural and physical characteristics, permanently consists an issue of high scientific and practical interest and its solution may contribute in the diminishing of risk factors and improving of population health. UV radiation influence on the structural and colour modifications of textile materials were studied. Colour modifications are due to structural changes in aromatic and carbonil groups. In most cases photo-oxidative processes were identified in the dye structure. Dyeing was performed using non-irradiated and irradiated cotton painted with reactive blue dye 204.

  20. Suppression of TLR4-mediated inflammatory response by macrophage class A scavenger receptor (CD204)

    Energy Technology Data Exchange (ETDEWEB)

    Ohnishi, Koji; Komohara, Yoshihiro; Fujiwara, Yukio; Takemura, Kenichi [Department of Cell Pathology, Graduate School of Medical Sciences, Faculty of Life Sciences, Kumamoto University, Kumamoto (Japan); Lei, XiaoFeng [Department of Cell Pathology, Graduate School of Medical Sciences, Faculty of Life Sciences, Kumamoto University, Kumamoto (Japan); Department of Biochemistry, Showa University School of Medicine, Tokyo (Japan); Nakagawa, Takenobu [Department of Cell Pathology, Graduate School of Medical Sciences, Faculty of Life Sciences, Kumamoto University, Kumamoto (Japan); Sakashita, Naomi [Department of Cell Pathology, Graduate School of Medical Sciences, Faculty of Life Sciences, Kumamoto University, Kumamoto (Japan); Department of Human Pathology, Institute of Health Biosciences, The University of Tokushima, Tokushima (Japan); Takeya, Motohiro, E-mail: takeya@kumamoto-u.ac.jp [Department of Cell Pathology, Graduate School of Medical Sciences, Faculty of Life Sciences, Kumamoto University, Kumamoto (Japan)

    2011-08-05

    Highlights: {yields} We focused on the interaction between SR-A and TLR4 signaling in this study. {yields} SR-A deletion promoted NF{kappa}B activation in macrophages in septic model mouse. {yields} SR-A suppresses both MyD88-dependent and -independent TLR4 signaling in vitro. {yields} SR-A clears LPS binding to TLR4 which resulting in the suppression of TLR4 signals. -- Abstract: The class A scavenger receptor (SR-A, CD204), one of the principal receptors expressed on macrophages, has been found to regulate inflammatory response and attenuate septic endotoxemia. However, the detailed mechanism of this process has not yet been well characterized. To clarify the regulative mechanisms of lipopolysaccharide (LPS)-induced macrophage activation by SR-A, we evaluated the activation of Toll-like receptor 4 (TLR4)-mediated signaling molecules in SR-A-deficient (SR-A{sup -/-}) macrophages. In a septic shock model, the blood levels of tumor necrosis factor (TNF)-{alpha}, interleukin (IL)-6 and interferon (IFN)-{beta} were significantly increased in SR-A{sup -/-} mice compared to wild-type mice, and elevated nuclear factor kappa B (NF{kappa}B) activation was detected in SR-A{sup -/-} macrophages. SR-A deletion increased the production of pro-inflammatory cytokines, and the phosphorylation of mitogen-activated protein kinase (MAPK) and NF{kappa}B in vitro. SR-A deletion also promoted the nuclear translocation of NF{kappa}B and IFN regulatory factor (IRF)-3. In addition, a competitive binding assay with acetylated low-density lipoprotein, an SR-A-specific ligand, and anti-SR-A antibody induced significant activation of TLR4-mediated signaling molecules in wild-type macrophages but not in SR-A{sup -/-} macrophages. These results suggest that SR-A suppresses the macrophage activation by inhibiting the binding of LPS to TLR4 in a competitive manner and it plays a pivotal role in the regulation of the LPS-induced inflammatory response.

  1. Neutron Capture Cross Sections of the s-Process Branching Points 147Pm, 171Tm, and 204Tl

    Science.gov (United States)

    Guerrero, Carlos; Domingo-Pardo, Cesar; Lerendegui-Marco, Jorge; Casanovas, Adria; Cortes-Giraldo, Miguel A.; Dressler, Rugard; Halfon, Shlomi; Heinitz, Stephan; Kivel, Niko; Köster, Ulli; Paul, Michael; Quesada-Molina, Jose Manuel; Schumann, Dorothea; Tarifeño-Saldivia, Ariel; Tessler, Moshe; Weissman, Leo

    The neutron capture cross section of several key unstable isotopes acting as branching points in the s-process are crucial for stellar nucleosynthesis studies, but they are very challenging to measure due to the difficult production of sufficient sample material, the high activity of the resulting samples, and the actual (n, γ) measurement, for which high neutron fluxes and effective background rejection capabilities are required. As part of a new program to measure some of these important branching points, radioactive targets of 147Pm, 171Tm, and 204Tl have been produced by irradiation of stable isotopes (146Nd, 170Er, and 203Tl) at the Institut Laue-Langevin (ILL) high flux reactor. After breeding in the reactor and a certain cooling period, the resulting mixed 204Tl/203Tl sample was used directly while 147Pm and 171Tm were radiochemically separated in non-carrier-added quality at the Paul Scherrer Institut (PSI), then prepared as targets. A set of theses samples has been used for time-of-flight measurements at the CERN n_TOF facility using the 19 and 185 m beam lines, during 2014 and 2015. The capture cascades were detected with a set of four C6D6 scintillators, allowing to observe the associated neutron capture resonances. The results presented in this work are the first ever determination of the resonance capture cross sections of 147Pm, 171Tm, and 204Tl. Activation experiments on the same 147Pm and 171Tm targets with a high-intensity quasi-Maxwellian flux of neutrons have been performed using the SARAF accelerator and the Liquid-Lithium Target (LiLiT) in order to extract the corresponding Maxwellian Average Cross Section (MACS). The experimental setups are here described together with the first, preliminary results of the n_TOF measurement.

  2. Completion Report for Well ER-20-4 Corrective Action Units 101 and 102: Central and Western Pahute Mesa

    Energy Technology Data Exchange (ETDEWEB)

    NSTec Environmental Management

    2011-04-30

    Well ER-20-4 was drilled for the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office in support of the Nevada Environmental Restoration Project at the Nevada National Security Site, Nye County, Nevada. The well was drilled in August and September 2010 as part of the Pahute Mesa Phase II drilling program. The primary purpose of the well was to investigate the possibility of radionuclide transport from up-gradient underground nuclear tests conducted in central Pahute Mesa. This well also provided detailed hydrogeologic information in the Tertiary volcanic section that will help reduce uncertainties within the Pahute Mesa-Oasis Valley hydrostratigraphic framework model.

  3. Results of a Phase 2, Randomized,Vehicle-Controlled Study Evaluating the Efficacy,Tolerability, and Safety of Daily or Twice Daily SB204 for the Treatment of Acne Vulgaris.

    Science.gov (United States)

    Eichenfield, Lawrence F; Gold, Linda Stein; Nahm, Walter K; Cook-Bolden, Fran E; Pariser, David M

    2016-12-01

    This randomized, double-blind, placebo-controlled, Phase 2 study compared efficacy, tolerability, and safety of SB204 once or twice daily to vehicle in the treatment of acne vulgaris. Eligible subjects were to be between 12 and 40 years old, have facial acne vulgaris with 25 to 70 non-inflammatory lesions, 20 to 40 inflammatory lesions, no more than 2 nodules, and a baseline Investigator's Global Assessment (IGA) score of moderate or severe. The co-primary efficacy endpoints were the absolute change in inflammatory and non-inflammatory lesion counts and IGA success rate (baseline to week 12). Safety assessments included reported adverse events (AEs), physical examinations, and laboratory testing. Tolerability was evaluated by the investigators based on the occurrence and severity of erythema, scaling, dryness, pruritus, and burning/stinging. A total of 213 subjects were randomized: 27 subjects to vehicle once daily; 29 subjects to vehicle twice daily; 53 subjects to SB204 2% twice daily; 52 subjects to SB204 4% once daily; and 52 subjects to SB204 4% twice daily. When compared to vehicle, treatment with all 3 SB204 regimens significantly reduced the absolute inflammatory lesion count and SB204 4% once daily reduced the absolute non-inflammatory lesion count. Treatment with SB204 4% once daily demonstrated a significant reduction in percent inflammatory lesions by week 4. There were no significant differences in the IGA success rates between groups at the end of treatment. All treatment regimens of SB204 were found to be safe and well tolerated. When compared to vehicle, SB204 2% and SB204 4% significantly decreased the absolute inflammatory lesion count and SB204 4% once daily also significantly decreased the absolute non-inflammatory lesion count in subjects with acne vulgaris treated for 12 weeks. Treatment with SB204 2% and 4% was found to be safe and well tolerated. J Drugs Dermatol. 2016;15(12):1496-1502.

  4. Molecular characterization, tissue tropism, and genetic variability of the novel Mupapillomavirus type HPV204 and phylogenetically related types HPV1 and HPV63.

    Directory of Open Access Journals (Sweden)

    Anja Šterbenc

    Full Text Available HPV204 is the only newly identified Mupapillomavirus (Mu-PV type in more than a decade. To comprehensively characterize HPV204, we performed a detailed molecular analysis of the viral genome and evaluated its clinical relevance in comparison to the other Mu-PVs, HPV1 and HPV63. The 7,227-bp long genome of HPV204 exhibits typical genomic organization of Mu-PVs with eight open reading frames (ORFs (E6, E7, E1, E2, E8, E4, L2, and L1. We developed three type-specific quantitative real-time PCRs and used them to test a representative collection (n = 1,006 of various HPV-associated benign and malignant neoplasms, as well as samples of clinically normal cutaneous, mucosal, and mucocutaneous origins. HPV204, HPV1, and HPV63 were detected in 1.1%, 2.7%, and 1.9% of samples tested, respectively, and were present in skin and mucosa, suggesting dual tissue tropism of all Mu-PVs. To evaluate the etiological role of Mu-PVs in the development of HPV-associated neoplasms, Mu-PV viral loads per single cell were estimated. HPV1 and HPV63 were present in high viral copy numbers in 3/43 and 1/43 cutaneous warts, respectively, and were identified as the most likely causative agents of these warts. HPV204 viral load was extremely low in a single HPV204-positive cutaneous wart (7.4 × 10-7 viral copies/cell. Hence, etiological association between HPV204 and the development of cutaneous warts could not be established. To the best of our knowledge, this is the first study to evaluate the genetic variability of Mu-PVs by sequencing complete LCR genomic regions of HPV204, HPV1, and HPV63. We detected several nucleotide substitutions and deletions within the LCR genomic regions of Mu-PVs and identified two genetic variants of HPV204 and HPV63 and five genetic variants of HPV1.

  5. The Effects of Polyvinyl Pyridine-N-Oxide (P204) on the Cytopathogenic Action of Chrysotile Asbestos in vivo and in vitro

    Science.gov (United States)

    Davis, J. M. G.

    1972-01-01

    A series of experiments was undertaken to test the action of polyvinyl pyridine-N-oxide (P204) on the cytopathic effects of chrysotile asbestos dust in experimental animals. Organ culture studies were undertaken using pieces of guinea-pig lung, and in addition to this the lesions produced by the intrapleural injection of chrysotile were studied after treatment with varying doses of P204. The results from both series of experiments were unfortunately negative and P204 appeared unable to modify asbestos lesions in any way. These findings contrast sharply with the marked ability of P204 to protect tissues from the effects of silica dust. It is suggested that these differences are due to the fact that while silica is rapidly toxic to macrophages, asbestos is not and many healthy macrophages and giant cells can be found in asbestos lesions packed with dust several weeks after injection. The fibrous tissue that is eventually produced in response to asbestos dust is probably produced by a slower and more insidious process than that stimulated by silica, and this process is not modified by the presence of P204. ImagesFig. 6Figs. 1-3Figs. 4-5 PMID:4345811

  6. Inhibition of smooth muscle contraction and platelet aggregation by peptide 204–212 of lipocortin 5: an attempt to define some structure requirements

    Directory of Open Access Journals (Sweden)

    K. G. Mugridge

    1993-01-01

    Full Text Available Peptide 204–212 of lipocortin (LC 5 inhibited porcine pancreatic phospholipase A2 (PLA2 induced rat stomach strip contractions and ADP induced rabbit platelet aggregation in a concentration dependent manner (IC30 of 10 μM and 400 μM, respectively. The first two amino acids are not necessary since the eptapeptide 206–212 was equipotent in both assays (IC30 of 12.5 μM and 420 μM. Of the two pentapeptides 204–208 and 208–212 only the latter showed inhibitory activity in both models although the potency was much reduced (IC30 of 170 μM and 630 μM compared with that of the parent nonapeptide. Comparison of peptide 204–212 effects with those of its analogues on LC1 and LC2 indicate that lysine 208 and aspartic acid 211 are essential in order to maintain a fully active nonapeptide.

  7. A humanized monoclonal antibody neutralizes yellow fever virus strain 17D-204 in vitro but does not protect a mouse model from disease.

    Science.gov (United States)

    Calvert, Amanda E; Dixon, Kandice L; Piper, Joseph; Bennett, Susan L; Thibodeaux, Brett A; Barrett, Alan D T; Roehrig, John T; Blair, Carol D

    2016-07-01

    The yellow fever virus (YFV) vaccine 17D-204 is considered safe and effective, yet rare severe adverse events (SAEs), some resulting in death, have been documented following vaccination. Individuals exhibiting post-vaccinal SAEs are ideal candidates for antiviral monoclonal antibody (MAb) therapy; the time until appearance of clinical signs post-exposure is usually short and patients are quickly hospitalized. We previously developed a murine-human chimeric monoclonal antibody (cMAb), 2C9-cIgG, reactive with both virulent YFV and 17D-204, and demonstrated its ability to prevent and treat YF disease in both AG129 mouse and hamster models of infection. To counteract possible selection of 17D-204 variants that escape neutralization by treatment with a single MAb (2C9-cIgG), we developed a second cMAb, 864-cIgG, for use in combination with 2C9-cIgG in post-vaccinal therapy. MAb 864-cIgG recognizes/neutralizes only YFV 17D-204 vaccine substrain and binds to domain III (DIII) of the viral envelope protein, which is different from the YFV type-specific binding site of 2C9-cIgG in DII. Although it neutralized 17D-204 in vitro, administration of 864-cIgG had no protective capacity in the interferon receptor-deficient AG129 mouse model of 17D-204 infection. The data presented here show that although DIII-specific 864-cIgG neutralizes virus infectivity in vitro, it does not have the ability to abrogate disease in vivo. Therefore, combination of 864-cIgG with 2C9-cIgG for treatment of YF vaccination SAEs does not appear to provide an improvement on 2C9-cIgG therapy alone. Copyright © 2016 Elsevier B.V. All rights reserved.

  8. How to Use the ADI-R for Classifying Autism Spectrum Disorders? Psychometric Properties of Criteria from the Literature in 1,204 Dutch Children

    Science.gov (United States)

    de Bildt, Annelies; Oosterling, Iris J.; van Lang, Natasja D. J.; Kuijper, Sanne; Dekker, Vera; Sytema, Sjoerd; Oerlemans, Anoek M.; van Steijn, Daphne J.; Visser, Janne C.; Rommelse, Nanda N.; Minderaa, Ruud B.; van Engeland, Herman; van der Gaag, Rutger-Jan; Buitelaar, Jan K.; de Jonge, Maretha V.

    2013-01-01

    The algorithm of the Autism Diagnostic Interview-Revised provides criteria for autism versus non-autism according to DSM-IV. Criteria for the broader autism spectrum disorders are needed. This study investigated the validity of seven sets of criteria from the literature, in 1,204 Dutch children (aged 3-18 years) with and without mental…

  9. miR-204 acts as a tumor suppressor in human bladder cancer cell T24 by targeting antiapoptotic BCL2

    National Research Council Canada - National Science Library

    Hwang, Thomas I-Sheng; Lin, Ji-Fan; Lin, Yi-Chia; Chen, Hung-En; Chou, Kuang-Yu; Tsai, Te-Fu

    2016-01-01

    .... We previously reported detecting dysregulated micro-RNAs (miRNAs) in human BC tissues. Using an miRNA targeting database, we found that miR-204, which is downregulated in BC, targets the B-cell lymphoma 2 gene (BCL2...

  10. Evaluation of the in vitro/in vivo drug interaction potential of BST204, a purified dry extract of ginseng, and its four bioactive ginsenosides through cytochrome P450 inhibition/induction and UDP-glucuronosyltransferase inhibition.

    Science.gov (United States)

    Zheng, Yu Fen; Bae, Soo Hyeon; Choi, Eu Jin; Park, Jung Bae; Kim, Sun Ok; Jang, Min Jung; Park, Gyu Hwan; Shin, Wan Gyoon; Oh, Euichaul; Bae, Soo Kyung

    2014-06-01

    We evaluated the potential of BST204, a purified dry extract of ginseng, to inhibit or induce human liver cytochrome P450 enzymes (CYPs) and UDP-glucuronosyltransferases (UGTs) in vitro to assess its safety. In vitro drug interactions of four bioactive ginsenosides of BST204, S-Rg3, R-Rg3, S-Rh2, and R-Rh2, were also evaluated. We demonstrated that BST204 slightly inhibited CYP2C8, CYP2D6, CYP2C9, and CYP2B6 activities with IC50 values of 17.4, 26.8, 31.5, and 49.7μg/mL, respectively. BST204 also weakly inhibited UGT1A1, UGT1A9, and UGT2B7 activities with IC50 values of 14.5, 26.6, and 31.5μg/mL, respectively. The potential inhibition by BST204 of the three UGT activities might be attributable to S-Rg3, at least in part, as its inhibitory pattern was similar to that of BST204. However, BST204 showed no time-dependent inactivation of the nine CYPs studied. In addition, BST204 did not induce CYP1A2, 2B6, or 3A4/5. On the basis of an in vivo interaction studies, our data strongly suggest that BST204 is unlikely to cause clinically significant drug-drug interactions mediated via inhibition or induction of most CYPs or UGTs involved in drug metabolism in vivo. Our findings offer a clearer understanding and possibility to predict drug-drug interactions for the safe use of BST204 in clinical practice. Copyright © 2014. Published by Elsevier Ltd.

  11. Corrective Action Decision Document for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada, Revision 0 with ROTC 1, 2, and Errata

    Energy Technology Data Exchange (ETDEWEB)

    Wickline, Alfred

    2004-04-01

    This Corrective Action Decision Document (CADD) has been prepared for Corrective Action Unit (CAU) 204 Storage Bunkers, Nevada Test Site (NTS), Nevada, in accordance with the ''Federal Facility Agreement and Consent Order'' (FFACO) that was agreed to by the State of Nevada; U.S. Department of Energy (DOE); and the U.S. Department of Defense (FFACO, 1996). The NTS is approximately 65 miles (mi) north of Las Vegas, Nevada (Figure 1-1). The Corrective Action Sites (CASs) within CAU 204 are located in Areas 1, 2, 3, and 5 of the NTS, in Nye County, Nevada (Figure 1-2). Corrective Action Unit 204 is comprised of the six CASs identified in Table 1-1. As shown in Table 1-1, the FFACO describes four of these CASs as bunkers one as chemical exchange storage and one as a blockhouse. Subsequent investigations have identified four of these structures as instrumentation bunkers (CASs 01-34-01, 02-34-01, 03-34-01, 05-33-01), one as an explosives storage bunker (CAS 05-99-02), and one as both (CAS 05-18-02). The six bunkers included in CAU 204 were primarily used to monitor atmospheric testing or store munitions. The ''Corrective Action Investigation Plan (CAIP) for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada'' (NNSA/NV, 2002a) provides information relating to the history, planning, and scope of the investigation; therefore, it will not be repeated in this CADD. This CADD identifies potential corrective action alternatives and provides a rationale for the selection of a recommended corrective action alternative for each CAS within CAU 204. The evaluation of corrective action alternatives is based on process knowledge and the results of investigative activities conducted in accordance with the CAIP (NNSA/NV, 2002a) that was approved prior to the start of the Corrective Action Investigation (CAI). Record of Technical Change (ROTC) No. 1 to the CAIP (approval pending) documents changes to the preliminary action levels

  12. Implication of the miR-184 and miR-204 competitive RNA network in control of mouse secondary cataract.

    Science.gov (United States)

    Hoffmann, Andrea; Huang, Yusen; Suetsugu-Maki, Rinako; Ringelberg, Carol S; Tomlinson, Craig R; Del Rio-Tsonis, Katia; Tsonis, Panagiotis A

    2012-05-09

    The high recurrence rate of secondary cataract (SC) is caused by the intrinsic differentiation activity of residual lens epithelial cells after extra-capsular lens removal. The objective of this study was to identify changes in the microRNA (miRNA) expression profile during mouse SC formation and to selectively manipulate miRNA expression for potential therapeutic intervention. To model SC, mouse cataract surgery was performed and temporal changes in the miRNA expression pattern were determined by microarray analysis. To study the potential SC counterregulative effect of miRNAs, a lens capsular bag in vitro model was used. Within the first 3 wks after cataract surgery, microarray analysis demonstrated SC-associated expression pattern changes of 55 miRNAs. Of the identified miRNAs, miR-184 and miR-204 were chosen for further investigations. Manipulation of miRNA expression by the miR-184 inhibitor (anti-miR-184) and the precursor miRNA for miR-204 (pre-miR-204) attenuated SC-associated expansion and migration of lens epithelial cells and signs of epithelial to mesenchymal transition such as α-smooth muscle actin expression. In addition, pre-miR-204 attenuated SC-associated expression of the transcription factor Meis homeobox 2 (MEIS2). Examination of miRNA target binding sites for miR-184 and miR-204 revealed an extensive range of predicted target mRNA sequences that were also a target to a complex network of other SC-associated miRNAs with possible opposing functions. The identification of the SC-specific miRNA expression pattern together with the observed in vitro attenuation of SC by anti-miR-184 and pre-miR-204 suggest that miR-184 and miR-204 play a significant role in the control of SC formation in mice that is most likely regulated by a complex competitive RNA network.

  13. Cu0.02Ti0.94Nb2.04O7: An advanced anode material for lithium-ion batteries of electric vehicles

    Science.gov (United States)

    Yang, Chao; Lin, Chunfu; Lin, Shiwei; Chen, Yongjun; Li, Jianbao

    2016-10-01

    To explore advanced anode materials for lithium-ion batteries of electric vehicles, Cu2+/Nb5+ co-doped TiNb2O7 is studied. Cu0.02Ti0.94Nb2.04O7 is successfully fabricated using a facile solid-state reaction. X-ray diffraction analyses combined with Rietveld refinements demonstrate that the trace Cu2+/Nb5+ co-doping does not destroy the shear ReO3 crystal structure of TiNb2O7 but increases the lattice parameters and unit cell volume. Specific surface area tests and scanning electron microscopy images reveal a smaller average particle size in Cu0.02Ti0.94Nb2.04O7. Due to the increased unit cell volume and free 3d electrons in Cu2+ ions, the Li+-ion diffusion coefficient and electronic conductivity of Cu0.02Ti0.94Nb2.04O7 are respectively enhanced by 14.8 times and at least 220 times. Consequently, Cu0.02Ti0.94Nb2.04O7 exhibits advanced electrochemical properties in terms of specific capacity, rate capability and cyclic stability. At 0.1 C, it delivers a large first-cycle discharge/charge capacity of 346/315 mAh g-1. At 10 C, it still provides a large capacity of 182 mAh g-1 with tiny loss of only 1.2% over 1000 cycles. In sharp contrast, TiNb2O7 shows a small capacity of only 90 mAh g-1 and large loss of 59.8%. Therefore, Cu0.02Ti0.94Nb2.04O7 possesses great potential for the application in lithium-ion batteries for electric vehicles.

  14. Deconvolution of [sup 204]Tl/[sup 36]Cl and [sup 147]Pm/[sup 45]Ca dual mixtures

    Energy Technology Data Exchange (ETDEWEB)

    Grau Carles, A. (Inst. de Investigacion Basica, CIEMAT, Madrid (Spain)); Rodriguez Barquero, L. (Inst. de Investigacion Basica, CIEMAT, Madrid (Spain)); Grau Malonda, A. (Inst. de Investigacion Basica, CIEMAT, Madrid (Spain))

    1994-01-22

    Technical characteristics of liquid scintillation counting include high counting efficiency, well-defined sample preparation procedures and a high capacity to measure a large number of samples. However, poor resolution and quenching limit the capability of measuring double-labeled samples when the maximum beta-ray energies are close. The simultaneous standardization of [sup 35]S and [sup 14]C was described in a previous paper, involving an improved spectrum unfolding method. This procedure has been tested with two other types of close maximum beta-energy nuclides: [sup 204]Tl and [sup 36]Cl have 710 and 763 keV maximum beta-energies respectively, and cannot be standardized simultaneously by double window methods. However, spectral shape differences permit their deconvolution with great accuracy. Both [sup 147]Pm and [sup 45]Ca (224 and 255 keV maximum beta-energies) have also been standardized. Samples with different quench values and activity ratios have been assayed, and the limitations have been determined. (orig.)

  15. GASP. IV. A Muse View of Extreme Ram-pressure-stripping in the Plane of the Sky: The Case of Jellyfish Galaxy JO204

    Science.gov (United States)

    Gullieuszik, Marco; Poggianti, Bianca M.; Moretti, Alessia; Fritz, Jacopo; Jaffé, Yara L.; Hau, George; Bischko, Jan C.; Bellhouse, Callum; Bettoni, Daniela; Fasano, Giovanni; Vulcani, Benedetta; D'Onofrio, Mauro; Biviano, Andrea

    2017-09-01

    In the context of the GAs Stripping Phenomena in galaxies with Muse (GASP) survey, we present the characterization of JO204, a jellyfish galaxy in A957, a relatively low-mass cluster with M=4.4× {10}14 {M}⊙ . This galaxy shows a tail of ionized gas that extends up to 30 kpc from the main body in the opposite direction of the cluster center. No gas emission is detected in the galaxy outer disk, suggesting that gas-stripping is proceeding outside-in. The stellar component is distributed as a regular disk galaxy; the stellar kinematics shows a symmetric rotation curve with a maximum radial velocity of 200 km s-1 out to 20 kpc from the galaxy center. The radial velocity of the gas component in the central part of the disk follows the distribution of the stellar component; the gas kinematics in the tail retains the rotation of the galaxy disk, indicating that JO204 is moving at high speed in the intracluster medium. Both the emission and radial-velocity maps of the gas and stellar components indicate ram-pressure as the most likely primary mechanism for gas-stripping, as expected given that JO204 is close to the cluster center and it is likely at the first infall in the cluster. The spatially resolved star formation history of JO204 provides evidence that the onset of ram-pressure-stripping occurred in the last 500 Myr, quenching the star formation activity in the outer disk, where the gas has been already completely stripped. Our conclusions are supported by a set of hydrodynamic simulations.

  16. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  17. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  18. Comparison of the live attenuated yellow fever vaccine 17D-204 strain to its virulent parental strain Asibi by deep sequencing.

    Science.gov (United States)

    Beck, Andrew; Tesh, Robert B; Wood, Thomas G; Widen, Steven G; Ryman, Kate D; Barrett, Alan D T

    2014-02-01

    The first comparison of a live RNA viral vaccine strain to its wild-type parental strain by deep sequencing is presented using as a model the yellow fever virus (YFV) live vaccine strain 17D-204 and its wild-type parental strain, Asibi. The YFV 17D-204 vaccine genome was compared to that of the parental strain Asibi by massively parallel methods. Variability was compared on multiple scales of the viral genomes. A modeled exploration of small-frequency variants was performed to reconstruct plausible regions of mutational plasticity. Overt quasispecies diversity is a feature of the parental strain, whereas the live vaccine strain lacks diversity according to multiple independent measurements. A lack of attenuating mutations in the Asibi population relative to that of 17D-204 was observed, demonstrating that the vaccine strain was derived by discrete mutation of Asibi and not by selection of genomes in the wild-type population. Relative quasispecies structure is a plausible correlate of attenuation for live viral vaccines. Analyses such as these of attenuated viruses improve our understanding of the molecular basis of vaccine attenuation and provide critical information on the stability of live vaccines and the risk of reversion to virulence.

  19. Food sources of total omega 6 fatty acids (18:2 + 20:4), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006

    Science.gov (United States)

    Food sources of total omega 6 fatty acids (18:2 + 20:4), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006

  20. Food sources of arachidonic acid (PFA 20:4), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006

    Science.gov (United States)

    Food sources of arachidonic acid (PFA 20:4), listed in descending order by percentages of their contribution to intake, based on data from the National Health and Nutrition Examination Survey 2005-2006

  1. Oral Nucleos(t)ide Analogs Alone After Liver Transplantation in Chronic Hepatitis B With Preexisting rt204 Mutation.

    Science.gov (United States)

    Fung, James; Wong, Tiffany; Chok, Kenneth; Chan, Albert; Sin, Sui-Ling; Cheung, Tan-To; Dai, Wing-Chiu; Ng, Kelvin; Ng, Kevin; Man, Kwan; Seto, Wai-Kay; Lai, Ching-Lung; Yuen, Man-Fung; Lo, Chung-Mau

    2017-10-01

    There is currently limited data regarding the use of oral antiviral therapy alone without hepatitis B immune globulin for chronic hepatitis B patients with preexisting lamivudine (LAM) resistance (LAM-R) undergoing liver transplantation. This is a cohort study determining the effectiveness and long-term outcome in this group of patients. Fifty-seven consecutive chronic hepatitis B patients with preexisting rt204 LAM-R mutations or virological load refractory to LAM undergoing liver transplantation were included, with a median follow-up of 73 months. Fifty-five (96.5%) patients received a regimen that included the use of nucleotide analogs. The cumulative rate of hepatitis B surface antigen seroclearance at 1, 5, and 10 years was 82%, 88%, and 91%, respectively. At the time of transplantation, 39 (72%) patients had detectable hepatitis B virus (HBV) DNA, with a median of 4.5 log copies/mL. The cumulative rate of HBV undetectability was 91% at 1 year, increasing to 100% by 5 years. After 1 year of liver transplantation, over 90% of the patients had undetectable HBV DNA, and from 8 years onward, 100% had undetectable HBV DNA. The overall long-term survival was excellent, with a 12-year survival of 87%. There was no HBV-related graft loss, and no retransplantation or deaths due to HBV reactivation. Oral antiviral therapy alone without hepatitis B immune globulin is highly effective in preventing HBV reactivation and graft loss from recurrent hepatitis B after liver transplantation in patients with preexisting LAM resistance HBV. The long-term outcome was excellent, with survival of 87% at 12 years after transplantation, without any mortality related to HBV reactivation.

  2. 204 - 207 Suleiman

    African Journals Online (AJOL)

    DR. AMIN

    2011-12-02

    Dec 2, 2011 ... ABSTRACT. Powders prepared from parts of different plant species indigenous to Nigeria were tested by various Nigerian scientists under laboratory conditions for their insecticidal activities against the common insect pests of maize and cowpea, i.e. Sitophilus zeamais and Callosobruchus maculatus.

  3. Validation of expression patterns for nine miRNAs in 204 lymph-node negative breast cancers.

    Directory of Open Access Journals (Sweden)

    Kristin Jonsdottir

    Full Text Available INTRODUCTION: Although lymph node negative (LN- breast cancer patients have a good 10-years survival (∼85%, most of them still receive adjuvant therapy, while only some benefit from this. More accurate prognostication of LN- breast cancer patient may reduce over- and under-treatment. Until now proliferation is the strongest prognostic factor for LN- breast cancer patients. The small molecule microRNA (miRNA has opened a new window for prognostic markers, therapeutic targets and/or therapeutic components. Previously it has been shown that miR-18a/b, miR-25, miR-29c and miR-106b correlate to high proliferation. METHODS: The current study validates nine miRNAs (miR-18a/b miR-25, miR-29c, miR-106b, miR375, miR-424, miR-505 and let-7b significantly correlated with established prognostic breast cancer biomarkers. Total RNA was isolated from 204 formaldehyde-fixed paraffin embedded (FFPE LN- breast cancers and analyzed with quantitative real-time Polymerase Chain Reaction (qPCR. Independent T-test was used to detect significant correlation between miRNA expression level and the different clinicopathological features for breast cancer. RESULTS: Strong and significant associations were observed for high expression of miR-18a/b, miR-106b, miR-25 and miR-505 to high proliferation, oestrogen receptor negativity and cytokeratin 5/6 positivity. High expression of let-7b, miR-29c and miR-375 was detected in more differentiated tumours. Kaplan-Meier survival analysis showed that patients with high miR-106b expression had an 81% survival rate vs. 95% (P = 0.004 for patients with low expression. CONCLUSION: High expression of miR-18a/b are strongly associated with basal-like breast cancer features, while miR-106b can identify a group with higher risk for developing distant metastases in the subgroup of Her2 negatives. Furthermore miR-106b can identify a group of patients with 100% survival within the otherwise considered high risk group of patients with

  4. Corrective Action Investigation Plan for Corrective Action Unit 204: Storage Bunkers, Nevada Test Site, Nevada (December 2002, Revision No.: 0), Including Record of Technical Change No. 1

    Energy Technology Data Exchange (ETDEWEB)

    NNSA/NSO

    2002-12-12

    The Corrective Action Investigation Plan contains the U.S. Department of Energy, National Nuclear Security Administration Nevada Operations Office's approach to collect the data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit (CAU) 204 under the Federal Facility Agreement and Consent Order. Corrective Action Unit 204 is located on the Nevada Test Site approximately 65 miles northwest of Las Vegas, Nevada. This CAU is comprised of six Corrective Action Sites (CASs) which include: 01-34-01, Underground Instrument House Bunker; 02-34-01, Instrument Bunker; 03-34-01, Underground Bunker; 05-18-02, Chemical Explosives Storage; 05-33-01, Kay Blockhouse; 05-99-02, Explosive Storage Bunker. Based on site history, process knowledge, and previous field efforts, contaminants of potential concern for Corrective Action Unit 204 collectively include radionuclides, beryllium, high explosives, lead, polychlorinated biphenyls, total petroleum hydrocarbons, silver, warfarin, and zinc phosphide. The primary question for the investigation is: ''Are existing data sufficient to evaluate appropriate corrective actions?'' To address this question, resolution of two decision statements is required. Decision I is to ''Define the nature of contamination'' by identifying any contamination above preliminary action levels (PALs); Decision II is to ''Determine the extent of contamination identified above PALs. If PALs are not exceeded, the investigation is completed. If PALs are exceeded, then Decision II must be resolved. In addition, data will be obtained to support waste management decisions. Field activities will include radiological land area surveys, geophysical surveys to identify any subsurface metallic and nonmetallic debris, field screening for applicable contaminants of potential concern, collection and analysis of surface and subsurface soil samples from biased locations

  5. The cross sections and energy spectra of the particle emission in proton induced reaction on 204,206,207,208Pb and 209Bi

    Directory of Open Access Journals (Sweden)

    Zhang Zhengjun

    2017-01-01

    Full Text Available All cross sections of proton induced reactions, angular distributions, energy spectra and double differential cross sections of neutron, proton, deuteron, triton, helium and alpha-particle emissions for p+ 204,206,207,208Pb, 209Bi reactions are consistently calculated and analyzed at incident proton energies below 200 MeV. The optical model, the distorted wave Born approximation theory, the unified Hauser-Feshbach and exciton model which includes the improved Iwamoto-Harada model are used. Theoretically calculated results are compared with the existing experimental data.

  6. Measurement of the neutron capture cross section of the s-only isotope 204Pb from 1 eV to 440 keV

    CERN Document Server

    Domingo-Pardo, C.; Aerts, G.; Alvarez-Pol, H.; Alvarez-Velarde, F.; Andriamonje, S.; Andrzejewski, J.; Assimakopoulos, P.; Audouin, L.; Badurek, G.; Baumann, P.; Becvar, F.; Berthoumieux, E.; Bisterzo, S.; Calvino, F.; Cano-Ott, D.; Capote, R.; Carrapico, C.; Cennini, P.; Chepel, V.; Chiaveri, E.; Colonna, N.; Cortes, G.; Couture, A.; Cox, J.; Dahlfors, M.; David, S.; Dillmann, I.; Dolfini, R.; Dridi, W.; Duran, I.; Eleftheriadis, C.; Embid-Segura, M.; Ferrant, L.; Ferrari, A.; Ferreira-Marques, R.; Fitzpatrick, L.; Frais-Koelbl, H.; Fujii, K.; Furman, W.; Gallino, R.; Goncalves, I.; Gonzalez-Romero, E.; Goverdovski, A.; Gramegna, F.; Griesmayer, E.; Guerrero, C.; Gunsing, F.; Haas, B.; Haight, R.; Heil, M.; Herrera-Martinez, A.; Igashira, M.; Isaev, S.; Jericha, E.; Kadi, Y.; Kappeler, F.; Karamanis, D.; Karadimos, D.; Kerveno, M.; Ketlerov, V.; Koehler, P.; Konovalov, V.; Kossionides, E.; Krticka, M.; Lamboudis, C.; Leeb, H.; Lindote, A.; Lopes, I.; Lozano, M.; Lukic, S.; Marganiec, J.; Marrone, S.; Mastinu, P.; Mengoni, A.; Milazzo, P.M.; Moreau, C.; Mosconi, M.; Neves, F.; Oberhummer, H.; Oshima, M.; O'Brien, S.; Pancin, J.; Papachristodoulou, C.; Papadopoulos, C.; Paradela, C.; Patronis, N.; Pavlik, A.; Pavlopoulos, P.; Perrot, L.; Plag, R.; Plompen, A.; Plukis, A.; Poch, A.; Pretel, C.; Quesada, J.; Rauscher, T.; Reifarth, R.; Rosetti, M.; Rubbia, C.; Rudolf, G.; Rullhusen, P.; Salgado, J.; Sarchiapone, L.; Savvidis, I.; Stephan, C.; Tagliente, G.; Tain, J.L.; Tassan-Got, L.; Tavora, L.; Terlizzi, R.; Vannini, G.; Vaz, P.; Ventura, A.; Villamarin, D.; Vincente, M.C.; Vlachoudis, V.; Vlastou, R.; Voss, F.; Walter, S.; Wendler, H.; Wiescher, M.; Wisshak, K.

    2007-01-01

    The neutron capture cross section of 204Pb has been measured at the CERN n_TOF installation with high resolution in the energy range from 1 eV to 440 keV. An R-matrix analysis of the resolved resonance region, between 1 eV and 100 keV, was carried out using the SAMMY code. In the interval between 100 keV and 440 keV we report the average capture cross section. The background in the entire neutron energy range could be reliably determined from the measurement of a 208Pb sample. Other systematic effects in this measurement could be investigated and precisely corrected by means of detailed Monte Carlo simulations. We obtain a Maxwellian average capture cross section for 204Pb at kT=30 keV of 79(3) mb, in agreement with previous experiments. However our cross section at kT=5 keV is about 35% larger than the values reported so far. The implications of the new cross section for the s-process abundance contributions in the Pb/Bi region are discussed.

  7. Phosphorylation of Ser-204 and Tyr-405 in human malonyl-CoA decarboxylase expressed in silkworm Bombyx mori regulates catalytic decarboxylase activity.

    Science.gov (United States)

    Hwang, In-Wook; Makishima, Yu; Suzuki, Tomohiro; Kato, Tatsuya; Park, Sungjo; Terzic, Andre; Chung, Shin-Kyo; Park, Enoch Y

    2015-11-01

    Decarboxylation of malonyl-CoA to acetyl-CoA by malonyl-CoA decarboxylase (MCD; EC 4.1.1.9) is a vital catalytic reaction of lipid metabolism. While it is established that phosphorylation of MCD modulates the enzymatic activity, the specific phosphorylation sites associated with the catalytic function have not been documented due to lack of sufficient production of MCD with proper post-translational modifications. Here, we used the silkworm-based Bombyx mori nucleopolyhedrovirus (BmNPV) bacmid system to express human MCD (hMCD) and mapped phosphorylation effects on enzymatic function. Purified MCD from silkworm displayed post-translational phosphorylation and demonstrated coherent enzymatic activity with high yield (-200 μg/silkworm). Point mutations in putative phosphorylation sites, Ser-204 or Tyr-405 of hMCD, identified by bioinformatics and proteomics analyses reduced the catalytic activity, underscoring the functional significance of phosphorylation in modulating decarboxylase-based catalysis. Identified phosphorylated residues are distinct from the decarboxylation catalytic site, implicating a phosphorylation-induced global conformational change of MCD as responsible in altering catalytic function. We conclude that phosphorylation of Ser-204 and Tyr-405 regulates the decarboxylase function of hMCD leveraging the silkworm-based BmNPV bacmid expression system that offers a fail-safe eukaryotic production platform implementing proper post-translational modification such as phosphorylation.

  8. Pahute Mesa Well Development and Testing Analyses for Wells ER-20-8 and ER-20-4, Nevada National Security Site, Nye County, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Greg Ruskauff and Sam Marutzky

    2012-09-01

    Wells ER-20-4 and ER-20-8 were drilled during fiscal year (FY) 2009 and FY 2010 (NNSA/NSO, 2011a and b). The closest underground nuclear test detonations to the area of investigation are TYBO (U-20y), BELMONT (U-20as), MOLBO (U-20ag), BENHAM (U-20c), and HOYA (U-20 be) (Figure 1-1). The TYBO, MOLBO, and BENHAM detonations had working points located below the regional water table. The BELMONT and HOYA detonation working points were located just above the water table, and the cavity for these detonations are calculated to extend below the water table (Pawloski et al., 2002). The broad purpose of Wells ER-20-4 and ER-20-8 is to determine the extent of radionuclide-contaminated groundwater, the geologic formations, groundwater geochemistry as an indicator of age and origin, and the water-bearing properties and hydraulic conditions that influence radionuclide migration. Well development and testing is performed to determine the hydraulic properties at the well and between other wells, and to obtain groundwater samples at the well that are representative of the formation at the well. The area location, wells, underground nuclear detonations, and other features are shown in Figure 1-1. Hydrostratigraphic cross sections A-A’, B-B’, C-C’, and D-D’ are shown in Figures 1-2 through 1-5, respectively.

  9. Tank Vapor Characterization Project: Headspace vapor characterization of Hanford Waste Tank 241-C-204: Results from samples collected on 07/02/96

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, B.L.; Evans, J.C.; Pool, K.H. [and others

    1997-01-01

    This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-C-204 (Tank C-204) at the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank farm operations. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNNL). Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Analyte concentrations were based on analytical results and, where appropriate, sample volumes provided by WHC. A summary of the inorganic analytes, permanent gases, and total non-methane organic compounds is listed in Table S.1. The three highest concentration analytes detected in SUMMA{trademark} canister and triple sorbent trap samples are also listed in Table S.1. Detailed descriptions of the analytical results appear in the appendices.

  10. LANDRON, Olivier. Le catholicisme vert. Histoire des relations entre l’Église et la nature au XXe siècle. Paris, Les Éditions du Cerf, 2008, 527 p. ISBN 978-2-204-08658-5

    Directory of Open Access Journals (Sweden)

    Luis Martínez Andrade

    2010-01-01

    Full Text Available Resenha do livro LANDRON, Olivier. Le catholicisme vert. Histoire des relations entre l’Église et la nature au XXe siècle. Paris, Les Éditions du Cerf, 2008, 527 p. ISBN 978-2-204-08658-5

  11. miR-204 Shifts the Epithelial to Mesenchymal Transition in Concert with the Transcription Factors RUNX2, ETS1, and cMYB in Prostate Cancer Cell Line Model

    Directory of Open Access Journals (Sweden)

    Krassimira Todorova

    2014-01-01

    Full Text Available Epithelial to mesenchymal transition is an essential step in advanced cancer development. Many master transcription factors shift their expression to drive this process, while noncoding RNAs families like miR-200 are found to restrict it. In this study we investigated how the tumor suppressor miR-204 and several transcription factors modulate main markers of mesenchymal transformation like E- and N-cadherin, SLUG, VEGF, and SOX-9 in prostate cancer cell line model (LNCaP, PC3, VCaP, and NCI-H660. We found that SLUG, E-cadherin, and N-cadherin are differentially modulated by miR-204, using miR-204 specific mimics and inhibitors and siRNA gene silencing (RUNX2, ETS-1, and cMYB. The genome perturbation associated TMPRSS2-ERG fusion coincided with shift from tumor-suppressor to tumor-promoting activity of this miRNA. The ability of miR-204 to suppress cancer cell viability and migration was lost in the fusion harboring cell lines. We found differential E-cadherin splicing corroborating to miR-204 modulatory effects. RUNX2, ETS1, and cMYB are involved in the regulation of E-cadherin, N-cadherin, and VEGFA expression. RUNX2 knockdown results in SOX9 downregulation, while ETS1 and cMYB silencing result in SOX9 upregulation in VCaP cells. Their expression was found to be also methylation dependent. Our study provides means for understanding cancer heterogeneity in regard to adapted therapeutic approaches development.

  12. Progressive Lower Extremity Weakness and Axonal Sensorimotor Polyneuropathy from a Mutation in KIF5A (c.611G>A;p.Arg204Gln

    Directory of Open Access Journals (Sweden)

    Nivedita U. Jerath

    2015-01-01

    Full Text Available Introduction. Hereditary Spastic Paraplegia (HSP is a rare hereditary disorder that primarily involves progressive spasticity of the legs (hamstrings, quadriceps, and calves. Methods. A 27-year-old gentleman was a fast runner and able to play soccer until age 9 when he developed slowly progressive weakness. He was wheelchair-bound by age 25. He was evaluated by laboratory testing, imaging, electrodiagnostics, and molecular genetics. Results. Electrodiagnostic testing revealed an axonal sensorimotor polyneuropathy. Genetic testing for HSP in 2003 was negative; repeat testing in 2013 revealed a mutation in KIF5A (c.611G>A;p.Arg204Gln. Conclusions. A recent advance in neurogenetics has allowed for more genes and mutations to be identified; over 76 different genetic loci for HSP and 59 gene products are currently known. Even though our patient had a sensorimotor polyneuropathy on electrodiagnostic testing and a 2003 HSP genetic panel that was negative, a repeat HSP genetic panel was performed in 2013 due to the advancement in neurogenetics. This revealed a mutation in KIF5A.

  13. Gravity wave generation and propagation during geomagnetic storms over Kiruna (67.8°N, 20.4°E

    Directory of Open Access Journals (Sweden)

    P. R. Fagundes

    1995-04-01

    Full Text Available Atmospheric gravity waves, detected over Kiruna (67.8°N, 20.4°E during geomagnetic storms, are presented and analysed. The data include direct measurements of the OI 630.0 nm emission line intensity, the x-component of the local geomagnetic field and thermospheric (meridional and zonal wind velocities derived from the OI 630.0 nm Doppler shift observed with an imaging Fabry-Perot interferometer (IFPI. A low pass band filter technique was used to determine short-period variations in the thermospheric meridional wind velocities observed during geomagnetic storms. These short-period variations in the meridional wind velocities, which are identified as due to gravity waves, are compared to the corresponding variations observed in the OI 630.0 nm emission line intensity, x-component of the local geomagnetic field and the location of the auroral electrojet. A cross-correlation analysis was used to calculate the propagation velocities of the observed gravity waves.

  14. The spectrum of Familial Mediterranean Fever gene (MEFV) mutations and genotypes in Iran, and report of a novel missense variant (R204H).

    Science.gov (United States)

    Ebadi, Nader; Shakoori, Abbas; Razipour, Masoumeh; Salmaninejad, Arash; Zarifian Yeganeh, Razieh; Mehrabi, Saman; Raeeskarami, Seyed Reza; Khaleghian, Malihea; Azhideh, Hamidreza

    2017-12-01

    Familial Mediterranean Fever (FMF) is an autosomal recessive disorder, characterized by recurrent and self-limited episodes of fever, abdominal pain, synovitis and pleuritis. FMF as the most common inherited monogenic autoinflammatory disease mainly affects ethnic groups of the Mediterranean basin, Arab, Jewish, Turkish, Armenian North Africans and Arabic descent. In the present study, we selected 390 unrelated FMF patients according to the Tel-Hashomer criteria, and analyzed all patients for 12 most common mutations of MEFV gene by reverse hybridization assay (FMF strip assay). We also investigated exon 2 and 10 of MEFV gene in 78 patients by Sanger sequencing. According to strip assay results, at least one mutation was found in 234 patients (60%), and no mutation was found in other 156 patients (40%). The five most common mutations and allelic frequencies were M694V (13.6%), E148Q (10.4%), M694I (6.5%), V726A (4.1%), and M680I (3.8%). Moreover, we detected a novel missense variant (R204H, c.611 G > A) (SCV000297822) and following rare mutations among sequenced samples; R202Q, P115T, G304R, and E230K. This study describes the MEFV mutations spectrum and distribution in Iranian population, and shows different mutation patterns among Iranian ethnicities. Moreover, M694V is the most common MEFV mutation in Iran. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  15. Microbial community structures in methane hydrate baring deep marine sediments from the Peru Margin (ODP Leg. 201) and the Cascadia Margin (ODP Leg. 204)

    Science.gov (United States)

    Inagaki, F.; Nunoura, T.; Suzuki, M.; Takai, K.; Nealson, K. H.; Horikoshi, K.; Delwiche, M.; Colwell, F. S.; Jorgensen, B. B.

    2003-12-01

    Current estimates of biomass in deep subseafloor sediments recovered by the Ocean Drilling Program (ODP) have lead to the conclusion that the subseafloor environment potentially represents the largest biosphere on Earth. However, neither the microbial diversity and distribution that live there nor the relationship between metabolic characteristics and geological, geochemical settings are poorly understood yet. We present here the vertical profiles of microbial community structures occurring in methane hydrate baring subseafloor sediments collected from the Peru Margin (ODP Leg 201, site 1230) and Cascadia Margin (ODP Leg 204, sites 1244, 1245, 1251). Organic rich marine sediment core lacking methane hydrates obtained from the Peru Margin (ODP Leg 201, site 1227) was also investigated as a reference site. Quantitative-PCR analysis of archaeal rDNA population and molecular phylogenetic analyses of over 3,000 archaeal and bacterial 16S rDNA clones were demonstrated vertically through the ODP sediment core columns, comparing with data from geochemical analyses. On the basis of the results from microbiology and geochemistry, we discuss the relationship between the distribution of previously unknown microbial communities and the potential source of biogenic methane associated with the formation of hydrates in two geologically discrete deep-subseafloor environments.

  16. Depth profile of production yields of {sup nat}Pb(p, xn) {sup 206,205,204,203,202,201}Bi nuclear reactions

    Energy Technology Data Exchange (ETDEWEB)

    Mokhtari Oranj, Leila [Division of Advanced Nuclear Engineering, POSTECH, Pohang 37673 (Korea, Republic of); Jung, Nam-Suk; Kim, Dong-Hyun; Lee, Arim; Bae, Oryun [Pohang Accelerator Laboratory, POSTECH, Pohang 37673 (Korea, Republic of); Lee, Hee-Seock, E-mail: lee@postech.ac.kr [Pohang Accelerator Laboratory, POSTECH, Pohang 37673 (Korea, Republic of)

    2016-11-01

    Experimental and simulation studies on the depth profiles of production yields of {sup nat}Pb(p, xn) {sup 206,205,204,203,202,201}Bi nuclear reactions were carried out. Irradiation experiments were performed at the high-intensity proton linac facility (KOMAC) in Korea. The targets, irradiated by 100-MeV protons, were arranged in a stack consisting of natural Pb, Al, Au foils and Pb plates. The proton beam intensity was determined by activation analysis method using {sup 27}Al(p, 3p1n){sup 24}Na, {sup 197}Au(p, p1n){sup 196}Au, and {sup 197}Au(p, p3n){sup 194}Au monitor reactions and also by Gafchromic film dosimetry method. The yields of produced radio-nuclei in the {sup nat}Pb activation foils and monitor foils were measured by HPGe spectroscopy system. Monte Carlo simulations were performed by FLUKA, PHITS/DCHAIN-SP, and MCNPX/FISPACT codes and the calculated data were compared with the experimental results. A satisfactory agreement was observed between the present experimental data and the simulations.

  17. Depth profiles of production yields of natPb(p, xn206,205,204,203,202 Bi reactions using 100-MeV proton beam

    Directory of Open Access Journals (Sweden)

    Oranj Leila Mokhtari

    2017-01-01

    Full Text Available In this study, results of the experimental study on the depth profiles of production yields of 206,205,204,203,202Bi radio-nuclei in the natural Pb target irradiated by a 100-MeV proton beam are presented. Irradiation was performed at proton linac facility (KOMAC in Korea. The target, irradiated by 100-MeV protons, was arranged in a stack consisting of natural Pb, Al, Au foils and Pb plates. The proton beam intensity was determined by activation analysis method using 27Al(p, 3p1n24Na, 197Au(p, p1n196Au, and 197Au(p, p3n194Au monitor reactions and also using dosimetry method by a Gafchromic film. The production yields of produced Bi radio-nuclei in the natural Pb foils and monitor reactions were measured by gamma-ray spectroscopy. Monte Carlo simulations were performed by FLUKA, PHITS, and MCNPX codes and compared with the measurements in order to verify validity of physical models and nuclear data libraries in the Monte Carlo codes. A fairly good agreement was observed between the present experimental data and the simulations by FLUKA, PHITS, and MCNPX. However, physical models and the nuclear data relevant to the end of range of protons in the codes need to be improved.

  18. Yellow fever vaccine: comparison of the neurovirulence of new 17D-204 Stamaril™ seed lots and RK 168-73 strain.

    Science.gov (United States)

    Moulin, Jean-Claude; Silvano, Jérémy; Barban, Véronique; Riou, Patrice; Allain, Caroline

    2013-07-01

    The neurovirulence of two new candidate 17D-204 Stamaril™ working seed lots and that of two reference preparations were compared. The Stamaril™ working seed lots have been used for more than twenty years for the manufacturing of vaccines of acceptable safety and efficacy. The preparation designated RK 168-73 and provided by the Robert Koch Institute was used as a reference. It was confirmed that RK 168-73 strain was not a good virus control in our study because it has a very low neurovirulence regarding both the clinical and histopathological scores in comparison with Stamaril™ strain and is not representative of a vaccine known to be satisfactory in use. The results were reinforced by the phenotypic characterization by plaque assay demonstrating that RK 168-73 was very different from the Stamaril™ vaccine, and by sequencing results showing 4 mutations between Stamaril™ and RK 168-73 viruses leading to amino acid differences in the NS4B and envelop proteins. Copyright © 2013 The International Alliance for Biological Standardization. Published by Elsevier Ltd. All rights reserved.

  19. $^{204m}$Pb: A new Probe for TDPAC Experiments in Biology Complementing the Well Established Probes $^{111}$Cd and $^{199m}$Hg

    CERN Multimedia

    2002-01-01

    The short-lived nuclear probes $\\,^{111m}$Cd( t$_{1/2}$ = 49 min) , $^{199m}$Hg ( t$_{1/2}$ = 43 min) , and $^{204m}$Pb( t$_{1/2}$ = 43 min) supplied by ISOLDE are used to study the interaction of metals with biological macromolecules like, e.g., DNA and proteins. The structure and dynamics of metal sites in biomolecules are important in determining the functional efficiency of these macromolecules. Many life processes are based on such interactions. In order to study those metal sites close to physiological conditions a highly sensitive spectroscopic method is required, like Time Differential Perturbed Angular Correlation (TDPAC). Here, a radioactive atom is placed at the site of interest and by correlating the emitted $\\gamma$-quanta in space and on a nanosecond time scale local structural information is provided via the Nuclear Quadrupole Interaction. These investigations will allow a deeper insight into the adaptivity and rigidity of metal sites in the blue copper proteins (electron transfer proteins), th...

  20. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  1. [Relationship between hepatitis B virus polymerase gene mutation patterns of rtM204I/V and pre-core/basal core promoter mutations].

    Science.gov (United States)

    Yan, Li; Wang, Jie-Fei; Wang, Zhan-Hui; Sun, Jian; Zhou, Bin; Hou, Jinlin

    2014-12-01

    To investigate the relationship between mutations of rtM204V/I (methionine to valine or isoleucine at position rt204 of reverse transcriptase domain) in the hepatitis B virus (HBV) polymerase gene and the G1896A and G1899A single mutations in the pre-eore (PC) region and the A1762T and G1764A double-mutations in the basal core promoter (BCP) region. A total of 2,849 hepatitis B complete genome sequences were retrieved from the GenBank/EMBL/DDBJ. The amino acid sequence of the of reverse transcriptase domain and genome sequences of the PC region and the BCP region were aligned using MEGA4 software. Data were calculated using Microsoft Excel and evaluated using SPSS 13.0 statistical software. Among the 2, 849 HBV complete genome sequences, 217 (8%) strains were identified with Y(I/V) DD and 120 of those had the YIDD mutation and 97 had the YVDD mutation. Of the 1543 strains (54.2%) with PC-BCP mutations, seven mutation patterns of G 1896A-G 1899A-G 1896A-G 1899A-A 1762T/G 1764A, A 1762T/G 1764AG 1896A, A 1762T/G 1764A-G 1899A, and A 1762T/G 1764A-G 1896A-G 1899A were identified. of YMDD and PC-BCP had a higher incidence than the single YMDD mutation (76% vs 24.0%, x2=45.283, P=0.000). The double-mutations of YIDD and PC-BCP had a higher incidence than the double-mutation of YVDD and PC-BCP (85% vs 64.9%, x2=11.836, P=0.000). The double-mutation for lamivudine resistance of YMDD and PC-BCP had a higher incidence than the double pre-existent YMDD and PC-BCP mutations (89.3% vs 58.9%, x2=27.084, P=0.000). The three mutation patterns of G1896A-G1899A (P=0.000, OR=7.573), A1762T/G1764A-G1899A (P=0.000, OR=6.539) and A1762T/G1764A-G1896A-G1899A (P=0.000, OR=6.596) were associated with a greater risk of developing the YIDD mutation, according to binary logistic analysis. There is a relationship between the HBV YI/VDD mutation and PC-BCP mutations. Different PC-BCP mutation patterns have different effects on the YI/VDD mutation.

  2. Identification and analysis of phenotypic resistance characteristics of a novel mutation rtL180M+A181C+M204V in HBV reverse-transcriptase region of a patient with chronic hepatitis B

    Directory of Open Access Journals (Sweden)

    Jia-hui LIU

    2012-06-01

    Full Text Available Objective  To identify a novel mutation rtA181C in HBV reverse-transcriptase (RT region of a chronic hepatitis B (CHB patient receiving sequential anti-HBV nucleoside/nucleotide analogues, and to analyze its phenotypic resistance characteristics. Methods  A 43-year-old CHB patient was identified in 302 Hospital of PLA in June 2010, serum HBV DNA was extracted and the HBV RT gene was amplified by nested PCR. The direct PCR sequencing and clonal sequencing were performed, and 12 drug-resistance-associated sites were analyzed. The recombinant plasmids pTriEx-HBV1.1 containing representative variation in RT region were constructed and transfected into HepG2 cells. The cell medium was supplemented with various concentrations of lamivudine, adefovir, entecavir and tenofovir 4 hours post-transfection. Four days later, HBV DNA level in the cell supernatant was quantified by real time PCR and the viral phenotypic resistance characteristics was analyzed. Results  The patient receiving lamivudine for 36 months, adefovir for 14 months, and entecavir for 29 months consecutively, and viral rebound and biochemical breakthrough subsequently occurred. HBV DNA increased to 1.1×106IU/ml, and ALT level increased to 235U/L. rtL180M+A181V+M204V mutation was identified in HBV RT region, and clonal analysis showed that 9 of 18 clones for rtL180M+A181V+M204V, 7 of 18 for rtL180M+A181C+M204V, 1 of 18 for rtV173L+L180M+A181V, and 1 of 18 for wild type virus were obtained. The viral replication capacity showed that wild type>rtV173L+L180M+A181V>rtL180M+A181C+M204V>rtL180M+A181V+M204V. Compared to the wild type virus, rtL180M+A181V+M204V and rtV173L+L180M+A181V variants were relatively less susceptible to lamivudine and adefovir, while rtL180M+A181C+M204V variant was less susceptible to lamivudine and entecavir. Conclusions  Long-term sequential treatment with nucleoside/nucleotide analogues may lead to occurrence of multidrug resistance; production of novel

  3. Reproductive performance and pre-weaning mortality: Preliminary analysis of 27,221 purebred female dogs and 204,537 puppies in France.

    Science.gov (United States)

    Chastant-Maillard, S; Guillemot, C; Feugier, A; Mariani, C; Grellet, A; Mila, H

    2017-04-01

    The objective of this study was to describe efficiency of reproduction of purebred dogs in field breeding conditions, from mating to weaning in France. Data were collected between 2010 and 2014 in 5,667 French breeding kennels via a reproduction management software (Breeding Management System, Royal Canin, Aimargues, France). Effect of breed size (Mini: adult body weight 40 kg), age of dam and male on pregnancy rate, abortion rate and litter size were evaluated by multivariable models. Data on 45,913 heats (all with mating), from 27,221 bitches from 248 breeds, were analysed. At mating, mean age (±SD) was 3.1 ± 1.8 years for bitches and 3.3 ± 2.0 for males. Males originated from the same kennel as the females in 88.5% of the matings. Based on breeder's evaluation of the pregnancy status, pregnancy rate (number of pregnant females based on breeders declaration/number of heats) was 87.8% and abortion rate was 6.8%. Finally, 81.9% of the mated females gave birth to a litter. On 37,946 litters (204,537 puppies), mean litter size was 5.4 ± 2.8 puppies (range 1-24), which was influenced by breed size and dam age (p breed size and within a breed size, by breed. Despite probable approximations (as data originate from breeders declaration), this large-scale analysis provides reference values on reproductive performance in dogs. © 2016 Blackwell Verlag GmbH.

  4. FCJ-204 Degrees of Freedom

    Directory of Open Access Journals (Sweden)

    Elena Knox

    2016-12-01

    Full Text Available This paper critiques a choreographed performance of embodied agency by a ‘very humanlike’ (Ishiguro, 2006 gynoid robot. It draws on my experience in 2013 with Actroid-F (or Geminoid-F, designed by ATR Hiroshi Ishiguro Laboratories, when I created six artworks making up Actroid Series I. My analysis here proceeds from and through the part-programmed, part-puppeteered actions and vocalisations of Actroid-F for my six-minute video Radical Hospitality, in which the robotic gynoid actor performs compound negotiations of embodied authority, docility, and compliance. Design of ‘very humanlike’ androids risks instilling into robotic agents existing and discriminatory societal standards. My performance, installation and screen works trouble the gendered aesthetics predominant in this realm of engineering design.

  5. MO-E-17A-08: Attenuation-Based Size Adjusted, Scanner-Independent Organ Dose Estimates for Head CT Exams: TG 204 for Head CT

    Energy Technology Data Exchange (ETDEWEB)

    McMillan, K; Bostani, M; Cagnon, C; McNitt-Gray, M [UCLA School of Medicine, Los Angeles, CA (United States); Zankl, M [Helmholtz Zentrum Munchen GmbH, Neuherberg (Germany); DeMarco, J [UCLA Department of Radiation Oncology, Los Angeles, CA (United States)

    2014-06-15

    Purpose: AAPM Task Group 204 described size specific dose estimates (SSDE) for body scans. The purpose of this work is to use a similar approach to develop patient-specific, scanner-independent organ dose estimates for head CT exams using an attenuation-based size metric. Methods: For eight patient models from the GSF family of voxelized phantoms, dose to brain and lens of the eye was estimated using Monte Carlo simulations of contiguous axial scans for 64-slice MDCT scanners from four major manufacturers. Organ doses were normalized by scannerspecific 16 cm CTDIvol values and averaged across all scanners to obtain scanner-independent CTDIvol-to-organ-dose conversion coefficients for each patient model. Head size was measured at the first slice superior to the eyes; patient perimeter and effective diameter (ED) were measured directly from the GSF data. Because the GSF models use organ identification codes instead of Hounsfield units, water equivalent diameter (WED) was estimated indirectly. Using the image data from 42 patients ranging from 2 weeks old to adult, the perimeter, ED and WED size metrics were obtained and correlations between each metric were established. Applying these correlations to the GSF perimeter and ED measurements, WED was calculated for each model. The relationship between the various patient size metrics and CTDIvol-to-organ-dose conversion coefficients was then described. Results: The analysis of patient images demonstrated the correlation between WED and ED across a wide range of patient sizes. When applied to the GSF patient models, an exponential relationship between CTDIvol-to-organ-dose conversion coefficients and the WED size metric was observed with correlation coefficients of 0.93 and 0.77 for the brain and lens of the eye, respectively. Conclusion: Strong correlation exists between CTDIvol normalized brain dose and WED. For the lens of the eye, a lower correlation is observed, primarily due to surface dose variations. Funding

  6. Pb(II) and Hg(II) binding to $\\textit{de novo}$ designed proteins studied by $^{204m}$Pb- and $^{199m}$Hg-Perturbed Angular Correlation of $\\gamma$-rays (PAC) spectroscopy : Clues to heavy metal toxicity

    CERN Multimedia

    2002-01-01

    $\\textit{De novo}$ design of proteins combined with PAC spectroscopy offers a unique and powerful approach to the study of fundamental chemistry of heavy metal-protein interactions, and thus of the mechanisms underlying heavy metal toxicity. In this project we focus on Pb(II) and Hg(II) binding to designed three stranded coiled coil proteins with one or two binding sites, mimicking a variety of naturally occurring thiolate-rich metal ion binding sites in proteins. The $^{204m}$Pb- and $^{199m}$Hg-PAC experiments will complement data already recorded with EXAFS, NMR, UV-Vis and CD spectroscopies.

  7. Excitation functions of $^{nat}$Pb(d,x)$^{206,205,204,203,202}$Bi, $^{203cum,202m,201cum}$Pb and $^{202cum,201cum}$Tl reactions up to 50 MeV

    OpenAIRE

    Ditrói, F.; Tárkányi, F.; Takács, S.; Hermanne, A.; Ignatyuk, A. V.

    2014-01-01

    Cross-sections of deuteron induced nuclear reactions on lead were measured up to 50 MeV using the standard stacked foil irradiation technique and high resolution $\\gamma$-ray spectrometry. Experimental cross-sections and derived integral yields are presented for the $^{nat}$Pb(d,x)$^{206,205,204,203,202}$Bi, $^{203cum,202m,201cum}$Pb and $^{202cum,201cum}$Tl reactions. The experimental data were compared with the results from literature and with the data in the TENDL-2013 library (obtained wi...

  8. High-titer lactic acid production from NaOH-pretreated corn stover by Bacillus coagulans LA204 using fed-batch simultaneous saccharification and fermentation under non-sterile condition.

    Science.gov (United States)

    Hu, Jinlong; Zhang, Zhenting; Lin, Yanxu; Zhao, Shumiao; Mei, Yuxia; Liang, Yunxiang; Peng, Nan

    2015-04-01

    Lactic acid (LA) is an important chemical with various industrial applications. Non-food feedstock is commercially attractive for use in LA production; however, efficient LA fermentation from lignocellulosic biomass resulting in both high yield and titer faces technical obstacles. In this study, the thermophilic bacterium Bacillus coagulans LA204 demonstrated considerable ability to ferment glucose, xylose, and cellobiose to LA. Importantly, LA204 produces LA from several NaOH-pretreated agro stovers, with remarkably high yields through simultaneous saccharification and fermentation (SSF). A fed-batch SSF process conducted at 50°C and pH 6.0, using a cellulase concentration of 30 FPU (filter paper unit)/g stover and 10 g/L yeast extract in a 5-L bioreactor, was developed to produce LA from 14.4% (w/w) NaOH-pretreated non-sterile corn stover. LA titer, yield, and average productivity reached 97.59 g/L, 0.68 g/g stover, and 1.63 g/L/h, respectively. This study presents a feasible process for lignocellulosic LA production from abundant agro stovers. Copyright © 2015 Elsevier Ltd. All rights reserved.

  9. Factors associated with grade 3 or 4 treatment-related toxicity in women with advanced or recurrent cervical cancer: an exploratory analysis of NRG Oncology/Gynecologic Oncology Group trials 179 and 204.

    Science.gov (United States)

    Chase, Dana M; Kauderer, James; Wenzel, Lari; Ramondetta, Lois; Cella, David; Long, Harry J; Monk, Bradley J

    2015-02-01

    This study aimed to describe pretreatment patient characteristics and baseline quality-of-life scores as they relate to the development of grade 3 or 4 toxicity in patients receiving chemotherapy for advanced/recurrent cervical cancer. The study sample was drawn from Gynecologic Oncology Group protocols 179 and 204. Grade 3 or 4 toxicities were considered in 4 specified categories as follows: peripheral neuropathy, fatigue, hematological, and gastrointestinal (GI). The data variables explored included age, stage, pretreatment radiation, performance status (PS) at treatment initiation, and baseline Functional Assessment of Cancer Therapy-Cervix (FACT-Cx) score. A logistic regression model was developed with various adverse events as binary (0/1) outcomes. Six hundred seventy-three patient-reported questionnaires were used in the analyses. At baseline, pain was the most severe patient-reported symptom. Baseline line-item patient concerns did demonstrate specific correlations with the development of individual toxicities. In 401 patients who were enrolled on Gynecologic Oncology Group 204 (fatigue not measured on 179), a worse PS predicted the development of grade 3 or 4 fatigue (odds ratio, 2.78; 95% confidence interval, 1.66-4.68). Exposure to previous radiation, treatment regimen, and a worse FACT-Cx score were associated with the reporting of both grade 3 or 4 leukopenia (P < 0.05) and anemia (P < 0.0005). Performance status and treatment regimen (P < 0.05) were associated with the development of grade 3 or 4 thrombocytopenia. Age and treatment regimen (P < 0.05) were associated with the development of grade 3 or 4 neutropenia. The FACT-Cx score (P = 0.0016) predicted grade 3 or 4 GI toxicity. The development of fatigue, hematological, and GI toxicity might be predictable based on factors other than treatment assignment such as age, PS, and patient-reported quality-of-life measurement.

  10. Automatización del laboratorio de ingeniería electrónica G-204 de la ECI a través de una red inmótica

    Directory of Open Access Journals (Sweden)

    Hernán Paz Penagos

    2006-09-01

    Full Text Available El aumento de usuarios (estudiantes y profesores de los laboratorios de ingeniería electrónica de la Escuela Colombiana de Ingeniería JULIO GARAVITO en el último año ha congestionado el acceso a dichos laboratorios, razón por la cual el Centro de Estudios de Electrónica Aplicada, Grupo de Investigación “Ecitrónica8 del programa de ingeniería electrónica de la escuela, propuso, diseñó y desarrolló un proyecto de investigación que aprovecha el tendido de distribución eléctrica del edificio G para ofrecer facilidades de acceso, control de equipos de laboratorio, ahorro de energía y mejoramiento de la calidad de servicio. El sistema de la red inmótica para el laboratorio G-204 estará constituida con los siguientes subsistemas: a. Un control de acceso con una arquitectura cliente - servidor; en este último reposa una base de datos de los usuarios, horarios, equipos y mesas de trabajo; el usuario se conecta desde cualquier computador (cliente al servidor a través de Internet para separar el turno de su práctica de laboratorio; en esa operación selecciona el horario, los equipos, la mesa, el tipo de red que requiere (monofásica o trifásica y registra a sus compañeros de trabajo. El acceso al laboratorio G-204, en el día y la hora de su práctica, se realiza mediante un lector de tarjetas inteligentes. b. Control de información de un aviso publicitario y de un reloj electrónico: desde el servidor se genera y controla el envió de información de interés a un aviso publicitario conformado por tres pantallas LCD ubicadas en una de las paredes del segundo piso del edificio G; así mismo, se actualiza continuamente la hora y se informa sobre la temperatura del laboratorio G-204. c. Habilitación o deshabilitación de los bancos de trabajo: mediante un control on-off, con mando desde el servidor, se energizan (al inicio de la práctica o desenergizan (al final de la práctica o ante eventualidades los bancos de trabajo para

  11. Inhibitory effect of juniperonic acid (Delta-5c,11c,14c,17c-20:4, omega-3) on bombesin-induced proliferation of Swiss 3T3 cells.

    Science.gov (United States)

    Morishige, Jun-ichi; Amano, Naoki; Hirano, Kaoru; Nishio, Hiroaki; Tanaka, Tamotsu; Satouchi, Kiyoshi

    2008-09-01

    Juniperonic acid (Delta-5c,11c,14c,17c-20:4, JA) is a polymethylene-interrupted (PMI) fatty acid that occurs in Biota orientalis. In this study, we found that JA has an antiproliferative activity. Swiss 3T3 cells were preloaded with fatty acids before stimulation with bombesin, a mitogenic neuropeptide, and proliferation of the cells was assessed by [(3)H]thymidine incorporation. Preloading of linoleic acid (Delta-9c,12c-18:2) significantly enhanced bombesin-induced proliferation. In contrast, preloading of eicosapentaenoic acid (Delta-5c,8c,11c,14c,17c-20:5, EPA) suppressed proliferation. Likewise, cells preloaded with JA showed a significantly curtailed response to bombesin. The antiproliferative potency of JA was equivalent to that of EPA. Sciadonic acid (Delta-5c,11c,14c-20:3), an omega-6 analogue of JA did not show antiproliferative activity, suggesting the importance of the omega-3 double bond rather than the PMI structure. The EPA-like activity of JA may be involved in the pharmaceutical activity of biota seeds, a psychoactive Chinese traditional medicine.

  12. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  13. 204-IJBCS-Article-Paul Noupa

    African Journals Online (AJOL)

    RHUMSIKI

    Cyanotis longifolia. Bulbostylis hispidula. Hyparrhenia suplumosa. Crotalaria occidentalis. Striga aspera. Ascolepsis sp. Cyperus sp. Crotalaria lachnophora. Triumfetta pentandra. Andropogon mannii. Ctenium newtonii. Desmodium adscendens. Dissotis decumbens. Eragrostis atrovirens. Ipomoea obscura. Microchloa sp.

  14. 40 CFR 204.54 - Test procedures.

    Science.gov (United States)

    2010-07-01

    ...+ Antilog L 5/10]) Where: L=The average A-weighted sound level (in decibels) L 1=The A-weighted sound level (in decibels) at microphone position 1 L 2=The A-weighted sound level (in decibels) at microphone position 2 L 3=The A-weighted sound level (in decibels) at microphone position 3 L 4=The A-weighted sound...

  15. 35__200 - 204__Musa - Toxicity

    African Journals Online (AJOL)

    User

    significant effect of Alanine Aminotransferase (ALT) and Aspartate Aminotransferase (AST); however there was significant (p < 0.05) .... cell (WBC) count and differential WBC count using the method of Tietz (1985). Tissue histology: Kidney ..... proliferation of matured lymphocytes. The extract therefore, may not have caused ...

  16. 18 CFR 157.204 - Application procedure.

    Science.gov (United States)

    2010-04-01

    ..., DEPARTMENT OF ENERGY REGULATIONS UNDER NATURAL GAS ACT APPLICATIONS FOR CERTIFICATES OF PUBLIC CONVENIENCE... gas company; the state under the laws of which the applicant is organized or authorized to do business... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Application procedure...

  17. 28_197 - 204_Saminu et al.,

    African Journals Online (AJOL)

    pc

    Thurechtand Howdle, 2009) and other various media (Mertoglu, et.al., 2005). ism involved in RAFT polymerisation ... 2009; Smith, et.al., 2010; Wager, et.al., 2004; Wang, et.al., 2006; Zhou, et.al., 2007).Synthetic procedures require the .... The decomposition pro of the copolymers were measured u thermogravimetric analysis ...

  18. 7 CFR 20.4 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... performance bond or letter of credit from the foreign buyer is included in this definition and such a... whose place of doing business with respect to the transaction is outside the United States. Foreign buyer or foreign seller includes a person who maintains a place of doing business outside the United...

  19. 48 CFR 952.204-2 - Security.

    Science.gov (United States)

    2010-10-01

    ... nuclear material in the production of energy, but excluding data declassified or removed from the... control which are required to be reported to the Securities and Exchange Commission, the Federal Trade...

  20. 48 CFR 2052.204-70 - Security.

    Science.gov (United States)

    2010-10-01

    ... financial information, including Commission plans, policies, reports, financial plans, internal data... use of special nuclear material in the production of energy, but does not include data declassified or...

  1. 5 CFR 9701.204 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... locality and special rate supplements. Classification, also referred to as job evaluation, means the process of analyzing and assigning a job or position to an occupational series, cluster, and band for pay..., Librarian Series). Position or Job means the duties, responsibilities, and related competency requirements...

  2. 5 CFR 9901.204 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... meaning given that term in § 9901.103. Classification, also referred to as job evaluation, means the process of analyzing and assigning a job or position to an occupational series, official title, career... meaning given that term in § 9901.103. Position or job means the duties, responsibilities, and related...

  3. 8 CFR 204.301 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... child's life so that the parent's whereabouts are unknown, there is no reasonable expectation of the... child, or to have disappeared from the child's life, in the same manner as would apply to any other... life; or (2) The child's father, when the competent authority has determined that the child's mother...

  4. Publications | Page 204 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    National development plans focus upon energy and water separately, often not integrating the other sector''s resource use. This contributes to programme failures in the long run. Research is needed to inform and assist government in making the right decisions around renewable energies. A... Managing International ...

  5. Publications | Page 204 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  6. 29 CFR 1614.204 - Class complaints.

    Science.gov (United States)

    2010-07-01

    ... that discriminates against the group on the basis of their race, color, religion, sex, national origin...; (ii) A description of the issues accepted as part of the class complaint; (iii) An explanation of the... entitled to reasonable development of evidence on matters relevant to the issues raised in the complaint...

  7. 12 CFR 268.204 - Class complaints.

    Science.gov (United States)

    2010-01-01

    ... discriminates against the group on the basis of their race, color, religion, sex, national origin, age or... of the complaint; (ii) A description of the issues accepted as part of the class complaint; (iii) An.... Both parties are entitled to reasonable development of evidence on matters relevant to the issues...

  8. 7 CFR 1901.204 - Compliance reviews.

    Science.gov (United States)

    2010-01-01

    ... determine the way in which they were recruited. (iv) Interview informed local community leaders, including minority leaders, if any to determine if the facility is operating without discrimination because of race, color, or national origin. (3) Recording results of reviews—(i) Association, Watershed, Resource...

  9. 48 CFR 204.7000 - Scope.

    Science.gov (United States)

    2010-10-01

    ..., contracts, and related instruments; and (b) Does not apply to solicitations or orders for communication service authorizations issued by the Defense Information Technology Contracting Organization of the Defense Information Systems Agency in accordance with 239.7407-2. ...

  10. 48 CFR 204.7101 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... Definitions. Accounting classification reference number (ACRN) means any combination of a two position alpha/numeric code used as a method of relating the accounting classification citation to detailed line item... in this subpart, means an item for which a firm price has been established in the basic contract or...

  11. Reference: 204 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ified in Arabidopsis based on a growth defect of the dark-grown hypocotyl and an abnormal composition of the...on defects of cells in the central cylinder. These defects were accompanied by changes in the non-cellulosic polysaccharide compositi...on, including the accumulation of ectopic callose. Interestingly, in contrast to ot

  12. 40 CFR 96.204 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... combustion turbine serving at any time, since the later of November 15, 1990 or the start-up of the unit's combustion chamber, a generator with nameplate capacity of more than 25 MWe producing electricity for sale. (2) If a stationary boiler or stationary combustion turbine that, under paragraph (a)(1) of this...

  13. 40 CFR 97.204 - Applicability.

    Science.gov (United States)

    2010-07-01

    ...: any stationary, fossil-fuel-fired boiler or stationary, fossil-fuel-fired combustion turbine serving... generator with nameplate capacity of more than 25 MWe producing electricity for sale. (2) If a stationary boiler or stationary combustion turbine that, under paragraph (a)(1) of this section, is not a CAIR SO2...

  14. 5 CFR 2635.204 - Exceptions.

    Science.gov (United States)

    2010-01-01

    ... technology. At the conclusion of his speech, the association presents the employee a framed map with a market... speech in support of the candidate. (g) Widely attended gatherings and other events—(1) Speaking and... significance of the employee's role in any such matter, the purpose of the event, the identity of other...

  15. TU-AB-204-04: Partnerships

    Energy Technology Data Exchange (ETDEWEB)

    Ochs, R. [Food & Drug Administration Center for Devices and Radiological Health (United States)

    2016-06-15

    The responsibilities of the Food and Drug Administration (FDA) have increased since the inception of the Food and Drugs Act in 1906. Medical devices first came under comprehensive regulation with the passage of the 1938 Food, Drug, and Cosmetic Act. In 1971 FDA also took on the responsibility for consumer protection against unnecessary exposure to radiation-emitting devices for home and occupational use. However it was not until 1976, under the Medical Device Regulation Act, that the FDA was responsible for the safety and effectiveness of medical devices. This session will be presented by the Division of Radiological Health (DRH) and the Division of Imaging, Diagnostics, and Software Reliability (DIDSR) from the Center for Devices and Radiological Health (CDRH) at the FDA. The symposium will discuss on how we protect and promote public health with a focus on medical physics applications organized into four areas: pre-market device review, post-market surveillance, device compliance, current regulatory research efforts and partnerships with other organizations. The pre-market session will summarize the pathways FDA uses to regulate the investigational use and commercialization of diagnostic imaging and radiation therapy medical devices in the US, highlighting resources available to assist investigators and manufacturers. The post-market session will explain the post-market surveillance and compliance activities FDA performs to monitor the safety and effectiveness of devices on the market. The third session will describe research efforts that support the regulatory mission of the Agency. An overview of our regulatory research portfolio to advance our understanding of medical physics and imaging technologies and approaches to their evaluation will be discussed. Lastly, mechanisms that FDA uses to seek public input and promote collaborations with professional, government, and international organizations, such as AAPM, International Electrotechnical Commission (IEC), Image Gently, and the Quantitative Imaging Biomarkers Alliance (QIBA) among others, to fulfill FDA’s mission will be discussed. Learning Objectives: Understand FDA’s pre-market and post-market review processes for medical devices Understand FDA’s current regulatory research activities in the areas of medical physics and imaging products Understand how being involved with AAPM and other organizations can also help to promote innovative, safe and effective medical devices J. Delfino, nothing to disclose.

  16. 29 CFR 541.204 - Educational establishments.

    Science.gov (United States)

    2010-07-01

    ... establishment” includes special schools for mentally or physically disabled or gifted children, regardless of... of instructing, measuring and testing the learning potential and achievement of students... work such as administering school testing programs, assisting students with academic problems and...

  17. 5 CFR 950.204 - Local eligibility.

    Science.gov (United States)

    2010-01-01

    ... defined as providing or conducting real services, benefits, assistance or program activities covering 30 percent of a state's geographic boundaries or providing or conducting real services, benefits, assistance... met on the basis of services provided solely through an “800” telephone number, the internet, the U.S...

  18. 12 CFR 204.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... death, incompetency, marriage, divorce, attachment, or otherwise by operation of law or a transfer on... Agreement Corporation organized under the laws of the United States, the sum, if positive, of the following... foreign parent institution, or by non-United States offices of an affiliated Edge or Agreement Corporation...

  19. 30 CFR 75.204 - Roof bolting.

    Science.gov (United States)

    2010-07-01

    ... accessories addressed in ASTM F432-95, “Standard Specification for Roof and Rock Bolts and Accessories,” the.... (4) In each roof bolting cycle, the actual torque or tension of the first tensioned roof bolt... during each roof bolting cycle shall be tested during or immediately after the first row of bolts has...

  20. 14 CFR 204.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... the board of directors and other managing officers are citizens of the United States, which is under... common responsibilities in both companies. (l) Substantial change in operations, ownership, or management includes, but is not limited to, the following events: (1) Changes in operations from charter to scheduled...

  1. 49 CFR 172.204 - Shipper's certification.

    Science.gov (United States)

    2010-10-01

    ... regulations.” (b) Exceptions. (1) Except for a hazardous waste, no certification is required for a hazardous material offered for transportation by motor vehicle and transported: (i) In a cargo tank supplied by the... contains radioactive material intended for use in, or incident to, research, or medical diagnosis or...

  2. 46 CFR 197.204 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... structurally. Commercial diver means a diver engaged in underwater work for hire excluding sport and... mode means a type of diving requiring SCUBA, surface-supplied air, or surface-supplied mixed-gas...

  3. 35__200 - 204__Musa - Toxicity

    African Journals Online (AJOL)

    User

    ABSTRACT. Sub-acute toxicity profile of Rheumatic Tea Formula (RTF), a polyherbal tea consisting of Salix alba, Eucalyptus globulus and Albizia chevalieri was investigated in wistar rats of both sexes. Wistar rats were orally administered three different doses of ethanol extract of RTF for 28 days after which the effect on ...

  4. 40 CFR 204.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... ballistics of meter dynamic characteristics as specified by American National Standard S1.4-1971 or... of a metering characteristic and weighing A, B, or C as specified in American National Standard...

  5. 23 CFR 646.204 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS RAILROADS Railroad... aspect upon the approach or presence of a train. Preliminary engineering shall mean the work necessary to... rapid transit, commuter and street railroads. Utility shall mean the lines and facilities for producing...

  6. Publications | Page 204 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Three decades of war have changed household and family structures, with an unprecedented increase in the number of female-headed households. Findings provide insight on the impact of state ICT policies and programmes regarding women''s engagement with new media. In terms of government policy,.

  7. 21 CFR 10.204 - General.

    Science.gov (United States)

    2010-04-01

    ... written media access to its proceedings, so that members of the press would have the opportunity to provide first-hand reports. However, because electronic media coverage presents certain difficulties that... PROCEDURES Electronic Media Coverage of Public Administrative Proceedings; Guideline on Policy and Procedures...

  8. 19 CFR 201.204 - Salary offset.

    Science.gov (United States)

    2010-04-01

    ... applicable. (7) Failure to appear. If, in the absence of good cause shown (e.g., illness), the employee or..., based on materially changed circumstances, including, but not limited to, catastrophic illness, divorce...

  9. INCLUSIÓN Y ACUMULACIÓN DE NA+ EN DIFERENTES ÓRGANOS DE LA VARIEDAD DE TRIGO CUBA-C-204 COMO RESPUESTA AL ESTRÉS SALINO

    Directory of Open Access Journals (Sweden)

    Leandris Argentel

    2016-06-01

    Full Text Available Se determinó la capacidad de inclusión y los sitios de retención de cationes en una variedad de trigo harinero Cuba-C-204, como posible indicador de toxicidad iónica y daño celular después de tratamiento salino, mediante técnicas de espectrofotometría de absorción atómica, fijación y microanálisis en diferentes órganos de la planta. Plantas fueron cultivadas por 35 días en condiciones de hidroponía en solución nutritiva con dos tratamientos (salinizada y control, con 88 mM de NaCl y sin NaCl, respectivamente. Se cuantificó el contenido catiónico en raíces, vainas y hojas, y en una muestra aleatoria de cada órgano seccionado. Como resultado del tratamiento salino observase que hubo mayor acumulación de Na+ y Ca2+ en los diferentes órganos. En la parte de la raíz más próxima al tallo, y en la base y parte media de la vaina se observó inclusión y concentración significativas de Na+. En la hoja el Na+ se acumuló en la parte más próxima a la lígula y el ápice, estando ausente en la parte media de la hoja. La mayor interferencia nutricional obtenida fue Na+/K+ en las vainas de las hojas, con una relación iónica media de 0.45. El contenido de Ca2+ en todos los casos fue superior en las plantas que crecieron en el medio salino y su concentración aumentó desde la raíz hasta las hojas. Existió congruencia entre los análisis espectrofotométricos y lo observado por microscopía electrónica. Los resultados obtenidos permiten aumentar el conocimiento que se tiene de la variedad como fuente de resistencia al estrés salino.

  10. 40 CFR Appendix I to Part 204 - Appendix I to Part 204

    Science.gov (United States)

    2010-07-01

    ....: Serial No.: Other and Manufacturer: Model No.: Serial No.: Data: Sound levels (decibels) Background sound level at location 1 (decibels) Location 1 2 3 4 5 Average sound level (decibels) A-Weighted Tested by...

  11. 49 CFR 571.204 - Standard No. 204; Steering control rearward displacement.

    Science.gov (United States)

    2010-10-01

    ... torque from the steering wheel to the steering gear. S4Requirements. S4.1Vehicles manufactured before... the forwardmost and rearwardmost position. S5.3Convertibles and open-body type vehicles have the top...

  12. 12 CFR 204.125 - Foreign, international, and supranational entities referred to in §§ 204.2(c)(1)(iv)(E) and 204.8...

    Science.gov (United States)

    2010-01-01

    ... Communities. European Development Fund. European Economic Community. European Free Trade Association. European.... Caribbean Development Bank. Caribbean Free Trade Association Caribbean Regional Development Agency. Central... American General Treaty of Economic Integration. River Plate Basin Commission. Africa African Development...

  13. Measurement of dose speed absorbed in depth imparted by sources external secondary patterns of beta radiation. Part 1 Measurement of dose speed absorbed in the surface of soft fabric for isotopes of {sup 90}Sr/{sup 90}Y, {sup 147}Pm and {sup 204}TI; Medicion de rapidez de dosis absorbida en profundidad impartida por fuentes patrones secundarios de radiacion beta externos. Parte 1. Medicion de rapidez de dosis absorbida en la superficie de tejido blando para isotopos de {sup 90}Sr/{sup 90}Y, {sup 147}Pm y {sup 204}TI

    Energy Technology Data Exchange (ETDEWEB)

    Alvarez R, J.T. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    1993-01-15

    The dose speed was measured absorbed for depth zero, (superficial) in soft equivalent fabric, for the secondary pattern{sup s} four sources of beta radiation, (Nr. 86): {sup 90}Sr/{sup 90}Y, (1850 MBq and 74 MBq respectively); {sup 147}Pm, (518 MBq) and {sup 204}TI, (18.5 MBq). The measurement is carried out to different distances of source-detecting separation, (11.0, 30.0 and 50.0 cm for the source of 1850 MBq, 30.0 cm for that of 74 MBq; 11.00 cm for the source of {sup 147}Pmand to contact for all the sources); maintaining the radiation sheaf aligned the one axis of symmetry of the detector, ({alpha} 0 degrees). The detector employed was a extrapolation chambers of variable electrodes and electrode fixed collector, (30 mm of diameter). In accordance with the principle of Bragg-Gray the volume of the chambers is varied and they register the variations of the current of collected ionization, correcting until for a maximum of thirteen correction factors that take into account the deviation to the suppositions that it establishes this principle. The certain values of the speed of superficial absorbed dose are in the following intervals: {sup 90}Sr/{sup 90}Y, (1850 MBq, 0.0, 11.0, 30.0 and 50.0 cm): 43.164 mGy S-t, 0.544 mGy s-1 ,0.075 mGy s{sup -1} and 0.027 mGy s{sup -1}, respectively, with a Global Analysis of the order of 1.17%, 1.17%, 1.14% and 1.66%, K J; {sup 90}Sr / {sup 90}Y, (74 MBq, 0.0 and 30 cm): 1.536 mGy s{sup -1} and 0.002 mGy s{sup -1}, with Global Analysis of 1.19.0% and 5.22%, (K = 1) respectively, for the {sup 147}Pm, (0.0 and 11.0 in the interval of: 0.36 {mu}Gy s{sup -1} and 0.43 {mu}Gy s{sup -1}, with one Global Analysis of 1 .42% and 4.28%, (K = 1), respectively; and finally for the {sup 204}TI, (0.0 cm) in the interval of 0.10 {mu}Gy s{sup -1} with a Global Analysis of 1.27%. He calculates of the Global Analysis one carries out of agreement with those recommendations of the BIPM. In all the cases of source-detecting arrangement with

  14. 7 CFR 25.204 - Evaluation of the strategic plan.

    Science.gov (United States)

    2010-01-01

    ... directly or through contractual or other arrangements subject a person to discrimination on the basis of race, color, creed, national origin, gender, handicap or age in its employment practices, including... Discrimination Act of 1975. ...

  15. 23 CFR 970.204 - Management systems requirements.

    Science.gov (United States)

    2010-04-01

    ... operation of management systems. The procedures shall include: (1) A process for ensuring the outputs of the... cost-effectively; (3) A description of each management system; (4) A process to operate and maintain the management systems and their associated databases; and (5) A process for data collection...

  16. 23 CFR 971.204 - Management systems requirements.

    Science.gov (United States)

    2010-04-01

    ... existing, or the development, establishment, implementation, and operation of new management systems. The procedures shall include: (1) A process for ensuring the output of the management systems is considered in... transportation assets cost-effectively; (3) A description of each management system; (4) A process to operate and...

  17. 23 CFR 973.204 - Management systems requirements.

    Science.gov (United States)

    2010-04-01

    ..., implementation and operation of nationwide management systems. If a tribe develops tribal management systems, the... operation of tribal management systems. The procedures shall include: (1) A description of each management system; (2) A process to operate and maintain the management systems and their associated databases; (3...

  18. 48 CFR 3052.204-71 - Contractor employee access.

    Science.gov (United States)

    2010-10-01

    ... unauthorized disclosure of which could adversely impact a person's privacy or welfare, the conduct of Federal..., telecommunications equipment, cabling, network drives, computer drives, network software, computer software, software...

  19. 48 CFR 52.204-2 - Security Requirements.

    Science.gov (United States)

    2010-10-01

    ... a cost contract for research and development with an educational institution is contemplated, add... this contract or any of its elements from an unclassified status or a lower classification to a higher... Contractor shall notify the Contracting Officer in writing. Until resolution of the problem is made by the...

  20. Dicty_cDB: VSA204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ne 3D7, *** SEQUENCING IN PROGRESS ***, 4 unordered pieces. 36 0.001 6 BQ045548 |BQ045548.1 EST594665 P. infestans-challenged...mRNA sequence. 54 0.002 1 BQ047121 |BQ047121.1 EST596239 P. infestans-challenged potato leaf, incompatible r

  1. RCT: Module 2.04, Dosimetry, Course 8769

    Energy Technology Data Exchange (ETDEWEB)

    Hillmer, Kurt T. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-08-11

    This course will introduce the types of instruments used to measure external and internal radiation to people. Dosimetry is the quantitative assessment of radiation received by the human body. Several types of dosimeters are used worldwide. This information is valuable to all radiological control personnel because dosimeters are the only direct method to measure and document personnel radiation exposure and ensure regulatory compliance with applicable limits. This course will cover dosimetry terms, Department of Energy (DOE) limits, Los Alamos National Laboratory (LANL) administrative guidelines, thermoluminescent dosimeters (TLDs), LANL dosimetry, and bioassay assessment methods. This course will prepare the student with the skills necessary for radiological control technician (RCT) qualification by passing quizzes, tests, and the RCT Comprehensive Phase 1, Unit 2 Examination (TEST 27566) and providing in-thefield skills.

  2. Dicty_cDB: SSA204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ssal-rgf-516-040... 34 1.8 (Q6ZSI9) RecName: Full=Calpain-12; EC=3.4.22.-; &AK127... 34 1.8 AL132848_2( AL132848...(Q9VT65) RecName: Full=Calpain-B; EC=3.4.22.-; AltName:... 33 2.3 A55054( A55054 ) calpain (EC 3.4.22.17) large...mRNA for calpain. 33 2.3 AF062404_1( AF062404 |pid:none) Drosophila melanogaster calpain mR... 33 2.3...melanogaster mRNA for Calpain. 33 2.3 BC042349_1( BC042349 |pid:none) Xenopus laevis calpain 8, mRNA (cD... 33

  3. MO-AB-204-04: Connectathons and Testing

    Energy Technology Data Exchange (ETDEWEB)

    Bosch, W. [Washington University (United States)

    2016-06-15

    You’ve experienced the frustration: vendor A’s device claims to work with vendor B’s device, but the practice doesn’t match the promise. Getting devices working together is the hidden art that Radiology and Radiation Oncology staff have to master. To assist with that difficult process, the Integrating the Healthcare Enterprise (IHE) effort was established in 1998, with the coordination of the Radiological Society of North America. Integrating the Healthcare Enterprise (IHE) is a consortium of healthcare professionals and industry partners focused on improving the way computer systems interconnect and exchange information. This is done by coordinating the use of published standards like DICOM and HL7. Several clinical and operational IHE domains exist in the healthcare arena, including Radiology and Radiation Oncology. The ASTRO-sponsored IHE Radiation Oncology (IHE-RO) domain focuses on radiation oncology specific information exchange. This session will explore the IHE Radiology and IHE RO process for; IHE solicitation process for new profiles. Improving the way computer systems interconnect and exchange information in the healthcare enterprise Supporting interconnectivity descriptions and proof of adherence by vendors Testing and assuring the vendor solutions to connectivity problems. Including IHE profiles in RFPs for future software and hardware purchases. Learning Objectives: Understand IHE role in improving interoperability in health care. Understand process of profile development and implantation. Understand how vendors prove adherence to IHE RO profiles. S. Hadley, ASTRO Supported Activity.

  4. MO-AB-204-02: IHE RAD [Health care

    Energy Technology Data Exchange (ETDEWEB)

    Seibert, J. [UC Davis Medical Center (United States)

    2016-06-15

    You’ve experienced the frustration: vendor A’s device claims to work with vendor B’s device, but the practice doesn’t match the promise. Getting devices working together is the hidden art that Radiology and Radiation Oncology staff have to master. To assist with that difficult process, the Integrating the Healthcare Enterprise (IHE) effort was established in 1998, with the coordination of the Radiological Society of North America. Integrating the Healthcare Enterprise (IHE) is a consortium of healthcare professionals and industry partners focused on improving the way computer systems interconnect and exchange information. This is done by coordinating the use of published standards like DICOM and HL7. Several clinical and operational IHE domains exist in the healthcare arena, including Radiology and Radiation Oncology. The ASTRO-sponsored IHE Radiation Oncology (IHE-RO) domain focuses on radiation oncology specific information exchange. This session will explore the IHE Radiology and IHE RO process for; IHE solicitation process for new profiles. Improving the way computer systems interconnect and exchange information in the healthcare enterprise Supporting interconnectivity descriptions and proof of adherence by vendors Testing and assuring the vendor solutions to connectivity problems. Including IHE profiles in RFPs for future software and hardware purchases. Learning Objectives: Understand IHE role in improving interoperability in health care. Understand process of profile development and implantation. Understand how vendors prove adherence to IHE RO profiles. S. Hadley, ASTRO Supported Activity.

  5. 5 CFR 362.204 - Development, evaluation, promotion, and certification.

    Science.gov (United States)

    2010-01-01

    ... one long-term developmental assignment of at least 9 months in duration during which time the Senior... developmental activities designed to impart the competencies of the occupation or functional discipline in which... will provide information on available training opportunities. (2) The appointing agency will provide...

  6. 32 CFR 204.3 - Policy and procedures.

    Science.gov (United States)

    2010-07-01

    ... customers. Fees for software packages are governed by DoD Instruction 7930.2. (ix) Pricing of performance by... appropriate courtesy to a foreign government or international organization, or comparable fees are set on a...

  7. Dicty_cDB: SHB204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available teavrrrpcsvvlfdevekahqqvwnvllqvldegrltd gqgrtvdfsnvviimtsnlgsqyilgeqankeggnnslsqackdkvidevrkhfrpefln rlddiiv...*lteavrrrpcsvvlfdevekahqqvwnvllqvldegrltd gqgrtvdfsnvviimtsnlgsqyilgeqankeggnnslsqackdkvidevrkhfrpefln rlddi

  8. 48 CFR 1652.204-74 - Large provider agreements.

    Science.gov (United States)

    2010-10-01

    ... insert the following clause in all FEHB Program contracts based on cost analysis (experience-rated...; (iv) Describe the methodology the carrier used to compute the provider's profit; and, (v) Describe provider risk provisions. (3) The Contracting officer may request from the carrier any additional...

  9. 204 Jyoti Prakash, Ajaib Singh and Savita Sharma

    Indian Academy of Sciences (India)

    . 1 1. ſ |D||*dz < ſ |wlºdz. () 0 so that using inequalities (18) and (21), we obtain from the above that. 1 - 1 i. ſ ***ſ |Dw?dz. (27). 0 Tº Jo. Further, multiplying equation (4) throughout by h; (the complex conjugate of h.), integrating each term of the ...

  10. Dicty_cDB: VFG204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |CF369697.1 rg55a11.y1 Meloidogyne hapla female SMART pGEM Meloidogyne hapla cDNA 5', mRNA sequence. 42...|CF369814.1 rg56e05.y1 Meloidogyne hapla female SMART pGEM Meloidogyne hapla cDNA 5', mRNA sequence. 42...|CF369841.1 rg56h02.y1 Meloidogyne hapla female SMART pGEM Meloidogyne hapla cDNA 5', mRNA sequence. 42...|CF370103.1 rg48b10.y1 Meloidogyne hapla female SMART pGEM Meloidogyne hapla cDNA 5', mRNA sequence. 42

  11. All projects related to | Page 204 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-12-21

    The rocketing growth in the number of people online and improvements in computer capacity are making it possible for governments and the private sector to collect and share information on every facet of people's lives. Start Date: December 21, 2012. End Date: August 5, 2015. Topic: DATA PROTECTION ...

  12. Weld solidification cracking in 304 to 204L stainless steel

    Energy Technology Data Exchange (ETDEWEB)

    Hochanadel, Patrick W [Los Alamos National Laboratory; Lienert, Thomas J [Los Alamos National Laboratory; Martinez, Jesse N [Los Alamos National Laboratory; Johnson, Matthew Q [Los Alamos National Laboratory

    2010-09-15

    A series of annulus welds were made between 304 and 304L stainless steel coaxial tubes using both pulsed laser beam welding (LBW) and pulsed gas tungsten arc welding (GTAW). In this application, a change in process from pulsed LBW to pulsed gas tungsten arc welding was proposed to limit the possibility of weld solidification cracking since weldability diagrams developed for GTAW display a greater range of compositions that are not crack susceptible relative to those developed for pulsed LBW. Contrary to the predictions of the GTAW weldability diagram, cracking was found.This result was rationalized in terms of the more rapid solidification rate of the pulsed gas tungsten arc welds. In addition, for the pulsed LBW conditions, the material compositions were predicted to be, by themselves, 'weldable' according to the pulsed LBW weldability diagram. However, the composition range along the tie line connecting the two compositions passed through the crack susceptible range. Microstructurally, the primary solidification mode (PSM) of the material processed with higher power LBW was determined to be austenite (A), while solidification mode of the materials processed with lower power LBW apparently exhibited a dual PSM of both austenite (A) and ferrite-austenite (FA) within the same weld. The materials processed by pulsed GTAW showed mostly primary austenite solidification, with some regions of either primary austenite-second phase ferrite (AF) solidification or primary ferrite-second phase austenite (FA) solidification. This work demonstrates that variations in crack susceptibility may be realized when welding different heats of 'weldable' materials together, and that slight variations in processing can also contribute to crack susceptibility.

  13. 48 CFR 2152.204-70 - Taxpayer Identification Number.

    Science.gov (United States)

    2010-10-01

    ... verify its accuracy. (d) Taxpayer Identification Number (TIN). TIN: (e) Type of organization. □ Corporate... reporting income tax and other returns. The TIN is the Contractor's Social Security Number. (b) The...

  14. 14 CFR 1274.204 - Costs and payments.

    Science.gov (United States)

    2010-01-01

    ... variety of factors. For example, while the future profitability of intellectual property may serve as an... of such items as patent rights, data rights, trade secrets, etc., included in intellectual property...) In most cases these costs are not readily quantifiable. Thus, although the value of intellectual...

  15. 27 CFR 24.204 - Other agricultural products.

    Science.gov (United States)

    2010-04-01

    ..., or liquid sugar, or invert sugar syrup is used. Additional pure dry sugar may be used for sweetening..., water and sugar may be added to the extent necessary to facilitate fermentation; Provided, That the total weight of pure dry sugar used for fermentation is less than the weight of the primary winemaking...

  16. 17 CFR 204.65 - Wage garnishment order.

    Science.gov (United States)

    2010-04-01

    ... withholding order, the Commission will send, by first class mail, a withholding order to the debtor's employer... order. This information includes the debtor's name, address, and social security number, as well as... certification will address matters such as information about the debtor's employment status and disposable pay...

  17. 15 CFR 904.204 - Duties and powers of Judge.

    Science.gov (United States)

    2010-01-01

    ...) NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE GENERAL REGULATIONS CIVIL... public scrutiny to protect privileged information, trade secrets, and confidential commercial or... during the proceeding to state his or her position concerning any issue or his or her theory in support...

  18. 5 CFR 841.204 - Deemed application to protect survivors.

    Science.gov (United States)

    2010-01-01

    ... though the commencing date were the first day of the month after the former employee's death. ... subject to FERS under subpart A of part 842 of this chapter on the date of death; (2) Dies after...

  19. Dicty_cDB: VHI204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available enia flabellata voucher GWS002... 81 1e-14 EF033564_1( EF033564 |pid:none) Pachymenia carnosa voucher GWS000..... 80 2e-14 EF033551_1( EF033551 |pid:none) Dilsea carnosa voucher GWS000746 e... 80 2e-14 protein update 20

  20. 1935 15' Quad #204 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  1. 18 CFR 1304.204 - Docks, piers, and boathouses.

    Science.gov (United States)

    2010-04-01

    ... pool. (e) All docks, piers, and other water-use facilities must be attached to the shore with a single walkway which must connect from land to the structure by the most direct route and must adjoin the access... shall not exceed six feet in width. (l) Enclosed space shall be used solely for storage of water-use...

  2. 40 CFR 204.55-3 - Configuration identification.

    Science.gov (United States)

    2010-07-01

    ... the following parameters: (1) The compressor type (screw, sliding vane, etc.). (2) Number of...; (ii) Type of filters. (5) The engine system: (i) Number of cylinders and configuration (L-6, V-8, V-12... (engine): (i) Natural; (ii) Turbocharged. (10) The muffler: (i) Manufacturer; (ii) Manufacturer part...

  3. 28 CFR 2.204 - Conditions of supervised release.

    Science.gov (United States)

    2010-07-01

    ... and are necessary to protect the public from further crimes by the releasee and to provide adequate... releasee's residence, workplace, or vehicle. (v) The releasee shall submit to a drug or alcohol test... schedule. (iii) If the term of supervision results from a conviction for a domestic violence crime, and...

  4. Dicty_cDB: SLD204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dehydrogenase; EC=1.1.1.3... 98 1e-19 (Q7VW97) RecName: Full=Malate dehydrogenase; EC=1.1.1.3... 97 2e-19...dehydrogenase; EC=1.1.1.3... 94 1e-18 (A1K5Q9) RecName: Full=Malate dehydrogenase; EC=1.1.1.37; 94 1e-18 (Q2L068)...dehydrogenase; EC=1.1.1.3... 93 3e-18 (A9BVK0) RecName: Full=Malate dehydrogenase; EC=1.1.1.3... 93 3e-18...(A1W9K7) RecName: Full=Malate dehydrogenase; EC=1.1.1.37; 92 6e-18 CP000539_2676( CP000539 |pid:none)

  5. Dicty_cDB: CHM204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 length of database: 80,480,566 effective HSP length: 17 effective length of query: 123 effective length of database: 78,821,179 eff...ective search space: 9695005017 effective search space u...ences better than 10.0: 0 length of query: 140 length of database: _,673,055,985 effective HSP length: 21 effective... length of query: 119 effective length of database: ^,756,834,679 effective search space: 5564063326801 effective

  6. 40 CFR 6.204 - Categorical exclusions and extraordinary circumstances.

    Science.gov (United States)

    2010-07-01

    ... advice to federal agencies, state or local governments, federally-recognized Indian tribes, foreign... GENERAL PROCEDURES FOR IMPLEMENTING THE NATIONAL ENVIRONMENTAL POLICY ACT AND ASSESSING THE ENVIRONMENTAL... practices and adheres to all applicable federal, state, local, and federally-recognized Indian tribal laws...

  7. Dicty_cDB: VHC204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lis mRNA for huntin... 72 4e-11 ( P51112 ) RecName: Full=Huntingtin; AltName: Full=Huntington... dise... 72 6e-11 L28827_1( L28827 |pid:none) Mouse Huntington's Disease gene homolo... 71 9e-11... ( P42859 ) RecName: Full=Huntingtin; AltName: Full=Huntington dise... 71 9e-11 AX460946_1( AX460946 |pid:no

  8. Dicty_cDB: SSI204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1997.12.25 Translated Amino Acid sequence itn*nkiny*i*k*nyy*fyylff*hfqywynlkkpill*kpiktmilfsn*LIQKKIQK ARDIL...iny*i*k*nyy*fyylff*hfqywynlkkpill*kpiktmilfsn*LIQKKIQK ARDILSGKETEEVHVMGRIRKSNKDYNPKYSFHIDPDTVTFFSMAIEVCDATA

  9. 48 CFR 52.204-7 - Central Contractor Registration.

    Science.gov (United States)

    2010-10-01

    ... conduct of business with the Government. Data Universal Numbering System (DUNS) number means the 9-digit number assigned by Dun and Bradstreet, Inc. (D&B) to identify unique business entities. Data Universal... located within the United States; or (ii) If located outside the United States, by contacting the local...

  10. 48 CFR 52.204-3 - Taxpayer identification.

    Science.gov (United States)

    2010-10-01

    ... conduct of a trade or business in the United States and does not have an office or place of business or a fiscal paying agent in the United States; □ Offeror is an agency or instrumentality of a foreign... a consolidated basis, and of which the offeror is a member. Taxpayer Identification Number (TIN), as...

  11. Zvaigžņotā Debess: 2009, Vasara (204)

    OpenAIRE

    Alksne, Zenta; Latvijas Universitāte. Astronomijas institūts; Latvijas Zinātņu akadēmija

    2009-01-01

    Contents: E.Conners. The Trojan Asteroids ; V.Šmēlings. Men on the Moon! ; E.Bervalds. Astronomical Domes and “Sauna” ; Z.Alksne, A.Alksnis. Sakurai’s Object Fails to Escape Own Dust ; Z.Alksne, A.Alksnis. R CrB Stars Surrounded by Dust Clouds ; M.Gills. April Started with Astronomy ; A.Alksnis. First Stamps Dedicated to Astronomy by Latvia’s Post-Office ; I.Pundure. Arturs Balklavs and Astronomy of Latvia (till 1969) ; M.Sudārs. Satellite Collisions – What Threat Do They Pose? ; I.Vilks. Dw...

  12. 29 CFR 1603.204 - Ex parte communications.

    Science.gov (United States)

    2010-07-01

    ... EXEMPT STATE AND LOCAL GOVERNMENT EMPLOYEE COMPLAINTS OF EMPLOYMENT DISCRIMINATION UNDER SECTION 304 OF... decision-making personnel of the Commission and an interested party to the adjudication without providing the other party a chance to participate are prohibited from the time the matter is assigned to an...

  13. 48 CFR 803.204 - Treatment of violations.

    Science.gov (United States)

    2010-10-01

    ... factors, such as those listed at FAR 9.406-1 and 809.406-1, prior to making a final decision. ... IMPROPER BUSINESS PRACTICES AND PERSONAL CONFLICTS OF INTEREST Contractor Gratuities to Government... process, by certified mail, return receipt requested, or any other method that provides signed evidence of...

  14. TU-AB-204-01: Device Approval Process

    Energy Technology Data Exchange (ETDEWEB)

    Delfino, J. [Food & Drug Administration (United States)

    2016-06-15

    The responsibilities of the Food and Drug Administration (FDA) have increased since the inception of the Food and Drugs Act in 1906. Medical devices first came under comprehensive regulation with the passage of the 1938 Food, Drug, and Cosmetic Act. In 1971 FDA also took on the responsibility for consumer protection against unnecessary exposure to radiation-emitting devices for home and occupational use. However it was not until 1976, under the Medical Device Regulation Act, that the FDA was responsible for the safety and effectiveness of medical devices. This session will be presented by the Division of Radiological Health (DRH) and the Division of Imaging, Diagnostics, and Software Reliability (DIDSR) from the Center for Devices and Radiological Health (CDRH) at the FDA. The symposium will discuss on how we protect and promote public health with a focus on medical physics applications organized into four areas: pre-market device review, post-market surveillance, device compliance, current regulatory research efforts and partnerships with other organizations. The pre-market session will summarize the pathways FDA uses to regulate the investigational use and commercialization of diagnostic imaging and radiation therapy medical devices in the US, highlighting resources available to assist investigators and manufacturers. The post-market session will explain the post-market surveillance and compliance activities FDA performs to monitor the safety and effectiveness of devices on the market. The third session will describe research efforts that support the regulatory mission of the Agency. An overview of our regulatory research portfolio to advance our understanding of medical physics and imaging technologies and approaches to their evaluation will be discussed. Lastly, mechanisms that FDA uses to seek public input and promote collaborations with professional, government, and international organizations, such as AAPM, International Electrotechnical Commission (IEC), Image Gently, and the Quantitative Imaging Biomarkers Alliance (QIBA) among others, to fulfill FDA’s mission will be discussed. Learning Objectives: Understand FDA’s pre-market and post-market review processes for medical devices Understand FDA’s current regulatory research activities in the areas of medical physics and imaging products Understand how being involved with AAPM and other organizations can also help to promote innovative, safe and effective medical devices J. Delfino, nothing to disclose.

  15. 48 CFR 511.204 - Solicitation provisions and contract clauses.

    Science.gov (United States)

    2010-10-01

    ... contracting officer shall include the clause 552.211-92, Radio Frequency Identification (RFID) using Passive... contracting officer shall include the clause 552.211-93, Unique Item Identification (UID), in solicitations...

  16. 48 CFR 204.805 - Disposal of contract files.

    Science.gov (United States)

    2010-10-01

    ... eligible for destruction. If no space is available locally, transfer the files to the General Services... soon as practicable once they are no longer needed. (5) Retain pricing review files, containing documents related to reviews of the contractor's price proposals, subject to cost or pricing data (see FAR...

  17. 8 CFR 204.6 - Petitions for employment creation aliens.

    Science.gov (United States)

    2010-01-01

    ... 35 working hours per week. In the case of the Immigrant Investor Pilot Program, “full-time employment... working hours per week. A job-sharing arrangement whereby two or more qualifying employees share a full... purchase costs, date of purchase, and purchasing entity; (iii) Evidence of property transferred from abroad...

  18. 20 CFR 204.5 - Employment relation-deemed service.

    Science.gov (United States)

    2010-04-01

    ... relation exists with respect to any month in which an individual, although not in the active service of an employer, is on furlough subject to recall by an employer, is on a bona fide leave of absence, has not been... in active service because of a discharge later determined to be wrongful. However, an employment...

  19. 38 CFR 3.204 - Evidence of dependents and age.

    Science.gov (United States)

    2010-07-01

    .... (Authority: 38 U.S.C. 501) (The Office of Management and Budget has approved the information collection... dependent, provided that the statement contains: the date (month and year) and place of the event; the full... addition, a claimant must provide the social security number of any dependent on whose behalf he or she is...

  20. 45 CFR 204.2 - State plans-format.

    Science.gov (United States)

    2010-10-01

    ... proper preparation of plans and submittal in accordance with the requirements for State Governors' review... Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION-STATE...

  1. 8 CFR 204.311 - Convention adoption home study requirements.

    Science.gov (United States)

    2010-01-01

    ... of sexual abuse, child abuse, or family violence is sufficient to constitute a “history” of abuse and... United States or abroad, of substance abuse, sexual abuse, or child abuse, or family violence, even if... each arrest or conviction or history of substance abuse, sexual abuse or child abuse, and/or family...

  2. 48 CFR 204.7202-1 - CAGE codes.

    Science.gov (United States)

    2010-10-01

    ... CD ROM that contains the H-4/H-8 CAGE master file issued by DLIS (Their address is: Customer Service... assignments to DLIS Customer Service: toll-free (888) 227-2423 or (888) 352-9333; DSN 932-4725; or commercial....39-M, Federal Logistics Information System (FLIS) Procedures Manual, prescribe use of CAGE codes. (b...

  3. Southern Forests: a Journal of Forest Science - Vol 204 (2005)

    African Journals Online (AJOL)

    Prescribed under-canopy burning in Pinus patula plantations of the Mpumalanga highveld: The effects of fire on tree growth · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Theresa L Bird, Mary C Scholes, 1-2 ...

  4. Dicty_cDB: CHE204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ---XXXXXXXXLGLLXXPRFXICFVMDXTLMFKVTTYRTINGKERTKIKHNVKALEVIWK HQHLGKFFSMKNTLHVDDLSKNFAMNPKNGVH Translated Amino...---XXXXXXXXLGLLXXPRFXICFVMDXTLMFKVTTYRTINGKERTKIKHNVKALEVIWK HQHLGKFFSMKNTLHVDDLSKNFAMNPKNGVH Frame B: ---

  5. 24 CFR 3280.204 - Kitchen cabinet protection.

    Science.gov (United States)

    2010-04-01

    ... framing members and trim are exempted from this requirement. The cabinet area over the cooking range or cooktops shall be protected by a metal hood (26-gauge sheet metal, or .017 stainless steel, or .024...

  6. 40 CFR 243.204-2 - Recommended procedures: Operations.

    Science.gov (United States)

    2010-07-01

    ... achieve the most efficient compaction. (3) Compactor trucks should be used to reduce the number of trips... commercial wastes which do not contain food wastes, storage capacity should be increased in lieu of more...

  7. 41 CFR 50-204.3 - Material handling and storage.

    Science.gov (United States)

    2010-07-01

    ... provided on spur railroad tracks where a rolling car could contact other cars being worked, enter a building, work or traffic area. (g) Covers and/or guard rails shall be provided to protect personnel from...

  8. 42 CFR 37.204 - Procedure for obtaining payment.

    Science.gov (United States)

    2010-10-01

    ...) The information, slides, and blocks of tissue required by this subpart. (2) Clinical abstract of... said deceased. I understand that the report and certain tissues as necessary will be released to the... Deceased ______. (Month, Day, Year) 2. Social Security Number of Deceased 3. Date and Place of Death...

  9. Dicty_cDB: SSD204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dcgirwtnififsiciliqryhlfiwt vfspkyiyevldvtlvliksillaafiiylrllsfvkekqvennslassqninxee*kkn kkn Frame C:...vv*lvfvlv*fvwvgwvnlvish lviqil*qvlifpvvill*siiisillafkpc*lvillncssfsflwlmlpiwlsnplai viinknphyyhhleq

  10. Growth of Enterococcus durans E204 producing bacteriocin-like ...

    African Journals Online (AJOL)

    In the other hand, the quantification of the antimicrobial activity was carried out by a photometric assay on culture tubes based on the determination of the ID50 dose causing 50% growth inhibition of Enterococcus faecium 410 CECT in 6 h of incubation. The highest bacteriocin-like titre (279.71 BUml-1) was obtained at ...

  11. 40 CFR 94.204 - Designation of engine families.

    Science.gov (United States)

    2010-07-01

    ...) Combustion chamber design; (6) Bore; (7) Stroke; (8) Number of cylinders, (engines with aftertreatment..., supercharged, naturally aspirated, Roots blown); (11) The turbocharger or supercharger general performance...

  12. 5 CFR 337.204 - Severe shortage of candidates.

    Science.gov (United States)

    2010-01-01

    ... information such as selective placement factors or other special requirements of the position, as well as... geographic locations. OPM may decide independently that such a shortage exists, or may make this decision in...

  13. 48 CFR 2052.204-71 - Site access badge requirements.

    Science.gov (United States)

    2010-10-01

    ... contractor to ensure that each employee has proper identification at all times. All prescribed identification... termination of employment of any contractor personnel. Contractor personnel shall have this identification in... that contractor personnel enter only those work areas necessary for performance of contract work and to...

  14. NASA SBIR Subtopic S2.04 Advanced Optical Components

    Science.gov (United States)

    2010-01-01

    require: 2 to 3 to 8 meter class mirrors with cryo-deformations < 100 nm rms. X-ray telescopes (such as IXO or GenX ) require: 1 to 2 meter long grazing...as SAFIR/CALISTO) require 2 to 3 to 8 meter class mirrors with cryo- deformations < 100 nm rms. X-ray telescopes (such as IXO and GenX ) require 1 to 2

  15. 41 CFR 105-54.204 - Advisory committee membership.

    Science.gov (United States)

    2010-07-01

    ... agencies. The HSSO or Regional Administrator submits nominations and letters of designation for the... Civil Rights for review and forwarding to the Administrator. (b) Discrimination is prohibited on the basis of race, color, age, national origin, religion, sex, or mental and physical handicap in selecting...

  16. 5 CFR 847.204 - Elections of FERS coverage.

    Science.gov (United States)

    2010-01-01

    ...) from an FERS-covered position to an NAFI may elect to continue FERS coverage. (b) An employee who elects FERS coverage under this section will be covered by FERS during all periods of future service not...

  17. Dicty_cDB: AFL204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available significant alignments: (bits) Value N CF443885 |CF443885.1 EST680230 normalized cDNA library of onion...6 normalized cDNA library of onion Allium cepa cDNA clone ACAAY36, mRNA sequence. 60 6e-15 3 BG226984 |BG226...NSFERASE ;, mRNA sequence. 48 2e-12 3 CF450348 |CF450348.1 EST686693 normalized cDNA library of onion Allium

  18. Dicty_cDB: SFH204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e) Dictyostelium discoideum heat-shoc... 401 0.0 EU679414_1( EU679414 |pid:none) Tetranychus cinnabarinus he...200803... 360 e-169 EU679412_1( EU679412 |pid:none) Tetranychus cinnabarinus heat shoc... 366 e-168 AJ783714

  19. 48 CFR 952.204-73 - Facility clearance.

    Science.gov (United States)

    2010-10-01

    ... changes in the extent and nature of FOCI which could affect the offeror's answers to the questions in... offeror's answers to the questions in Standard Form 328. Notice of changes in ownership or control which... of the company's articles of incorporation and an attested copy of the company's by-laws, or similar...

  20. Dicty_cDB: VSE204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available APF GIKVVLLSPSGFKTNFVNDNMESAKVRIEGYKTDDLAKWLDGIVNEARGDPDKFADAVIA VSKMDEVPKNLFLGTAAVNWMEGEFKKQIDELKLN...APF GIKVVLLSPSGFKTNFVNDNMESAKVRIEGYKTDDLAKWLDGIVNEARGDPDKFADAVIA VSKMDEVPKNLFLGTAAVNWMEGEFKKQIDELKLN

  1. 48 CFR 52.204-4 - Printed or Copied Double-Sided on Recycled Paper.

    Science.gov (United States)

    2010-10-01

    ... Government through Waste Prevention, Recycling, and Federal Acquisition, the Contractor is encouraged to... Contractor cannot purchase high-speed copier paper, offset paper, forms bond, computer printout paper...

  2. 75 FR 59102 - Defense Federal Acquisition Regulation Supplement; Part 204, Administrative Matters

    Science.gov (United States)

    2010-09-27

    ... indexing methodology across DoD. This technical amendment adds language to the Defense Federal Acquisition... technical amendment also provides the location of guidance on a uniform contract indexing methodology across... Policy letter dated July 8, 2010, subject: Contract Indexing Standard, provides detailed guidance on...

  3. Calibration of ground-based lidar instrument WLS7-204

    DEFF Research Database (Denmark)

    Gómez Arranz, Paula; Courtney, Michael

    This report presents the result of the lidar calibration performed for the given WLS7 Windcube at DTU’s test site for large wind turbine at Høvsøre, Denmark. Calibration is here understood as the establishment of a relation between the reference wind speed measurements with measurement uncertaint......This report presents the result of the lidar calibration performed for the given WLS7 Windcube at DTU’s test site for large wind turbine at Høvsøre, Denmark. Calibration is here understood as the establishment of a relation between the reference wind speed measurements with measurement...... uncertainties provided by measurement standard and corresponding lidar wind speed indications with associated measurement uncertainties. The lidar calibration concerns the 10 minute mean wind speed measurements. The comparison of the lidar measurements of the wind direction with that from wind vanes...

  4. MO-DE-204-04: Dose Optimization in CT: Trends and Motivation in the US

    Energy Technology Data Exchange (ETDEWEB)

    Kofler, J. [Mayo Clinic (United States)

    2016-06-15

    The main topic of the session is to show how dose optimization is being implemented in various regions of the world, including Europe, Australia, North America and other regions. A multi-national study conducted under International Atomic Energy Agency (IAEA) across more than 50 less resourced countries gave insight into patient radiation doses and safety practices in CT, mammography, radiography and interventional procedures, both for children and adults. An important outcome was the capability development on dose assessment and management. An overview of recent European projects related to CT radiation dose and optimization both to adults and children will be presented. Existing data on DRLs together with a European methodology proposed on establishing and using DRLs for paediatric radiodiagnostic imaging and interventional radiology practices will be shown. Compared with much of Europe at least, many Australian imaging practices are relatively new to the task of diagnostic imaging dose optimisation. In 2008 the Australian Government prescribed a requirement to periodically compare patient radiation doses with diagnostic reference levels (DRLs), where DRLs have been established. Until recently, Australia had only established DRLs for computed tomography (CT). Regardless, both professional society and individual efforts to improved data collection and develop optimisation strategies across a range of modalities continues. Progress in this field, principally with respect to CT and interventional fluoroscopy will be presented. In the US, dose reduction and optimization efforts for computed tomography have been promoted and mandated by several organizations and accrediting entities. This presentation will cover the general motivation, implementation, and implications of such efforts. Learning Objectives: Understand importance of the dose optimization in Diagnostic Radiology. See how this goal is achieved in different regions of the World. Learn about the global trend in the dose optimization and future prospectives. M. Rehani, The work was a part of the work of IAEA where I was an employee and IAEA is a United Nations organization.

  5. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (204b-0613-332211)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  6. MO-AB-204-01: IHE RO Overview [Health Care

    Energy Technology Data Exchange (ETDEWEB)

    Hadley, S. [The University of Michigan (United States)

    2016-06-15

    You’ve experienced the frustration: vendor A’s device claims to work with vendor B’s device, but the practice doesn’t match the promise. Getting devices working together is the hidden art that Radiology and Radiation Oncology staff have to master. To assist with that difficult process, the Integrating the Healthcare Enterprise (IHE) effort was established in 1998, with the coordination of the Radiological Society of North America. Integrating the Healthcare Enterprise (IHE) is a consortium of healthcare professionals and industry partners focused on improving the way computer systems interconnect and exchange information. This is done by coordinating the use of published standards like DICOM and HL7. Several clinical and operational IHE domains exist in the healthcare arena, including Radiology and Radiation Oncology. The ASTRO-sponsored IHE Radiation Oncology (IHE-RO) domain focuses on radiation oncology specific information exchange. This session will explore the IHE Radiology and IHE RO process for; IHE solicitation process for new profiles. Improving the way computer systems interconnect and exchange information in the healthcare enterprise Supporting interconnectivity descriptions and proof of adherence by vendors Testing and assuring the vendor solutions to connectivity problems. Including IHE profiles in RFPs for future software and hardware purchases. Learning Objectives: Understand IHE role in improving interoperability in health care. Understand process of profile development and implantation. Understand how vendors prove adherence to IHE RO profiles. S. Hadley, ASTRO Supported Activity.

  7. MO-AB-204-00: Interoperability in Radiation Oncology: IHE-RO Committee Update

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2016-06-15

    You’ve experienced the frustration: vendor A’s device claims to work with vendor B’s device, but the practice doesn’t match the promise. Getting devices working together is the hidden art that Radiology and Radiation Oncology staff have to master. To assist with that difficult process, the Integrating the Healthcare Enterprise (IHE) effort was established in 1998, with the coordination of the Radiological Society of North America. Integrating the Healthcare Enterprise (IHE) is a consortium of healthcare professionals and industry partners focused on improving the way computer systems interconnect and exchange information. This is done by coordinating the use of published standards like DICOM and HL7. Several clinical and operational IHE domains exist in the healthcare arena, including Radiology and Radiation Oncology. The ASTRO-sponsored IHE Radiation Oncology (IHE-RO) domain focuses on radiation oncology specific information exchange. This session will explore the IHE Radiology and IHE RO process for; IHE solicitation process for new profiles. Improving the way computer systems interconnect and exchange information in the healthcare enterprise Supporting interconnectivity descriptions and proof of adherence by vendors Testing and assuring the vendor solutions to connectivity problems. Including IHE profiles in RFPs for future software and hardware purchases. Learning Objectives: Understand IHE role in improving interoperability in health care. Understand process of profile development and implantation. Understand how vendors prove adherence to IHE RO profiles. S. Hadley, ASTRO Supported Activity.

  8. MO-AB-204-03: Profile Development and IHE Process

    Energy Technology Data Exchange (ETDEWEB)

    Pauer, C. [Sun Nuclear, Melbourne, FL (United States)

    2016-06-15

    You’ve experienced the frustration: vendor A’s device claims to work with vendor B’s device, but the practice doesn’t match the promise. Getting devices working together is the hidden art that Radiology and Radiation Oncology staff have to master. To assist with that difficult process, the Integrating the Healthcare Enterprise (IHE) effort was established in 1998, with the coordination of the Radiological Society of North America. Integrating the Healthcare Enterprise (IHE) is a consortium of healthcare professionals and industry partners focused on improving the way computer systems interconnect and exchange information. This is done by coordinating the use of published standards like DICOM and HL7. Several clinical and operational IHE domains exist in the healthcare arena, including Radiology and Radiation Oncology. The ASTRO-sponsored IHE Radiation Oncology (IHE-RO) domain focuses on radiation oncology specific information exchange. This session will explore the IHE Radiology and IHE RO process for; IHE solicitation process for new profiles. Improving the way computer systems interconnect and exchange information in the healthcare enterprise Supporting interconnectivity descriptions and proof of adherence by vendors Testing and assuring the vendor solutions to connectivity problems. Including IHE profiles in RFPs for future software and hardware purchases. Learning Objectives: Understand IHE role in improving interoperability in health care. Understand process of profile development and implantation. Understand how vendors prove adherence to IHE RO profiles. S. Hadley, ASTRO Supported Activity.

  9. 40 CFR 421.204 - Standards of performance for new sources.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Standards of performance for new... average mg/kg (pounds per million pounds) of mercury produced from batteries Lead 0.030 0.014 Mercury 0.016 0.006 Total suspended solids 1.590 1.272 pH (1) (1) 1 Within the range of 7.5 to 10.0 at all times...

  10. 14 CFR 204.3 - Applicants for new certificate or commuter air carrier authority.

    Science.gov (United States)

    2010-01-01

    ... qualifications, and any affiliation he or she has with the applicant. (l) A list of all actions and outstanding... description of the applicant's fleet of aircraft, including: (1) The number of each type of aircraft owned... or lease of additional aircraft; and (3) A sworn affidavit stating that each aircraft owned or leased...

  11. 49 CFR 236.204 - Track signaled for movements in both directions, requirements.

    Science.gov (United States)

    2010-10-01

    ...) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RULES, STANDARDS, AND INSTRUCTIONS GOVERNING... opposing signals immediately ahead of it to display the most restrictive aspect, the indication of which... signal in advance of each such signal then displays an aspect requiring a stop, or its most restrictive...

  12. 48 CFR 52.204-11 - American Recovery and Reinvestment Act-Reporting Requirements.

    Science.gov (United States)

    2010-10-01

    ... description of the types of jobs created and jobs retained in the United States and outlying areas (see definition in FAR 2.101). This description may rely on job titles, broader labor categories, or the... subcontractor shall provide— (A) A brief description of the types of jobs created and jobs retained in the...

  13. 14 CFR 204.4 - Carriers proposing to provide essential air service.

    Science.gov (United States)

    2010-01-01

    ..., if applicable, in the subject market(s). (5) A list of the markets the carrier serves and the number... each type of aircraft is currently flown per day. (7) An estimate of the impact the proposed essential... costs and revenues are allocated. (4) A traffic forecast including a load factor analysis on all...

  14. Observando Nuestro Entorno Local: Exploraciones Escolares. Pág. 191-204

    Directory of Open Access Journals (Sweden)

    César Piñones Cañete

    2013-03-01

    Full Text Available El presente trabajo es una síntesis de dos procesos de indagación naturalista, desarrollados con jóvenes de enseñanza secundaria, en el marco del currículum de estudio de la asignatura de biología definidos para Chile. Se diseñó e implementó un conjunto de actividades que propiciaron la participación activa de los estudiantes, siendo ellos protagonistas de sus propios aprendizajes, por medio de la exploración de los espacios naturales cercanos a sus colegios. Se busca con este escrito: a describir las características del programa científico escolar ejecutado, b documentar las acciones de indagación desarrolladas por los estudiantes y c sintetizar los principales resultados pedagógicos de las experiencias

  15. Early Proterozoic (2.04 GA) Phoshorites of Pechenga Greenstone Belt and Their Origin

    Science.gov (United States)

    Rozanov, Alexei Yu.; Astafieva, Marina M.; Hoover, Richard B.

    2007-01-01

    No principal differences have been found between microfossils described from Cambrian and Phanerozoic and the 2000 Ma phosphorites. Numerous samples revealed diverse microbial microstructures interpreted as cyanobacterial mats consisting of filamentous (1-3 microns in diameter, 20 microns in length), coccoidal (0.8-1.0 microns) and ellipsoidal or rod-shaped microfossils (0.8 microns in diameter, around 2 microns in length) which morphologically resemble modern Microcoleus and Siphonophycus, Thiocapsa, and Rhabdoderma, respectively, reported from alkali ne or saline environment_ The sequence of the early Palaeoproterozoic events which point to a significant oxidation of the hydrosphere, including the formation of phosphorites and changes in the phosphorous cycle, mimics the sequence which was repeated at the Neoproterozoic-Cembrian transition, implying that oxidation of the terrestrial atmosphere-hydrosphere system experienced an irregular cyclic development.

  16. Subjective and objective outcome in congenital clubfoot; a comparative study of 204 children

    Directory of Open Access Journals (Sweden)

    Barker Simon

    2007-06-01

    Full Text Available Abstract Background Outcome following management of congenital talipes equinovarus (clubfoot can be assessed in a number of ways. Bjonness stated simply that "the patient is the final judge of whether he has a good foot"; a purely subjective assessment. Others have employed objective measures. Combining subjective evaluation with a more objective assessment of movement and position of the foot, is likely to give a more comprehensive picture of the final result of clubfoot. The purpose of this study was to compare subjective and objective outcome following management of clubfoot, and evaluate sex differences in outcome. Methods We used a patient-administered subjective assessment of outcome following treatment of clubfoot and compared it with objective anthropometry and range of movement of the ankle to assess and compare subjective and objective outcome in clubfoot. Statistical analysis was performed using Pearson correlation coefficients. Significance was tested using Student's t-test test. Results Objective outcome can be assessed using length of the foot, calf circumference and range of movement at the ankle. These are easy to measure, reproducible, and correlate well with subjective outcome. Objective outcome is comparable for boys and girls. However, subjectively, female patients and their parents are less happy with the results of management of clubfoot. Conclusion There is a correlation between the anthropometric measures and the subjective outcome and an objective grading can be designed using foot length, calf muscle bulk and range of movement at the ankle.

  17. Subjective and objective outcome in congenital clubfoot; a comparative study of 204 children

    Science.gov (United States)

    Chesney, David; Barker, Simon; Maffulli, Nicola

    2007-01-01

    Background Outcome following management of congenital talipes equinovarus (clubfoot) can be assessed in a number of ways. Bjonness stated simply that "the patient is the final judge of whether he has a good foot"; a purely subjective assessment. Others have employed objective measures. Combining subjective evaluation with a more objective assessment of movement and position of the foot, is likely to give a more comprehensive picture of the final result of clubfoot. The purpose of this study was to compare subjective and objective outcome following management of clubfoot, and evaluate sex differences in outcome. Methods We used a patient-administered subjective assessment of outcome following treatment of clubfoot and compared it with objective anthropometry and range of movement of the ankle to assess and compare subjective and objective outcome in clubfoot. Statistical analysis was performed using Pearson correlation coefficients. Significance was tested using Student's t-test test. Results Objective outcome can be assessed using length of the foot, calf circumference and range of movement at the ankle. These are easy to measure, reproducible, and correlate well with subjective outcome. Objective outcome is comparable for boys and girls. However, subjectively, female patients and their parents are less happy with the results of management of clubfoot. Conclusion There is a correlation between the anthropometric measures and the subjective outcome and an objective grading can be designed using foot length, calf muscle bulk and range of movement at the ankle. PMID:17598880

  18. 204 The Crisis of Identity and the Quest for Development in Africa ...

    African Journals Online (AJOL)

    Ike Odimegwu

    development. However, does it mean that when a society is an industrial giant, economically viable and technologically ..... a moment when the outcome of our revolution was almost in doubt, the father of our nation ..... Achebe, Chinua The Trouble with Nigeria Enugu: Fourth. Dimension Publishers Ltd., 1985. Agbo, Joseph ...

  19. Working Paper 204 - Skills and Youth Entrepreneurship in Africa: Analysis with Evidence from Swaziland

    OpenAIRE

    Zuzana Brixiova; Mthuli Ncube

    2014-01-01

    The shortages of entrepreneurial skillshave lowered search effectiveness of potential young entrepreneurs and the rate of youth start-ups. Our paper contributes to closing a gap in the entrepreneurship and development literature with a model of costly firm creation and skill differences between young and adult entrepreneurs. The model shows that for young entrepreneurs facing high cost of searching for business opportunities, support for training is more effective in stimulating productive st...

  20. 48 CFR 28.204-3 - Irrevocable letter of credit (ILC).

    Science.gov (United States)

    2010-10-01

    ... contracting officer shall use the sight draft set forth in the clause at 52.228-14, and present it with the... any warranty period; or (C) For payment bonds only, until resolution of all claims filed against the... 52.228-14. (h)(1) Additional information on credit rating services and investment grade ratings is...

  1. 37 CFR 204.5 - Procedures for requesting access to records.

    Science.gov (United States)

    2010-07-01

    ... a written request, signed by themselves or their duly authorized agent, to that effect either by... any working day except legal holidays at Room LM-401, The James Madison Memorial Building, 1st and... working days of receipt; and will notify the requester within 30 working days of receipt when and where...

  2. MO-FG-204-04: How Iterative Reconstruction Algorithms Affect the NPS of CT Images

    Energy Technology Data Exchange (ETDEWEB)

    Li, G; Liu, X; Dodge, C; Jensen, C; Rong, J [UT MD Anderson Cancer Center, Houston, TX (United States)

    2015-06-15

    Purpose: To evaluate how the third generation model based iterative reconstruction (MBIR) compares with filtered back-projection (FBP), adaptive statistical iterative reconstruction (ASiR), and the second generation MBIR based on noise power spectrum (NPS) analysis over a wide range of clinically applicable dose levels. Methods: The Catphan 600 CTP515 module, surrounded by an oval, fat-equivalent ring to mimic patient size/shape, was scanned on a GE HD750 CT scanner at 1, 2, 3, 6, 12 and 19mGy CTDIvol levels with typical patient scan parameters: 120kVp, 0.8s, 40mm beam width, large SFOV, 0.984 pitch and reconstructed thickness 2.5mm (VEO3.0: Abd/Pelvis with Texture and NR05). At each CTDIvol level, 10 repeated scans were acquired for achieving sufficient data sampling. The images were reconstructed using Standard kernel with FBP; 20%, 40% and 70% ASiR; and two versions of MBIR (VEO2.0 and 3.0). For evaluating the effect of the ROI spatial location to the Result of NPS, 4 ROI groups were categorized based on their distances from the center of the phantom. Results: VEO3.0 performed inferiorly comparing to VEO2.0 over all dose levels. On the other hand, at low dose levels (less than 3 mGy), it clearly outperformed ASiR and FBP, in NPS values. Therefore, the lower the dose level, the relative performance of MBIR improves. However, the shapes of the NPS show substantial differences in horizontal and vertical sampling dimensions. These differences may determine the characteristics of the noise/texture features in images, and hence, play an important role in image interpretation. Conclusion: The third generation MBIR did not improve over the second generation MBIR in term of NPS analysis. The overall performance of both versions of MBIR improved as compared to other reconstruction algorithms when dose was reduced. The shapes of the NPS curves provided additional value for future characterization of the image noise/texture features.

  3. Yeast Interacting Proteins Database: YPL204W, YOL149W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available Subunit of the Dcp1p-Dcp2p decapping enzyme complex, which removes the 5' cap str...1p-Dcp2p decapping enzyme complex, which removes the 5' cap structure from mRNAs prior to their degradation;

  4. 204 The Crisis of Identity and the Quest for Development in Africa ...

    African Journals Online (AJOL)

    Ike Odimegwu

    with the cultural syncretistic interpretation of the existential situation in Africa. What is .... regard Africa, many parts of Asia and the third world as ..... in World War Two. The Japanese lost confidence and suffered from identity crisis and inferiority complex. This state continued until the middle of the 1960s when the Japanese.

  5. 24 CFR 570.204 - Special activities by Community-Based Development Organizations (CBDOs).

    Science.gov (United States)

    2010-04-01

    ... alone or in concert with other project activities either being carried out or for which funding has been... primary purpose the improvement of the physical, economic or social environment of its geographic area of... 501 State Development Company or Section 502 Local Development Company, or an SBA Certified Section...

  6. TU-AB-204-01: Advances in C-Arm CBCT for Brain Perfusion Imaging

    Energy Technology Data Exchange (ETDEWEB)

    Chen, G. [University of Wisconsin (United States)

    2015-06-15

    This symposium highlights advanced cone-beam CT (CBCT) technologies in four areas of emerging application in diagnostic imaging and image-guided interventions. Each area includes research that extends the spatial, temporal, and/or contrast resolution characteristics of CBCT beyond conventional limits through advances in scanner technology, acquisition protocols, and 3D image reconstruction techniques. Dr. G. Chen (University of Wisconsin) will present on the topic: Advances in C-arm CBCT for Brain Perfusion Imaging. Stroke is a leading cause of death and disability, and a fraction of people having an acute ischemic stroke are suitable candidates for endovascular therapy. Critical factors that affect both the likelihood of successful revascularization and good clinical outcome are: 1) the time between stroke onset and revascularization; and 2) the ability to distinguish patients who have a small volume of irreversibly injured brain (ischemic core) and a large volume of ischemic but salvageable brain (penumbra) from patients with a large ischemic core and little or no penumbra. Therefore, “time is brain” in the care of the stroke patients. C-arm CBCT systems widely available in angiography suites have the potential to generate non-contrast-enhanced CBCT images to exclude the presence of hemorrhage, time-resolved CBCT angiography to evaluate the site of occlusion and collaterals, and CBCT perfusion parametric images to assess the extent of the ischemic core and penumbra, thereby fulfilling the imaging requirements of a “one-stop-shop” in the angiography suite to reduce the time between onset and revascularization therapy. The challenges and opportunities to advance CBCT technology to fully enable the one-stop-shop C-arm CBCT platform for brain imaging will be discussed. Dr. R. Fahrig (Stanford University) will present on the topic: Advances in C-arm CBCT for Cardiac Interventions. With the goal of providing functional information during cardiac interventions, significant effort has been expended to improve the quantitative accuracy of C-arm CBCT reconstructions. The challenge is to improve image quality while providing very short turnaround between data acquisition and volume data visualization. Corrections for x-ray scatter, view aliasing and patient motion that require no more than 2 iterations keep processing time short while reducing artifact. Fast, multi-sweep acquisitions can be used to permit assessment of left ventricular function, and visualization of radiofrequency lesions created to treat arrhythmias. Workflows for each imaging goal have been developed and validated against gold standard clinical CT or histology. The challenges, opportunities, and limitations of the new functional C-arm CBCT imaging techniques will be discussed. Dr. W. Zbijewski (Johns Hopkins University) will present on the topic: Advances in CBCT for Orthopaedics and Bone Health Imaging. Cone-beam CT is particularly well suited for imaging of musculoskeletal extremities. Owing to the high spatial resolution of flat-panel detectors, CBCT can surpass conventional CT in imaging tasks involving bone visualization, quantitative analysis of subchondral trabecular structure, and visualization and monitoring of subtle fractures that are common in orthopedic radiology. A dedicated CBCT platform has been developed that offers flexibility in system design and provides not only a compact configuration with improved logistics for extremities imaging but also enables novel diagnostic capabilities such as imaging of weight-bearing lower extremities in a natural stance. The design, development and clinical performance of dedicated extremities CBCT systems will be presented. Advanced capabilities for quantitative volumetric assessment of joint space morphology, dual-energy image-based quantification of bone composition, and in-vivo analysis of bone microarchitecture will be discussed, along with emerging applications in the diagnosis of arthritis and osteoporosis and assessment of novel therapies. Finally, Dr. J. Boone (UC Davis) will present on the topic: Advances in CBCT for Breast Imaging. Breast CT has been studied as an imaging tool for diagnostic breast evaluation and for potential breast cancer screening. The breast CT application lends itself to CBCT because of the small dimensions of the breast, the tapered shape of the breast towards higher cone angle, and the fact that there are no bones in the breast. The performance of various generations of breast CT scanners developed in recent years will be discussed, focusing on advances in spatial resolution and image noise characteristics. The results will also demonstrate the results of clinical trials using both computer and human observers. Learning Objectives: Understand the challenges, key technological advances, and emerging opportunities of CBCT in: Brain perfusion imaging, including assessment of ischemic stroke Cardiac imaging for functional assessment in cardiac interventions Orthopedics imaging for evaluation of musculoskeletal trauma, arthritis, and osteoporosis Breast imaging for screening and diagnosis of breast cancer. Work presented in this symposium includes research support by: Siemens Healthcare (Dr. Chen); NIH and Siemens Healthcare (Dr. Fahrig); NIH and Carestream Health (Dr. Zbijewski); and NIH (Dr. Boone)

  7. TU-AB-204-02: Advances in C-Arm CBCT for Cardiac Interventions

    Energy Technology Data Exchange (ETDEWEB)

    Fahrig, R. [Stanford University (United States)

    2015-06-15

    This symposium highlights advanced cone-beam CT (CBCT) technologies in four areas of emerging application in diagnostic imaging and image-guided interventions. Each area includes research that extends the spatial, temporal, and/or contrast resolution characteristics of CBCT beyond conventional limits through advances in scanner technology, acquisition protocols, and 3D image reconstruction techniques. Dr. G. Chen (University of Wisconsin) will present on the topic: Advances in C-arm CBCT for Brain Perfusion Imaging. Stroke is a leading cause of death and disability, and a fraction of people having an acute ischemic stroke are suitable candidates for endovascular therapy. Critical factors that affect both the likelihood of successful revascularization and good clinical outcome are: 1) the time between stroke onset and revascularization; and 2) the ability to distinguish patients who have a small volume of irreversibly injured brain (ischemic core) and a large volume of ischemic but salvageable brain (penumbra) from patients with a large ischemic core and little or no penumbra. Therefore, “time is brain” in the care of the stroke patients. C-arm CBCT systems widely available in angiography suites have the potential to generate non-contrast-enhanced CBCT images to exclude the presence of hemorrhage, time-resolved CBCT angiography to evaluate the site of occlusion and collaterals, and CBCT perfusion parametric images to assess the extent of the ischemic core and penumbra, thereby fulfilling the imaging requirements of a “one-stop-shop” in the angiography suite to reduce the time between onset and revascularization therapy. The challenges and opportunities to advance CBCT technology to fully enable the one-stop-shop C-arm CBCT platform for brain imaging will be discussed. Dr. R. Fahrig (Stanford University) will present on the topic: Advances in C-arm CBCT for Cardiac Interventions. With the goal of providing functional information during cardiac interventions, significant effort has been expended to improve the quantitative accuracy of C-arm CBCT reconstructions. The challenge is to improve image quality while providing very short turnaround between data acquisition and volume data visualization. Corrections for x-ray scatter, view aliasing and patient motion that require no more than 2 iterations keep processing time short while reducing artifact. Fast, multi-sweep acquisitions can be used to permit assessment of left ventricular function, and visualization of radiofrequency lesions created to treat arrhythmias. Workflows for each imaging goal have been developed and validated against gold standard clinical CT or histology. The challenges, opportunities, and limitations of the new functional C-arm CBCT imaging techniques will be discussed. Dr. W. Zbijewski (Johns Hopkins University) will present on the topic: Advances in CBCT for Orthopaedics and Bone Health Imaging. Cone-beam CT is particularly well suited for imaging of musculoskeletal extremities. Owing to the high spatial resolution of flat-panel detectors, CBCT can surpass conventional CT in imaging tasks involving bone visualization, quantitative analysis of subchondral trabecular structure, and visualization and monitoring of subtle fractures that are common in orthopedic radiology. A dedicated CBCT platform has been developed that offers flexibility in system design and provides not only a compact configuration with improved logistics for extremities imaging but also enables novel diagnostic capabilities such as imaging of weight-bearing lower extremities in a natural stance. The design, development and clinical performance of dedicated extremities CBCT systems will be presented. Advanced capabilities for quantitative volumetric assessment of joint space morphology, dual-energy image-based quantification of bone composition, and in-vivo analysis of bone microarchitecture will be discussed, along with emerging applications in the diagnosis of arthritis and osteoporosis and assessment of novel therapies. Finally, Dr. J. Boone (UC Davis) will present on the topic: Advances in CBCT for Breast Imaging. Breast CT has been studied as an imaging tool for diagnostic breast evaluation and for potential breast cancer screening. The breast CT application lends itself to CBCT because of the small dimensions of the breast, the tapered shape of the breast towards higher cone angle, and the fact that there are no bones in the breast. The performance of various generations of breast CT scanners developed in recent years will be discussed, focusing on advances in spatial resolution and image noise characteristics. The results will also demonstrate the results of clinical trials using both computer and human observers. Learning Objectives: Understand the challenges, key technological advances, and emerging opportunities of CBCT in: Brain perfusion imaging, including assessment of ischemic stroke Cardiac imaging for functional assessment in cardiac interventions Orthopedics imaging for evaluation of musculoskeletal trauma, arthritis, and osteoporosis Breast imaging for screening and diagnosis of breast cancer. Work presented in this symposium includes research support by: Siemens Healthcare (Dr. Chen); NIH and Siemens Healthcare (Dr. Fahrig); NIH and Carestream Health (Dr. Zbijewski); and NIH (Dr. Boone)

  8. TU-AB-204-04: Advances in CBCT for Breast Imaging

    Energy Technology Data Exchange (ETDEWEB)

    Boone, J. [University of California Davis School of Medicine (United States)

    2015-06-15

    This symposium highlights advanced cone-beam CT (CBCT) technologies in four areas of emerging application in diagnostic imaging and image-guided interventions. Each area includes research that extends the spatial, temporal, and/or contrast resolution characteristics of CBCT beyond conventional limits through advances in scanner technology, acquisition protocols, and 3D image reconstruction techniques. Dr. G. Chen (University of Wisconsin) will present on the topic: Advances in C-arm CBCT for Brain Perfusion Imaging. Stroke is a leading cause of death and disability, and a fraction of people having an acute ischemic stroke are suitable candidates for endovascular therapy. Critical factors that affect both the likelihood of successful revascularization and good clinical outcome are: 1) the time between stroke onset and revascularization; and 2) the ability to distinguish patients who have a small volume of irreversibly injured brain (ischemic core) and a large volume of ischemic but salvageable brain (penumbra) from patients with a large ischemic core and little or no penumbra. Therefore, “time is brain” in the care of the stroke patients. C-arm CBCT systems widely available in angiography suites have the potential to generate non-contrast-enhanced CBCT images to exclude the presence of hemorrhage, time-resolved CBCT angiography to evaluate the site of occlusion and collaterals, and CBCT perfusion parametric images to assess the extent of the ischemic core and penumbra, thereby fulfilling the imaging requirements of a “one-stop-shop” in the angiography suite to reduce the time between onset and revascularization therapy. The challenges and opportunities to advance CBCT technology to fully enable the one-stop-shop C-arm CBCT platform for brain imaging will be discussed. Dr. R. Fahrig (Stanford University) will present on the topic: Advances in C-arm CBCT for Cardiac Interventions. With the goal of providing functional information during cardiac interventions, significant effort has been expended to improve the quantitative accuracy of C-arm CBCT reconstructions. The challenge is to improve image quality while providing very short turnaround between data acquisition and volume data visualization. Corrections for x-ray scatter, view aliasing and patient motion that require no more than 2 iterations keep processing time short while reducing artifact. Fast, multi-sweep acquisitions can be used to permit assessment of left ventricular function, and visualization of radiofrequency lesions created to treat arrhythmias. Workflows for each imaging goal have been developed and validated against gold standard clinical CT or histology. The challenges, opportunities, and limitations of the new functional C-arm CBCT imaging techniques will be discussed. Dr. W. Zbijewski (Johns Hopkins University) will present on the topic: Advances in CBCT for Orthopaedics and Bone Health Imaging. Cone-beam CT is particularly well suited for imaging of musculoskeletal extremities. Owing to the high spatial resolution of flat-panel detectors, CBCT can surpass conventional CT in imaging tasks involving bone visualization, quantitative analysis of subchondral trabecular structure, and visualization and monitoring of subtle fractures that are common in orthopedic radiology. A dedicated CBCT platform has been developed that offers flexibility in system design and provides not only a compact configuration with improved logistics for extremities imaging but also enables novel diagnostic capabilities such as imaging of weight-bearing lower extremities in a natural stance. The design, development and clinical performance of dedicated extremities CBCT systems will be presented. Advanced capabilities for quantitative volumetric assessment of joint space morphology, dual-energy image-based quantification of bone composition, and in-vivo analysis of bone microarchitecture will be discussed, along with emerging applications in the diagnosis of arthritis and osteoporosis and assessment of novel therapies. Finally, Dr. J. Boone (UC Davis) will present on the topic: Advances in CBCT for Breast Imaging. Breast CT has been studied as an imaging tool for diagnostic breast evaluation and for potential breast cancer screening. The breast CT application lends itself to CBCT because of the small dimensions of the breast, the tapered shape of the breast towards higher cone angle, and the fact that there are no bones in the breast. The performance of various generations of breast CT scanners developed in recent years will be discussed, focusing on advances in spatial resolution and image noise characteristics. The results will also demonstrate the results of clinical trials using both computer and human observers. Learning Objectives: Understand the challenges, key technological advances, and emerging opportunities of CBCT in: Brain perfusion imaging, including assessment of ischemic stroke Cardiac imaging for functional assessment in cardiac interventions Orthopedics imaging for evaluation of musculoskeletal trauma, arthritis, and osteoporosis Breast imaging for screening and diagnosis of breast cancer. Work presented in this symposium includes research support by: Siemens Healthcare (Dr. Chen); NIH and Siemens Healthcare (Dr. Fahrig); NIH and Carestream Health (Dr. Zbijewski); and NIH (Dr. Boone)

  9. TU-AB-204-00: Advances in Cone-Beam CT and Emerging Applications

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2015-06-15

    This symposium highlights advanced cone-beam CT (CBCT) technologies in four areas of emerging application in diagnostic imaging and image-guided interventions. Each area includes research that extends the spatial, temporal, and/or contrast resolution characteristics of CBCT beyond conventional limits through advances in scanner technology, acquisition protocols, and 3D image reconstruction techniques. Dr. G. Chen (University of Wisconsin) will present on the topic: Advances in C-arm CBCT for Brain Perfusion Imaging. Stroke is a leading cause of death and disability, and a fraction of people having an acute ischemic stroke are suitable candidates for endovascular therapy. Critical factors that affect both the likelihood of successful revascularization and good clinical outcome are: 1) the time between stroke onset and revascularization; and 2) the ability to distinguish patients who have a small volume of irreversibly injured brain (ischemic core) and a large volume of ischemic but salvageable brain (penumbra) from patients with a large ischemic core and little or no penumbra. Therefore, “time is brain” in the care of the stroke patients. C-arm CBCT systems widely available in angiography suites have the potential to generate non-contrast-enhanced CBCT images to exclude the presence of hemorrhage, time-resolved CBCT angiography to evaluate the site of occlusion and collaterals, and CBCT perfusion parametric images to assess the extent of the ischemic core and penumbra, thereby fulfilling the imaging requirements of a “one-stop-shop” in the angiography suite to reduce the time between onset and revascularization therapy. The challenges and opportunities to advance CBCT technology to fully enable the one-stop-shop C-arm CBCT platform for brain imaging will be discussed. Dr. R. Fahrig (Stanford University) will present on the topic: Advances in C-arm CBCT for Cardiac Interventions. With the goal of providing functional information during cardiac interventions, significant effort has been expended to improve the quantitative accuracy of C-arm CBCT reconstructions. The challenge is to improve image quality while providing very short turnaround between data acquisition and volume data visualization. Corrections for x-ray scatter, view aliasing and patient motion that require no more than 2 iterations keep processing time short while reducing artifact. Fast, multi-sweep acquisitions can be used to permit assessment of left ventricular function, and visualization of radiofrequency lesions created to treat arrhythmias. Workflows for each imaging goal have been developed and validated against gold standard clinical CT or histology. The challenges, opportunities, and limitations of the new functional C-arm CBCT imaging techniques will be discussed. Dr. W. Zbijewski (Johns Hopkins University) will present on the topic: Advances in CBCT for Orthopaedics and Bone Health Imaging. Cone-beam CT is particularly well suited for imaging of musculoskeletal extremities. Owing to the high spatial resolution of flat-panel detectors, CBCT can surpass conventional CT in imaging tasks involving bone visualization, quantitative analysis of subchondral trabecular structure, and visualization and monitoring of subtle fractures that are common in orthopedic radiology. A dedicated CBCT platform has been developed that offers flexibility in system design and provides not only a compact configuration with improved logistics for extremities imaging but also enables novel diagnostic capabilities such as imaging of weight-bearing lower extremities in a natural stance. The design, development and clinical performance of dedicated extremities CBCT systems will be presented. Advanced capabilities for quantitative volumetric assessment of joint space morphology, dual-energy image-based quantification of bone composition, and in-vivo analysis of bone microarchitecture will be discussed, along with emerging applications in the diagnosis of arthritis and osteoporosis and assessment of novel therapies. Finally, Dr. J. Boone (UC Davis) will present on the topic: Advances in CBCT for Breast Imaging. Breast CT has been studied as an imaging tool for diagnostic breast evaluation and for potential breast cancer screening. The breast CT application lends itself to CBCT because of the small dimensions of the breast, the tapered shape of the breast towards higher cone angle, and the fact that there are no bones in the breast. The performance of various generations of breast CT scanners developed in recent years will be discussed, focusing on advances in spatial resolution and image noise characteristics. The results will also demonstrate the results of clinical trials using both computer and human observers. Learning Objectives: Understand the challenges, key technological advances, and emerging opportunities of CBCT in: Brain perfusion imaging, including assessment of ischemic stroke Cardiac imaging for functional assessment in cardiac interventions Orthopedics imaging for evaluation of musculoskeletal trauma, arthritis, and osteoporosis Breast imaging for screening and diagnosis of breast cancer. Work presented in this symposium includes research support by: Siemens Healthcare (Dr. Chen); NIH and Siemens Healthcare (Dr. Fahrig); NIH and Carestream Health (Dr. Zbijewski); and NIH (Dr. Boone)

  10. TU-AB-204-03: Advances in CBCT for Orhtopaedics and Bone Health Imaging

    Energy Technology Data Exchange (ETDEWEB)

    Zbijewski, W. [Johns Hopkins University (United States)

    2015-06-15

    This symposium highlights advanced cone-beam CT (CBCT) technologies in four areas of emerging application in diagnostic imaging and image-guided interventions. Each area includes research that extends the spatial, temporal, and/or contrast resolution characteristics of CBCT beyond conventional limits through advances in scanner technology, acquisition protocols, and 3D image reconstruction techniques. Dr. G. Chen (University of Wisconsin) will present on the topic: Advances in C-arm CBCT for Brain Perfusion Imaging. Stroke is a leading cause of death and disability, and a fraction of people having an acute ischemic stroke are suitable candidates for endovascular therapy. Critical factors that affect both the likelihood of successful revascularization and good clinical outcome are: 1) the time between stroke onset and revascularization; and 2) the ability to distinguish patients who have a small volume of irreversibly injured brain (ischemic core) and a large volume of ischemic but salvageable brain (penumbra) from patients with a large ischemic core and little or no penumbra. Therefore, “time is brain” in the care of the stroke patients. C-arm CBCT systems widely available in angiography suites have the potential to generate non-contrast-enhanced CBCT images to exclude the presence of hemorrhage, time-resolved CBCT angiography to evaluate the site of occlusion and collaterals, and CBCT perfusion parametric images to assess the extent of the ischemic core and penumbra, thereby fulfilling the imaging requirements of a “one-stop-shop” in the angiography suite to reduce the time between onset and revascularization therapy. The challenges and opportunities to advance CBCT technology to fully enable the one-stop-shop C-arm CBCT platform for brain imaging will be discussed. Dr. R. Fahrig (Stanford University) will present on the topic: Advances in C-arm CBCT for Cardiac Interventions. With the goal of providing functional information during cardiac interventions, significant effort has been expended to improve the quantitative accuracy of C-arm CBCT reconstructions. The challenge is to improve image quality while providing very short turnaround between data acquisition and volume data visualization. Corrections for x-ray scatter, view aliasing and patient motion that require no more than 2 iterations keep processing time short while reducing artifact. Fast, multi-sweep acquisitions can be used to permit assessment of left ventricular function, and visualization of radiofrequency lesions created to treat arrhythmias. Workflows for each imaging goal have been developed and validated against gold standard clinical CT or histology. The challenges, opportunities, and limitations of the new functional C-arm CBCT imaging techniques will be discussed. Dr. W. Zbijewski (Johns Hopkins University) will present on the topic: Advances in CBCT for Orthopaedics and Bone Health Imaging. Cone-beam CT is particularly well suited for imaging of musculoskeletal extremities. Owing to the high spatial resolution of flat-panel detectors, CBCT can surpass conventional CT in imaging tasks involving bone visualization, quantitative analysis of subchondral trabecular structure, and visualization and monitoring of subtle fractures that are common in orthopedic radiology. A dedicated CBCT platform has been developed that offers flexibility in system design and provides not only a compact configuration with improved logistics for extremities imaging but also enables novel diagnostic capabilities such as imaging of weight-bearing lower extremities in a natural stance. The design, development and clinical performance of dedicated extremities CBCT systems will be presented. Advanced capabilities for quantitative volumetric assessment of joint space morphology, dual-energy image-based quantification of bone composition, and in-vivo analysis of bone microarchitecture will be discussed, along with emerging applications in the diagnosis of arthritis and osteoporosis and assessment of novel therapies. Finally, Dr. J. Boone (UC Davis) will present on the topic: Advances in CBCT for Breast Imaging. Breast CT has been studied as an imaging tool for diagnostic breast evaluation and for potential breast cancer screening. The breast CT application lends itself to CBCT because of the small dimensions of the breast, the tapered shape of the breast towards higher cone angle, and the fact that there are no bones in the breast. The performance of various generations of breast CT scanners developed in recent years will be discussed, focusing on advances in spatial resolution and image noise characteristics. The results will also demonstrate the results of clinical trials using both computer and human observers. Learning Objectives: Understand the challenges, key technological advances, and emerging opportunities of CBCT in: Brain perfusion imaging, including assessment of ischemic stroke Cardiac imaging for functional assessment in cardiac interventions Orthopedics imaging for evaluation of musculoskeletal trauma, arthritis, and osteoporosis Breast imaging for screening and diagnosis of breast cancer. Work presented in this symposium includes research support by: Siemens Healthcare (Dr. Chen); NIH and Siemens Healthcare (Dr. Fahrig); NIH and Carestream Health (Dr. Zbijewski); and NIH (Dr. Boone)

  11. 12 CFR 204.134 - Linked time deposits and transaction accounts.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Linked time deposits and transaction accounts... Linked time deposits and transaction accounts. (a) Authority. Under section 19(a) of the Federal Reserve... payments to third persons or others. This interpretation is adopted under these authorities. (b) Linked...

  12. SU-C-204-04: Irradiation of Human Cell Lines Using Various Ions

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Y; McMahon, S; Kaminuma, T; Held, K [Harvard Medical School, Boston MA (United States); Tessa, C; Rusek, A [Brookhaven National Laboratory, Upton, NY (United States)

    2016-06-15

    Purpose: The purpose of this study is to investigate and quantify the biological effects of ion radiation using several human cell lines. We aim to answer the question of whether carbon ion the most ideal ion species for heavy ion radiotherapy. Methods: The cells were irradiated at different positions along the pristine Bragg peak of several ions with different atomic number. The biological effectiveness was evaluated using the clonogenic cell survival assay. Irradiation of three human lung cancer cell lines and a fibroblast cell line were undertaken using the charged particle beam at the NASA Space Radiation Laboratory at Brookhaven National Lab. Four mono-energetic ion beams (carbon, oxygen, helium and lithium) were used to irradiate the cells. Water or media-filled T25 flasks were lined up along the beam line so that the cell-containing surfaces of the flasks were placed at a specific depth along the pristine Bragg curve. Four depths along the curve, representing entrance point, rising peak, peak and distal fall off, were selected to determine biological effectiveness. Gaf-chromic films were placed between the flasks to monitor the irradiation as soon as it was finished. Results: For all ion radiations, the maximum cell killing effect occurs at either peak or distal fall off, depending on the cell lines. For instance, for the fibroblast cell line AGO1522, RBEs of 1.4, 1.2, 1.4 and 1.9 were observed at the Bragg peak for Helium, Lithium, Carbon and Oxygen ions. Comparing positions, RBEs of 0.9, 1.2, 1.4 and 1.8 were observed for carbon irradiation of AGO-1522 cells positions corresponding to entrance, rising peak, peak and distal fall off. Conclusion: RBE values differ with position in the Bragg peak, ion species and cell line. Ions other than carbon may prove more effective in certain irradiation conditions and may contribute to optimized heavy ion therapy.

  13. Operations and maintenance manual, atmospheric contaminant sensor. Addendum 1: Carbon monoxide monitor model 204

    Science.gov (United States)

    1972-01-01

    An instrument for monitoring the carbon monoxide content of the ambient atmosphere is described. The subjects discussed are: (1) theory of operation, (2) system features, (3) controls and monitors, (4) operational procedures, and (5) maintenance and troubleshooting. Block drawings and circuit diagrams are included to clarify the text.

  14. 48 CFR 37.204 - Guidelines for determining availability of personnel.

    Science.gov (United States)

    2010-10-01

    ... required training and capabilities; and (2) Consider the administrative cost and time associated with conducting the search, the dollar value of the procurement, other costs, such as travel costs involved in the use of such personnel, and the needs of the Federal agencies to make management decisions on the best...

  15. MO-DE-204-03: Radiology Dose Optimisation - An Australian Perspective

    Energy Technology Data Exchange (ETDEWEB)

    Schick, D. [Princess Alexandra Hospital (United States)

    2016-06-15

    The main topic of the session is to show how dose optimization is being implemented in various regions of the world, including Europe, Australia, North America and other regions. A multi-national study conducted under International Atomic Energy Agency (IAEA) across more than 50 less resourced countries gave insight into patient radiation doses and safety practices in CT, mammography, radiography and interventional procedures, both for children and adults. An important outcome was the capability development on dose assessment and management. An overview of recent European projects related to CT radiation dose and optimization both to adults and children will be presented. Existing data on DRLs together with a European methodology proposed on establishing and using DRLs for paediatric radiodiagnostic imaging and interventional radiology practices will be shown. Compared with much of Europe at least, many Australian imaging practices are relatively new to the task of diagnostic imaging dose optimisation. In 2008 the Australian Government prescribed a requirement to periodically compare patient radiation doses with diagnostic reference levels (DRLs), where DRLs have been established. Until recently, Australia had only established DRLs for computed tomography (CT). Regardless, both professional society and individual efforts to improved data collection and develop optimisation strategies across a range of modalities continues. Progress in this field, principally with respect to CT and interventional fluoroscopy will be presented. In the US, dose reduction and optimization efforts for computed tomography have been promoted and mandated by several organizations and accrediting entities. This presentation will cover the general motivation, implementation, and implications of such efforts. Learning Objectives: Understand importance of the dose optimization in Diagnostic Radiology. See how this goal is achieved in different regions of the World. Learn about the global trend in the dose optimization and future prospectives. M. Rehani, The work was a part of the work of IAEA where I was an employee and IAEA is a United Nations organization.

  16. SU-C-204-03: DFT Calculations of the Stability of DOTA-Based-Radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Khabibullin, A.R.; Woods, L.M. [University of South Florida, Tampa, Florida (United States); Karolak, A.; Budzevich, M.M.; Martinez, M.V. [H. Lee Moffitt Cancer Center and Research Institute, Tampa, Florida (United States); McLaughlin, M.L.; Morse, D.L. [University of South Florida, Tampa, Florida (United States); H. Lee Moffitt Cancer Center and Research Institute, Tampa, Florida (United States)

    2016-06-15

    Purpose: Application of the density function theory (DFT) to investigate the structural stability of complexes applied in cancer therapy consisting of the 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (DOTA) chelated to Ac225, Fr221, At217, Bi213, and Gd68 radio-nuclei. Methods: The possibility to deliver a toxic payload directly to tumor cells is a highly desirable aim in targeted alpha particle therapy. The estimation of bond stability between radioactive atoms and the DOTA chelating agent is the key element in understanding the foundations of this delivery process. Thus, we adapted the Vienna Ab-initio Simulation Package (VASP) with the projector-augmented wave method and a plane-wave basis set in order to study the stability and electronic properties of DOTA ligand chelated to radioactive isotopes. In order to count for the relativistic effect of radioactive isotopes we included Spin-Orbit Coupling (SOC) in the DFT calculations. Five DOTA complex structures were represented as unit cells, each containing 58 atoms. The energy optimization was performed for all structures prior to calculations of electronic properties. Binding energies, electron localization functions as well as bond lengths between atoms were estimated. Results: Calculated binding energies for DOTA-radioactive atom systems were −17.792, −5.784, −8.872, −13.305, −18.467 eV for Ac, Fr, At, Bi and Gd complexes respectively. The displacements of isotopes in DOTA cages were estimated from the variations in bond lengths, which were within 2.32–3.75 angstroms. The detailed representation of chemical bonding in all complexes was obtained with the Electron Localization Function (ELF). Conclusion: DOTA-Gd, DOTA-Ac and DOTA-Bi were the most stable structures in the group. Inclusion of SOC had a significant role in the improvement of DFT calculation accuracy for heavy radioactive atoms. Our approach is found to be proper for the investigation of structures with DOTA-based-radiopharmaceuticals and will enhance our understanding of processes occurring at subatomic levels.

  17. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (204b-0613-272217)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National OceanService, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment, the...

  18. Yeast Interacting Proteins Database: YPL204W, YHR185C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available n Sporulation protein required for prospore membrane formation at selected spindle poles, ensures functionality...Sporulation protein required for prospore membrane formation at selected spindle poles, ensures functional...ity of all four spindle pole bodies during meiosis II; not required for meiotic rec

  19. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (204c-0613-272217)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  20. 77 FR 2089 - Proposed Information Collection Request of the ETA 204, Experience Rating Report; Comment Request...

    Science.gov (United States)

    2012-01-13

    ... Change AGENCY: Employment and Training Administration, Labor. ACTION: Notice. SUMMARY: The Department of... Employment and Training Administration to project revenues for the Unemployment Insurance (UI) program on a... employment, etc.) on the unemployment experience of various groups of employers. The data also provide an...

  1. Herman Paul. (2011. Hayden White: The Historical Imagination. Cambridge: Polity Press [204 pp.

    Directory of Open Access Journals (Sweden)

    Ariel C. Lopez

    2011-12-01

    Full Text Available Ang akdang ito ni Herman Paul ay isang kritikal na pagsasakasaysayan(historicization ng mga ideya ni Hayden White na maibibilang sapinakamahahalagang pilosopo ng kasaysayan ng kontemporaryong panahon.Si White ay tanyag bilang simbolo par excellence ng postmodernistang kasaysayan na reaksyon laban sa noo’y, at hanggang ngayo’y, namamayaning positibistang pananaw (na inuugat sa Alemang historyador ng ika-19 na dantaon na si Leopold von Ranke. Noong Dekada ’50 pa lang, masusulyapan na ang pagsalungat ni White sa tradisyong positibista nang tawagin niya si Ranke bilang “kawawang nilalang na nagkandabulag sa paghahanap ng ‘kung ano ang tunay na nangyari’”(Paul, 2011, p.105. Para kay White, ang nakaraan per se (bilang nakaraan ay isang “walang-kahulugang katotohanan” (meaningless reality lamang. Binibigyang kahulugan ng mga historyador ang nakaraan sa pamamagitan ng mga naratibo na siyang humuhugis at nagtatakda sa kahulugan. Sa magnum opus ni White na pinamagatang Metahistory: The Historical Imagination in Nineteenth-Century Europe (1973, inilalatag niya ang ibat-ibang pagbabanghay (emplotment at tropos (tropesna implisitong sinusundan at sinasandigan ng mga (positibistang historyador upang magkaroon ng makatotohanang naratibo.

  2. 48 CFR 252.204-7005 - Oral attestation of security responsibilities.

    Science.gov (United States)

    2010-10-01

    ... responsibilities imposed by law or regulation on those granted access. Reading aloud the first paragraph of... responsibilities when being briefed into a new program or during their annual refresher briefing. There is no... and shall submit a report to the Contractor's security activity. (End of clause) ...

  3. 48 CFR 52.204-10 - Reporting Executive Compensation and First-Tier Subcontract Awards.

    Science.gov (United States)

    2010-10-01

    ... (Revised 2004) (FAS 123R), Shared Based Payments. (3) Earnings for services under non-equity incentive...) Change in pension value. This is the change in present value of defined benefit and actuarial pension plans. (5) Above-market earnings on deferred compensation which is not tax-qualified. (6) Other...

  4. Scaling Academic Planning in Community College: A Randomized Controlled Trial. REL 2017-204

    Science.gov (United States)

    Visher, Mary G.; Mayer, Alexander K.; Johns, Michael; Rudd, Timothy; Levine, Andrew; Rauner, Mary

    2016-01-01

    Community college students often lack an academic plan to guide their choices of coursework to achieve their educational goals, in part because counseling departments typically lack the capacity to advise students at scale. This randomized controlled trial tests the impact of guaranteed access to one of two alternative counseling sessions (group…

  5. 44 CFR 204.51 - Application and approval procedures for a fire management assistance grant.

    Science.gov (United States)

    2010-10-01

    ... receipt of the written request from the State, the Regional Administrator may grant an extension for up to... wildfire risk and contains a wildfire mitigation strategy and related mitigation initiatives. ...

  6. MO-FG-204-05: Evaluation of a Novel Algorithm for Improved 4DCT Resolution

    Energy Technology Data Exchange (ETDEWEB)

    Glide-Hurst, C; Briceno, J; Chetty, I. J. [Henry Ford Health System, Detroit, MI (United States); Klahr, P [Philips Healthcare, Highland Heights, OH (United States)

    2015-06-15

    Purpose: Accurate tumor motion characterization is critical for increasing the therapeutic ratio of radiation therapy. To accommodate the divergent fan-beam geometry of the scanner, the current 4D-CT algorithm utilizes a larger temporal window to ensure that pixel values are valid throughout the entire FOV. To minimize the impact on temporal resolution, a cos{sup 2} weighting is employed. We propose a novel exponential weighting (“exponential”) 4DCT reconstruction algorithm that has a sharper slope and provides a more optimal temporal resolution. Methods: A respiratory motion platform translated a lung-mimicking Styrofoam slab with several high and low-contrast inserts 2 cm in the superior-inferior direction. Breathing rates (10–15 bpm) and couch pitch (0.06–0.1 A.U.) were varied to assess interplay between parameters. Multi-slice helical 4DCTs were acquired with 0.5 sec gantry rotation and data were reconstructed with cos{sup 2} and exponential weighting. Mean and standard deviation were calculated via region of interest analysis. Intensity profiles evaluated object boundaries. Retrospective raw data reconstructions were performed for both 4DCT algorithms for 3 liver and lung cancer patients. Image quality (temporal blurring/sharpness) and subtraction images were compared between reconstructions. Results: In the phantom, profile analysis revealed that sharper boundaries were obtained with exponential reconstructions at transitioning breathing phases (i.e. mid-inhale or mid-exhale). Reductions in full-width half maximum were ∼1 mm in the superior-inferior direction and appreciable sharpness could be observed in difference maps. This reduction also yielded a slight reduction in target volume between reconstruction algorithms. For patient cases, coronal views showed less blurring at object boundaries and local intensity differences near the tumor and diaphragm with exponential weighted reconstruction. Conclusion: Exponential weighted 4DCT offers potential for improving image sharpness in 4DCT. Comparisons with true object extent using static CTs of varied phantom positions are necessary to confirm these findings. Future work with additional patient cases is warranted. Research partially sponsored by Philips Healthcare.

  7. 7 CFR 760.204 - Eligible livestock, honeybees, and farm-raised fish.

    Science.gov (United States)

    2010-01-01

    ..., gilts 50 to 150 pounds; (xxxii) Swine, sows, boars, barrows, gilts over 150 pounds; (xxxiii) Turkeys..., gilts; (vii) Swine, sows, boars, barrows, gilts; and (viii) Turkeys, toms, fryers, and roasters. (f) For...

  8. TU-AB-204-03: Research Activities in Medical Physics

    Energy Technology Data Exchange (ETDEWEB)

    Badano, A. [Food & Drug Administration (United States)

    2016-06-15

    The responsibilities of the Food and Drug Administration (FDA) have increased since the inception of the Food and Drugs Act in 1906. Medical devices first came under comprehensive regulation with the passage of the 1938 Food, Drug, and Cosmetic Act. In 1971 FDA also took on the responsibility for consumer protection against unnecessary exposure to radiation-emitting devices for home and occupational use. However it was not until 1976, under the Medical Device Regulation Act, that the FDA was responsible for the safety and effectiveness of medical devices. This session will be presented by the Division of Radiological Health (DRH) and the Division of Imaging, Diagnostics, and Software Reliability (DIDSR) from the Center for Devices and Radiological Health (CDRH) at the FDA. The symposium will discuss on how we protect and promote public health with a focus on medical physics applications organized into four areas: pre-market device review, post-market surveillance, device compliance, current regulatory research efforts and partnerships with other organizations. The pre-market session will summarize the pathways FDA uses to regulate the investigational use and commercialization of diagnostic imaging and radiation therapy medical devices in the US, highlighting resources available to assist investigators and manufacturers. The post-market session will explain the post-market surveillance and compliance activities FDA performs to monitor the safety and effectiveness of devices on the market. The third session will describe research efforts that support the regulatory mission of the Agency. An overview of our regulatory research portfolio to advance our understanding of medical physics and imaging technologies and approaches to their evaluation will be discussed. Lastly, mechanisms that FDA uses to seek public input and promote collaborations with professional, government, and international organizations, such as AAPM, International Electrotechnical Commission (IEC), Image Gently, and the Quantitative Imaging Biomarkers Alliance (QIBA) among others, to fulfill FDA’s mission will be discussed. Learning Objectives: Understand FDA’s pre-market and post-market review processes for medical devices Understand FDA’s current regulatory research activities in the areas of medical physics and imaging products Understand how being involved with AAPM and other organizations can also help to promote innovative, safe and effective medical devices J. Delfino, nothing to disclose.

  9. TU-AB-204-02: Device Adverse Events and Compliance

    Energy Technology Data Exchange (ETDEWEB)

    Gonzales, S. [Food & Drug Administration (United States)

    2016-06-15

    The responsibilities of the Food and Drug Administration (FDA) have increased since the inception of the Food and Drugs Act in 1906. Medical devices first came under comprehensive regulation with the passage of the 1938 Food, Drug, and Cosmetic Act. In 1971 FDA also took on the responsibility for consumer protection against unnecessary exposure to radiation-emitting devices for home and occupational use. However it was not until 1976, under the Medical Device Regulation Act, that the FDA was responsible for the safety and effectiveness of medical devices. This session will be presented by the Division of Radiological Health (DRH) and the Division of Imaging, Diagnostics, and Software Reliability (DIDSR) from the Center for Devices and Radiological Health (CDRH) at the FDA. The symposium will discuss on how we protect and promote public health with a focus on medical physics applications organized into four areas: pre-market device review, post-market surveillance, device compliance, current regulatory research efforts and partnerships with other organizations. The pre-market session will summarize the pathways FDA uses to regulate the investigational use and commercialization of diagnostic imaging and radiation therapy medical devices in the US, highlighting resources available to assist investigators and manufacturers. The post-market session will explain the post-market surveillance and compliance activities FDA performs to monitor the safety and effectiveness of devices on the market. The third session will describe research efforts that support the regulatory mission of the Agency. An overview of our regulatory research portfolio to advance our understanding of medical physics and imaging technologies and approaches to their evaluation will be discussed. Lastly, mechanisms that FDA uses to seek public input and promote collaborations with professional, government, and international organizations, such as AAPM, International Electrotechnical Commission (IEC), Image Gently, and the Quantitative Imaging Biomarkers Alliance (QIBA) among others, to fulfill FDA’s mission will be discussed. Learning Objectives: Understand FDA’s pre-market and post-market review processes for medical devices Understand FDA’s current regulatory research activities in the areas of medical physics and imaging products Understand how being involved with AAPM and other organizations can also help to promote innovative, safe and effective medical devices J. Delfino, nothing to disclose.

  10. TU-AB-204-00: CDRH/FDA Regulatory Processes and Device Science Activities

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2016-06-15

    The responsibilities of the Food and Drug Administration (FDA) have increased since the inception of the Food and Drugs Act in 1906. Medical devices first came under comprehensive regulation with the passage of the 1938 Food, Drug, and Cosmetic Act. In 1971 FDA also took on the responsibility for consumer protection against unnecessary exposure to radiation-emitting devices for home and occupational use. However it was not until 1976, under the Medical Device Regulation Act, that the FDA was responsible for the safety and effectiveness of medical devices. This session will be presented by the Division of Radiological Health (DRH) and the Division of Imaging, Diagnostics, and Software Reliability (DIDSR) from the Center for Devices and Radiological Health (CDRH) at the FDA. The symposium will discuss on how we protect and promote public health with a focus on medical physics applications organized into four areas: pre-market device review, post-market surveillance, device compliance, current regulatory research efforts and partnerships with other organizations. The pre-market session will summarize the pathways FDA uses to regulate the investigational use and commercialization of diagnostic imaging and radiation therapy medical devices in the US, highlighting resources available to assist investigators and manufacturers. The post-market session will explain the post-market surveillance and compliance activities FDA performs to monitor the safety and effectiveness of devices on the market. The third session will describe research efforts that support the regulatory mission of the Agency. An overview of our regulatory research portfolio to advance our understanding of medical physics and imaging technologies and approaches to their evaluation will be discussed. Lastly, mechanisms that FDA uses to seek public input and promote collaborations with professional, government, and international organizations, such as AAPM, International Electrotechnical Commission (IEC), Image Gently, and the Quantitative Imaging Biomarkers Alliance (QIBA) among others, to fulfill FDA’s mission will be discussed. Learning Objectives: Understand FDA’s pre-market and post-market review processes for medical devices Understand FDA’s current regulatory research activities in the areas of medical physics and imaging products Understand how being involved with AAPM and other organizations can also help to promote innovative, safe and effective medical devices J. Delfino, nothing to disclose.

  11. SU-D-204-02: BED Consistent Extrapolation of Mean Dose Tolerances

    Energy Technology Data Exchange (ETDEWEB)

    Perko, Z; Bortfeld, T; Hong, T; Wolfgang, J; Unkelbach, J [Massachusetts General Hospital, Boston, MA (United States)

    2016-06-15

    Purpose: The safe use of radiotherapy requires the knowledge of tolerable organ doses. For experimental fractionation schemes (e.g. hypofractionation) these are typically extrapolated from traditional fractionation schedules using the Biologically Effective Dose (BED) model. This work demonstrates that using the mean dose in the standard BED equation may overestimate tolerances, potentially leading to unsafe treatments. Instead, extrapolation of mean dose tolerances should take the spatial dose distribution into account. Methods: A formula has been derived to extrapolate mean physical dose constraints such that they are mean BED equivalent. This formula constitutes a modified BED equation where the influence of the spatial dose distribution is summarized in a single parameter, the dose shape factor. To quantify effects we analyzed 14 liver cancer patients previously treated with proton therapy in 5 or 15 fractions, for whom also photon IMRT plans were available. Results: Our work has two main implications. First, in typical clinical plans the dose distribution can have significant effects. When mean dose tolerances are extrapolated from standard fractionation towards hypofractionation they can be overestimated by 10–15%. Second, the shape difference between photon and proton dose distributions can cause 30–40% differences in mean physical dose for plans having the same mean BED. The combined effect when extrapolating proton doses to mean BED equivalent photon doses in traditional 35 fraction regimens resulted in up to 7–8 Gy higher doses than when applying the standard BED formula. This can potentially lead to unsafe treatments (in 1 of the 14 analyzed plans the liver mean dose was above its 32 Gy tolerance). Conclusion: The shape effect should be accounted for to avoid unsafe overestimation of mean dose tolerances, particularly when estimating constraints for hypofractionated regimens. In addition, tolerances established for a given treatment modality cannot necessarily be applied to other modalities with drastically different dose distributions.

  12. Stratospheric Determination of Effective Photodissociation Cross Sections for Molecular Oxygen: 191-204 nm

    Science.gov (United States)

    1983-10-20

    near 200 nm, is greater than expected, indicating that the recoin- mended 6 02 Herzberg continuum cross sections may be too large. Photo- -~ chemical...ToT(A) convolved with altitude-dependent effective absorption cross sections, t’eff(ZAX)9󈧎 (Allen & Frederick , 1982, ref. 10, will subsequently be 1...The preliminary data from that flight will be used to augment this study and tighten the error estimates. IV. Theory: As Allen and Frederick 10

  13. 8 CFR 204.313 - Filing and adjudication of a Form I-800.

    Science.gov (United States)

    2010-01-01

    ... has given the notice contemplated by article 5(c) of the Convention, shall constitute prima facie... service provider's plan for post-placement duties, as specified in 22 CFR 96.50; and (5) If the child may...

  14. 8 CFR 204.5 - Petitions for employment-based immigrants.

    Science.gov (United States)

    2010-01-01

    ... working on an advanced degree will only be acceptable if the alien has acquired the degree, and if the... or corporation or other legal entity; or (B) If the alien is already in the United States working for... was employed by the entity abroad for at least one year in a managerial or executive capacity; (C) The...

  15. 20 CFR 204.6 - Employment relation-pay for time lost.

    Science.gov (United States)

    2010-04-01

    ... the active service of an employer, is on furlough subject to recall by an employer, is on a bona fide... to return to service, or was not in active service because of a discharge later determined to be...

  16. Health Hazard Evaluation Report HETA 84-204-1600, Dental Health Associates, Paoli, Pennsylvania. [Nitrous oxide

    Energy Technology Data Exchange (ETDEWEB)

    Crandall, M.S.

    1985-06-01

    Area air and breathing-zone samples were analyzed for nitrous oxide at Dental Health Associates, Paoli, Pennsylvania on August 2, 1984. The evaluation was requested by a dental assistant because of general concern about the extent of nitrous oxide exposure, especially since the office was not equipped with a waste-anesthetic gas-scavenging system. The author recommends installing a waste anesthetic gas scavenging system with a dedicated exhaust. The nitrous oxide delivery and mixing system should be checked for leaks monthly and work practices for handling nitrous oxide should be improved.

  17. 41 CFR 101-39.204 - Obtaining motor vehicles for indefinite assignment.

    Science.gov (United States)

    2010-07-01

    ..., TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.2-GSA Interagency Fleet Management... related services of the GSA Interagency Fleet Management System (IFMS) are provided to requesting agencies... have been consolidated into the supporting GSA IFMS fleet management center, and no agency-owned...

  18. 48 CFR 252.204-7004 - Alternate A, Central Contractor Registration.

    Science.gov (United States)

    2010-10-01

    ... information required for the conduct of business with the Government. “Commercial and Government Entity (CAGE) code” means— (1) A code assigned by the Defense Logistics Information Service (DLIS) to identify a..., Inc. (D&B) to identify unique business entities. “Data Universal Numbering System +4 (DUNS+4) number...

  19. 31 CFR 500.204 - Importation of and dealings in certain merchandise.

    Science.gov (United States)

    2010-07-01

    ... the jurisdiction of the United States may not purchase, transport, import, or otherwise deal in or engage in any transaction with respect to any merchandise outside the United States specified in following paragraph (a)(1) of this section. (1) Merchandise the country of origin of which is North Korea...

  20. 8 CFR 204.4 - Amerasian child of a United States citizen.

    Science.gov (United States)

    2010-01-01

    ... marriage certificate, if married, and evidence of the termination of any previous marriages, if applicable... mother or legal guardian must show an understanding of the effects of the release and state before...

  1. 45 CFR 204.1 - Submittal of State plans for Governor's review.

    Science.gov (United States)

    2010-10-01

    ... amendments and long-range program planning projections or other periodic reports thereon. This requirement does not apply to periodic statistical or budget and other fiscal reports. Under this requirement, the Office of the Governor will be afforded a specified period in which to review the material. Any comments...

  2. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (204c-0613-332211)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  3. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (204a-0613-332211)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  4. 24 CFR 1003.204 - Special activities by Community-Based Development Organizations (CBDOs).

    Science.gov (United States)

    2010-04-01

    ... INDIAN HOUSING, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT COMMUNITY DEVELOPMENT BLOCK GRANTS FOR INDIAN... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Special activities by Community... Development Organizations (CBDOs). (a) Eligible activities. The grantee may provide ICDBG funds as grants or...

  5. 25 CFR 161.204 - How are carrying capacities and stocking rates established?

    Science.gov (United States)

    2010-04-01

    ... be based on forage production, range utilization, the application of land management practices, and range improvements in place to achieve uniformity of grazing under sustained yield management principles... agricultural resource management plan and range unit management plan. (b) BIA, with the concurrence of the...

  6. 19 CFR 351.204 - Time periods and persons examined; voluntary respondents; exclusions.

    Science.gov (United States)

    2010-04-01

    ... may limit the investigation by using a method described in subsection (a), (c), or (e) of section 777A...' rates from all-others rate. In calculating an all-others rate under section 705(c)(5) or section 735(c... countervailable subsidy rate of zero or de minimis. (2) Preliminary determinations. In an affirmative preliminary...

  7. 23 CFR 500.204 - TMS components for highway traffic data.

    Science.gov (United States)

    2010-04-01

    ... be available to address traffic data program needs. (d) Short term traffic monitoring. (1) Count data... monitoring shall comply to the data needs identified in § 500.203(a) of this subpart. (2) Vehicle... the test procedure as well as the frequency of testing. Standards of the American Society for Testing...

  8. Coupled-channel analysis for 20.4 MeV energy of p- Zn inelastic ...

    Indian Academy of Sciences (India)

    The major issues in nucleon–nucleus scattering studies are the determination of geome- tries, energy dependencies and deformation parameters of the phenomenological, local, complex optical model potential. Until recently, the gross properties of the optical model potential were deduced mainly from proton scattering ...

  9. 8 CFR 204.2 - Petitions for relatives, widows and widowers, and abused spouses and children.

    Science.gov (United States)

    2010-01-01

    ... is submitted by the purported father of a child or son or daughter born out of wedlock, the father... date will be accorded only to a son or daughter previously eligible as a derivative beneficiary under a... benefits do not extend to an unmarried or married son or daughter of an alien widow or widower. (c) Self...

  10. TU-EF-204-02: Hiigh Quality and Sub-MSv Cerebral CT Perfusion Imaging

    Energy Technology Data Exchange (ETDEWEB)

    Li, Ke; Niu, Kai; Wu, Yijing; Chen, Guang-Hong [University of Wisconsin, Madison, WI (United States)

    2015-06-15

    Purpose: CT Perfusion (CTP) imaging is of great importance in acute ischemic stroke management due to its potential to detect hypoperfused yet salvageable tissue and distinguish it from definitely unsalvageable tissue. However, current CTP imaging suffers from poor image quality and high radiation dose (up to 5 mSv). The purpose of this work was to demonstrate that technical innovations such as Prior Image Constrained Compressed Sensing (PICCS) have the potential to address these challenges and achieve high quality and sub-mSv CTP imaging. Methods: (1) A spatial-temporal 4D cascaded system model was developed to indentify the bottlenecks in the current CTP technology; (2) A task-based framework was developed to optimize the CTP system parameters; (3) Guided by (1) and (2), PICCS was customized for the reconstruction of CTP source images. Digital anthropomorphic perfusion phantoms, animal studies, and preliminary human subject studies were used to validate and evaluate the potentials of using these innovations to advance the CTP technology. Results: The 4D cascaded model was validated in both phantom and canine stroke models. Based upon this cascaded model, it has been discovered that, as long as the spatial resolution and noise properties of the 4D source CT images are given, the 3D MTF and NPS of the final CTP maps can be analytically derived for a given set of processing methods and parameters. The cascaded model analysis also identified that the most critical technical factor in CTP is how to acquire and reconstruct high quality source images; it has very little to do with the denoising techniques often used after parametric perfusion calculations. This explained why PICCS resulted in a five-fold dose reduction or substantial improvement in image quality. Conclusion: Technical innovations generated promising results towards achieving high quality and sub-mSv CTP imaging for reliable and safe assessment of acute ischemic strokes. K. Li, K. Niu, Y. Wu: Nothing to disclose. G.-H. Chen: Research funded, GE Healthcare; Research funded, Siemens AX.

  11. 48 CFR 1852.204-76 - Security requirements for unclassified information technolocgy resources.

    Science.gov (United States)

    2010-10-01

    ... yearly “Classroom Exercises.” “Functional Exercises,” shall be coordinated with the Center CIOs and be... extent required to carry out IT security inspection, investigation, and/or audits to safeguard against..., interim access may be granted pending completion of the required investigation and final access...

  12. 204 Prevalence of Ritual Images in Yoruba Nollywood Films and the ...

    African Journals Online (AJOL)

    Abstract. Studies have shown that a majority of Nollywood movies are a reflection of the Nigerian people's traditional and cultural performances. This study posits that these themes are always explored to reinforce the existing cultural values and beliefs in the society. It is against this backdrop that this the study examined the.

  13. 18 CFR 292.204 - Criteria for qualifying small power production facilities.

    Science.gov (United States)

    2010-04-01

    ... primary energy source of the facility must be biomass, waste, renewable resources, geothermal resources... FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY REGULATIONS UNDER THE PUBLIC UTILITY REGULATORY... production facilities that use the same energy resource, are owned by the same person(s) or its affiliates...

  14. Financing State Governments in Nigeria, 1980-2007 (Pp. 204-215)

    African Journals Online (AJOL)

    Nekky Umera

    variables taken together. Student t-test was used to test for the significance of each explanatory variable contributing to the financing of the state government expenditure profiles in Nigeria because the number of years covered in the research was 28years, which is below thirty. The co-efficient of multiple determinations (R2) ...

  15. 30 CFR 204.205 - How do I obtain accounting and auditing relief?

    Science.gov (United States)

    2010-07-01

    ..., address, phone number, and contact name; and (ii) The specific MMS lease number and agreement number, if... contain: (i) Your company name, MMS-assigned payor code, address, phone number, and contact name; (ii) The MMS lease number and agreement number, if applicable; and (iii) A complete and detailed description of...

  16. CLOSURE REPORT FOR CORRECTIVE ACTION UNIT 204: STORAGE BUNKERS, NEVADA TEST SITE, NEVADA

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-04-01

    Corrective Action Unit (CAU) 330 consists of four Corrective Action Sites (CASs) located in Areas 6, 22, and 23 of the Nevada Test Site (NTS). The unit is listed in the Federal Facility Agreement and Consent Order (FFACO, 1996) as CAU 330: Areas 6, 22, and 23 Tanks and Spill Sites. CAU 330 consists of the following CASs: CAS 06-02-04, Underground Storage Tank (UST) and Piping CAS 22-99-06, Fuel Spill CAS 23-01-02, Large Aboveground Storage Tank (AST) Farm CAS 23-25-05, Asphalt Oil Spill/Tar Release

  17. 49 CFR 174.204 - Tank car delivery of gases, including cryogenic liquids.

    Science.gov (United States)

    2010-10-01

    ... subchapter) may not be delivered and the loaded unit tanks may not be removed from the car frame on carrier..., 1976; Amdt. 174-32, 43 FR 48644, Oct. 19, 1978; Amdt. 174-43, 48 FR 27699, June 16, 1983; 48 FR 50440...

  18. 32 CFR 204.8 - Benefits for which no fee shall be assessed.

    Science.gov (United States)

    2010-07-01

    ... to statutes or Executive Orders. (7) Information from or copies of medical and dental records or x-ray films of patients or former patients of military medical or dental facilities, when such information is required for further medical or dental care, and requests for such data are submitted by an...

  19. 17 CFR 204.76 - Use of credit bureau or consumer reporting agencies.

    Science.gov (United States)

    2010-04-01

    ... EXCHANGE COMMISSION RULES RELATING TO DEBT COLLECTION Miscellaneous: Credit Bureau Reporting, Collection... reporting agencies to the detriment of the debtor's credit rating; and (6) A description of the collection... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Use of credit bureau or...

  20. 17 CFR 275.204-2 - Books and records to be maintained by investment advisers.

    Science.gov (United States)

    2010-04-01

    ...) Electronic storage media, including any digital storage medium or system that meets the terms of this section... legible, true, and complete printout of the record; and (C) Means to access, view, and print the records..., see the List of CFR Sections Affected, which appears in the Finding Aids section of the printed volume...

  1. 41 CFR 50-204.50 - Gases, vapors, fumes, dusts, and mists.

    Science.gov (United States)

    2010-07-01

    ... e Mg/M 3 Silica: Crystalline: Quartz (respirable) 250 f 10mg/M 3 m %SiO2=5 %SiO2=2 Quartz (total... natural diatomaceous earth 20 80mg/M 3 %SiO2 Silicates (less than 1% crystalline silica): Mica 20...-field technics. fThe percentage of crystalline silica in the formula is the amount determined from air...

  2. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  3. δ37Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.

  4. δ³⁷Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine

  5. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  6. An Activin A/BMP2 Chimera, AB204, Displays Bone‐Healing Properties Superior to Those of BMP2

    National Research Council Canada - National Science Library

    Yoon, Byung‐Hak; Esquivies, Luis; Ahn, Chihoon; Gray, Peter C; Ye, Sang‐kyu; Kwiatkowski, Witek; Choe, Senyon

    2014-01-01

    ... is administered in high quantities, but such doses of BMP2 are at the same time associated with undesirable side effects. Therefore, BMP2 substitutes with higher therapeutic potency are needed. BMPs and Activins are dimeric TGF‐β superfamily ligands that signal by binding and assembling type I and type II transmembrane serine/threonine receptor kinases. After l...

  7. C-A2-04: The Geisinger Transitions of Care Initiative: Overview of an Interdisciplinary Quality Improvement Process

    Science.gov (United States)

    Bulger, John B; Maynor, Kenric A; Frazier, Seth

    2010-01-01

    Background: Care transitions between inpatient and outpatient providers are quickly becoming a surrogate marker of quality for care of the hospitalized patient. Almost one in six (17.6%) Medicare patients are readmitted within 30 days of hospital discharge. As a result the Centers for Medicare and Medicaid Services (CMS) is targeting readmissions as a probable marker for both poor quality of care and money going down the drain. The Geisinger Transitions of Care Initiative (TOCI) focuses on creating reliable, sustained change that is broad based, cross platform and applicable to all patients. Methods: Geisinger’s approach to address transitions of care is a team-based model. It begins with nurses screening patients’ readmission risk status using an electronic health record tool developed from national evidence and modified based upon GHS’s local experience. Once a patient identified as high risk is admitted, nursing performs a checklist of activities for early care activation (e.g. screening for the need for post acute infusion) and care management prepares a discharge plan and completes a detailed assessment of the patient’s support environment. On selected units, high risk patients are followed for a month post-discharge using an outpatient care management protocol that leverages telephonic case management and remote monitoring tools that can be customized to the patient’s medical plan. The final core pilot encompasses our transition bundle. This includes automation of primary care physician follow-up appointment scheduling and discharge communication. Results: The pilots were implemented in May and June of 2008. Because of the low frequency of readmissions, we have yet to evaluate whether early promising results are statistically significant. We have been able to demonstrate reliable emergency department screening and transition bundle performance and the reliability of implementing this complex model is improving each month. Approximately 2,000 patients have been discharged from units where the pilots were in operation. Conclusions: The TOCI approach is interdisciplinary at all level’s governance, coordination, and patient care. We believe the methods that are developed and utilized, including specialized screening tools, nursing and care management protocols, interdisciplinary team rounds, discharge protocols and post acute care management strategies, will be essential components of the national strategy to reduce readmissions.

  8. [Radiodiagnosis of orthodontic and dysfunctional anomalies of the stomatognathic system: analysis of a sample of 204 patients].

    Science.gov (United States)

    Scutellari, P N; Capurso, U; Orzincolo, C; Rotolo, L; Calura, G

    1990-12-01

    Two hundred and four subjects (86 males and 118 females), aged 8 to 35 years, with different types of malocclusion, underwent panoramic dental radiography and skull teleradiography. This study was aimed at investigating advantages and limitations of the two radiographic techniques, in view of their use as screening methods. On orthopantomography, inferior interincisive point, menthon (Me), and, bilaterally, gonion (Go) and condilion (Co), were localized so as to allow a model of the right and left jaws to be made. On teleradiography of the skull, in lateral view, Steiner's cephalometric analysis allowed skeletal classes to be evaluated according to ANB angle values. Moreover, major postural parameters relative to the relationship between skull and cervical spine were analyzed: atlanto-occipital distance, cranio-vertebral angle, cervical lordosis, and hyoid triangle. Orthopantomography, though not a reproducible technique, can be considered as a valuable screening method for it allows right and left hemi-jaws to be comparatively measured. Cephalometric analysis of postural data confirmed the frequency of wrong postures in orthodontic patients. From the correlation of mandibular asymmetries and cranio-cervical parameters, the authors observed that asymmetrical patients have many postural problems, just like class II skeletal and dolico-facial types. This finding seems to confirm the mixed (functional and skeletal) etiopathogenesis of mandibular asymmetries.

  9. 204. Crioablación de la fibrilación auricular: 2 años de seguimiento

    Directory of Open Access Journals (Sweden)

    V. Asorey Veiga

    2010-01-01

    Conclusiones: La curación de la FA es posible y segura mediante crioablación, si bien son necesarios estudios más amplios en cuanto a tamaño muestral y seguimiento. Nuestros resultados son similares a los publicados en la literatura.

  10. Guilhem Anelier de Tolosa, "Ara farai, no·m puesc tener" (BdT 204.1)

    OpenAIRE

    Francesco Zambon

    2015-01-01

    Following the publication of Richard E. F. Straub’s study in 1995, his suggestion of dating the four surviving sirventes by Guilhelm Anelier de Tolosa between 1270 and 1285 has generally been accepted; therefore his being identified as the same Guilhelm Anelier de Tolosa who, around 1280, wrote the "Song of the Navarrese War" has also been acknowledged. The present paper, accompanied by the critical edition of "Arai farai", proves the inconsistency of these dates of composition (unacceptable ...

  11. Oahu Hyperspectral Imagery 2000 (204a-0613-272217) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  12. 44 CFR 204.52 - Application and approval procedures for a subgrant under a fire management assistance grant.

    Science.gov (United States)

    2010-10-01

    ... to prepare Project Worksheets (FEMA Form 90-91). (2) The Regional Administrator may request the Principal Advisor to assist in the preparation of Project Worksheets. (3) The State will be the primary...) Preparing a Project Worksheet. (1) Once the Regional Administrator approves an applicant's Request for Fire...

  13. SU-C-204-07: Radiation Therapy as a Potential Treatment for Obesity: Initial Data from a Preclinical Investigation

    Energy Technology Data Exchange (ETDEWEB)

    Pasciak, A; Bradley, Y; Nodit, L; Bourgeois, A; Paxton, B; Arepally, A [University of Tennessee Medical Center, Knoxville, TN (United States)

    2016-06-15

    Purpose: To evaluate the feasibility of Yttrium-90 (90Y) radionuclide therapy as a potential treatment for obesity in a porcine model. As the only appetite-stimulating hormone, localized targeting of ghrelin-producing X/A cells in the fundus of the stomach using 90Y may reduce serum ghrelin levels and decrease hunger. Methods: Under approval of the University of Tennessee IACUC, 8 young female pigs aged 12–13 weeks and weighing 21.8–28.1 Kg were included in this study. Six animals underwent transfemoral angiography as part of a two-day procedure involving: (1) infusion of 99mTc-MAA, followed by nuclear scintigraphy and contrast-enhanced CT for treatment-planning and (2) administration of resin 90Y microspheres into the stomach fundus. Calibrated 90Y activities were infused into the main left gastric and the gastric artery arising from the splenic to yield predetermined fundal absorbed doses. Control animals underwent a sham procedure with saline and contrast. Weekly animal weight and serum ghrelin were measured along with post-euthanasia histologic analyses of mucosal integrity and ghrelin immunoreactive cell-density. Results: 90Y radioembolization was administered to six pigs in dosages from 46.3 to 105.1 MBq resulting in average fundal absorbed doses between 35.5 and 91.9 Gy. No animal showed any signs of pain or GI complication through the duration of the study. Ghrelin immunoreactive cell-density was significantly lower in treated vs. control animals in both the stomach fundus (13.5 vs 34.8, P < 0.05) and body (11.2 vs 19.8, P < 0.05). A trend towards decreased weight gain in treated animals as well as a decrease in explanted stomach volume was also noted. Conclusion: The safety and technical feasibility of radiation therapy using 90Y radioembolization as a potential treatment for obesity has been demonstrated at fundal absorbed doses over 90 Gy. Preliminary data is suggestive of short-term safety and potential efficacy, however, further animal studies are required. Project was funded by SIRTex medical ltd.

  14. 9 CFR 381.204 - Marking of poultry products offered for entry; official import inspection marks and devices.

    Science.gov (United States)

    2010-01-01

    ... official mark. (e) The ordering and manufacture of brands shall be in accordance with the provisions... country of origin, the foreign establishment number, the product name, the number of units, the shipping... privilege will be in effect until there is a final determination in the proceeding. (Approved by the Office...

  15. 29 CFR 825.204 - Transfer of an employee to an alternative position during intermittent leave or reduced schedule...

    Science.gov (United States)

    2010-07-01

    ... State law. Transfer to an alternative position may include altering an existing job to better... 29 Labor 3 2010-07-01 2010-07-01 false Transfer of an employee to an alternative position during... alternative position during intermittent leave or reduced schedule leave. (a) Transfer or reassignment. If an...

  16. TU-H-CAMPUS-TeP2-04: Measurement of Stereotactic Output Factors with DNA Double-Strand Breaks

    Energy Technology Data Exchange (ETDEWEB)

    Cline, K; Obeidat, M; Stathakis, S; Kabat, C; Markovic, M; Papanikolaou, N; Rasmussen, K; Gutierrez, A; Ha, C; Lee, S; Shim, E; Kirby, N [University of Texas HSC SA, San Antonio, TX (United States)

    2016-06-15

    Purpose: Radiotherapy treatment is specified by radiation dose prescriptions, but biological DNA damage actually controls treatment effectiveness. It is impractical to directly measure dose in the clinic, so we measure quantities, such as collected charge, and calculate the relationship to dose. At small fields, such as those in stereotactic radiosurgery (SRS), charged-particle equilibrium (CPE) breaks down and the accuracy of the measurement for delivered dose decreases. By measuring DNA double-strand breaks (DSB) directly, we believe treatment accuracy could improve by providing a more meaningful measurement. Methods: A DNA dosimeter, consisting of magnetic streptavidin beads attached to 4 kilobase pair DNA strands labeled with biotin and fluorescein amidite (FAM) on opposing ends, was suspended in phosphate-buffered saline (PBS). Twenty µL samples were placed in plastic micro-capillary tubes inside a water tank setup and irradiated with 10 cm, 3 cm, 1.25 cm, 0.75 cm, and 0.5 cm radiation field sizes, where the three smallest sizes were cones. After irradiation, the dosimeters were mechanically separated into beads (intact DNA) and supernatant (broken DNA/FAM) using a magnet. The fluorescence was read and the probability of DSB was calculated. This was used to calculate the output factor for an SRS beam and compared to that measured using a diode detector. Results: The output factors relative to a 10 cm field were 0.89±0.07, 0.76±0.08, 0.59±0.04, and 0.78±0.12 for the field sizes of 3 cm, 1.25 cm, 0.75 cm, and 0.5 cm, respectively. Some of the diode measurements do not fall within these uncertainties. Conclusion: This was the first attempt to measure output factors in a water tank with the DNA dosimeter. Although differences compared to the diode were observed, the uncertainty analysis ignored systematic errors. For future work, we will repeat this experiment to quantify and correct systematic errors, such as those caused by positional alignment and sample contamination. This work was funded in part by CPRIT (RP140105).

  17. Enigmas del saber. Historia de aprendices./ Kachinovsky, Alicia. 204 p. Montevideo: Universidad de la República, 2012.

    Directory of Open Access Journals (Sweden)

    Juan Fernández Romar

    2013-11-01

    Full Text Available Lo primero que llama la atención desde las primeras páginas es el nutrido detalle del inventariado temático que se despliega en el índice. Su afán descriptivo nos introducen en un mundo ordenado de conjuntos que exploran cuestiones diversas, que van desde la problemática ontogenética de la actividad escritural infantil (“Aprendices que no aprenden. La prioridad del otro en la escritura” hasta reflexiones y preguntas despertadas por una intervención concreta en un liceo, con las que explora el sentido de un dispositivo ensayado en la enseñanza media (“Espacio curricular abierto. Artesanos del saber”. No obstante, una primera lectura esboza con facilidad varios modos de articulación de los trece capítulos que componen este libro y dibuja diversas vías de ensamblaje de su consustancial heterogeneidad temática en un discurso integrado que ilumine en una dirección.

  18. 8 CFR 204.3 - Orphan cases under section 101(b)(1)(F) of the Act (non-Convention cases).

    Science.gov (United States)

    2010-01-01

    ... substance abuse, sexual or child abuse, or domestic violence, even if it did not result in an arrest or... history of substance abuse, sexual or child abuse, and/or domestic violence and the date of each..., sexual or child abuse, and/or domestic violence, the home study preparer may, nevertheless, make a...

  19. 48 CFR 952.204-76 - Conditional payment of fee or profit-safeguarding restricted data and other classified information.

    Science.gov (United States)

    2010-10-01

    ...-compliance with applicable laws, regulations, and DOE directives actually resulting in, or creating a risk of... import that will be considered second degree: (i) Non-compliance with applicable laws, regulations, and... failures or performance failures of similar import that will be considered third degree: (i) Non-compliance...

  20. Multifrequency radio observations of a SNR in the LMC: The case of SNR J0527-6549 (DEM l204

    Directory of Open Access Journals (Sweden)

    Bozzetto L.M.

    2010-01-01

    Full Text Available We present a detailed study and results of new Australia Telescope Compact Array (ATCA observations of supernova remnant SNR J0527-6549. This Large Magellanic Cloud (LMC object follows a typical supernova remnant (SNR horseshoe morphology with a diameter of D=(66×58±1 pc which is among the largest SNRs in the LMC. Its relatively large size indicates older age while a steeper than expected radio spectral index of α=-0.92±0.11 is more typical of younger and energetic SNRs. Also, we report detections of regions with a high order of polarization at a peak value of ~54%±17% at 6 cm.