
Sample records for astatine 203

  1. Organic chemistry of astatine

    International Nuclear Information System (INIS)

    The paper surveys the investigations on the chemical behaviour of astatine in organic systems and deals with the preparation and identification of its organic compounds. A discussion is given on some of the physico-chemical properties of these compounds determined by extrapolation techniques as well as by direct measurement. The biomedical importance of 211At-labelled compounds is briefly referred to. (authors)

  2. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  3. Astatine-211: production and availability. (United States)

    Zalutsky, Michael R; Pruszynski, Marek


    The 7.2-h half life radiohalogen (211)At offers many potential advantages for targeted α-particle therapy; however, its use for this purpose is constrained by its limited availability. Astatine-211 can be produced in reasonable yield from natural bismuth targets via the (209)Bi(α,2n)(211)At nuclear reaction utilizing straightforward methods. There is some debate as to the best incident α-particle energy for maximizing 211At production while minimizing production of (210)At, which is problematic because of its 138.4-day half life α-particle emitting daughter, (210)Po. The intrinsic cost for producing (211)At is reasonably modest and comparable to that of commercially available (123)I. The major impediment to (211)At availability is attributed to the need for a medium energy α-particle beam for its production. On the other hand, there are about 30 cyclotrons in the world that have the beam characteristics required for (211)At production. PMID:22201707

  4. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211At species, 211At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  5. Dosimetrical considerations in astatine-211 radioimmunotherapy

    International Nuclear Information System (INIS)

    Several dosimetrical quantities have been suggested for use in alpha-particle dosimetry. To evaluate the expected biological effect when using these quantities, a Monte Carlo program was set to register the single-event distribution of both specific energy and alpha-particle track length to a cell nucleus (r=5.6 μm). Distributions were acquired for both 'bound' (simulating the effect of 211At-labelled antibodies bound to antigens on cell surfaces (r=7.0 μm)) as well as 'non-bound' (simulating 211At-labelled antibodies that have not bound to a cell) astatine-211. From these distributions, various theoretical cell survival curves were established for 3 different dosimetrical quantities, i.e. specific energy, number of alpha-particle hits and total track length. The survival curves for all quantities are presented for the corresponding mean absorbed dose in order to facilitate comparisons of the expected effects of using the 3 different quantities for both distributions of 211At decays. The theoretical survival curves presented here could, combined with experiments using 'bound' and 'non-bound' 211At in a single-cell suspension, reveal which dosimetrical quantity is most suitable for 211 At-radioimmunotherapy. (author)

  6. Discovery of the astatine, radon, francium, and radium isotopes


    Fry, C; Thoennessen, M


    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  7. Extraction of astatine isotopes for development of radiopharmaceuticals using a 211Rn-211At generator

    International Nuclear Information System (INIS)

    In order to utilize a 211At isotope, a promising α-emitter for radionuclide therapy, the chemical properties of astatine isotopes are studied. We have examined wet chemistry methods through the distribution ratios of astatine in liquid-liquid extraction. The astatine isotopes have been found to be well extracted into DIPE and MIBK. We observed that the distribution ratio of astatine isotopes increases with concentrations of HCl greater than 3 M, while it decreases with the HCl concentration less than 2 M. The results will be useful for development of the 211Rn-211At generator. (author)

  8. Astatine-211-Labeled Targeted Radiotherapeutics: An Update

    International Nuclear Information System (INIS)

    The heavy halogen 211At was first proposed for use in α-particle targeted radiotherapy more than 30 years ago and continues to be one of the most promising radionuclides for this purpose. Although its 7.2-h half life is not ideal for intravenously administered whole antibodies, it is compatible with the pharmacokinetics of antibody fragments, peptides, aptamers and organic molecules. Its diverse chemistry allows its incorporation into a wide array of targeting vehicles, relying on its chemical similarity to iodine to provide a useful point of departure. On the other hand, the relatively low carbon-astatine bond strength is challenging. In common with the other α-emitters being discussed at this symposium, lack of reliable availability is one of the biggest hurdles in the use of 211At for targeted radiotherapy. However, in the case of 211At, it is not a question of production cost or availability of target material, because 211At can be produced in reasonable yield from natural bismuth targets. Rather, the difficulty is the lack of cyclotrons equipped with the medium energy α-particle beams required for its production. If the infrastructure for producing 211At is to be improved to the stage where 211At-labeled radiopharmaceuticals can have a meaningful impact, several developments must occur. First, the ability to produce clinically relevant levels of 211At that can be shipped to remote locations in chemically tractable form must be demonstrated. Approaches under consideration include compensating for radiolysis-mediated effects and the consideration of alternative chemistries. Second, strategies for compensating for heterogeneities in dose deposition must be developed, hopefully in a way that is compatible with approval for human use. And third, it is essential that more clinical trials be performed with 211At-labeled therapeutics, particularly in settings of minimum residual disease where the radiobiological advantages of α-particles can be best exploited. Our

  9. Scrutinizing "Invisible" astatine: A challenge for modern density functionals. (United States)

    Sergentu, Dumitru-Claudiu; David, Grégoire; Montavon, Gilles; Maurice, Rémi; Galland, Nicolas


    The main-group 6p elements did not receive much attention in the development of recent density functionals. In many cases it is still difficult to choose among the modern ones a relevant functional for various applications. Here, we illustrate the case of astatine species (At, Z = 85) and we report the first, and quite complete, benchmark study on several properties concerning such species. Insights on geometries, transition energies and thermodynamic properties of a set of 19 astatine species, for which reference experimental or theoretical data has been reported, are obtained with relativistic (two-component) density functional theory calculations. An extensive set of widely used functionals is employed. The hybrid meta-generalized gradient approximation (meta-GGA) PW6B95 functional is overall the best choice. It is worth noting that the range-separated HSE06 functional as well as the old and very popular B3LYP and PBE0 hybrid-GGAs appear to perform quite well too. Moreover, we found that astatine chemistry in solution can accurately be predicted using implicit solvent models, provided that specific parameters are used to build At cavities. © 2016 Wiley Periodicals, Inc. PMID:27059181

  10. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A


    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  11. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates. (United States)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Svedhem, Sofia; Lindegren, Sture


    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single cancer cells. A promising radioactive nuclide for this type of therapy is astatine-211. Astatine-211 attached to tumor-specific antibodies as carrier molecules is a system currently under investigation for use in targeted alpha therapy. In the common radiolabeling procedure, astatine is coupled to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies. PMID:26791409

  12. AED 203 Courses Tutorial / indigohelp




    AED 203 Assignment: Science Experiment AED 203 Capstone Discussion Question AED 203 Final Project: Effective Classroom Management Plan AED 203 WEEK 1 ONE DISCUSSION 1 AED 203 WEEK 1 ONE DISCUSSION 2 AED 203 CheckPoint: Room Plan AED 203 CheckPoint: Effective Lesson Plan AED 203 WEEK 3 THREE DISCUSSION 1 AED 203 WEEK 3 THREE DISCUSSION 2 AED 203 CheckPoint: Monitoring Student Progress AED 203 WEEK 5 FIVE DISCUSSION QUESTION 1 AED 203 WEEK 5 FIVE DISC...

  13. Astatine-211: production, injection into monoclonal antibodies radiological effect, possible application to cancer treatment

    International Nuclear Information System (INIS)

    Methods developed in the Laboratory of Nuclear Problems, JINR, for producing astatine-211 and injecting it into monoclonal antibodies are described. The use of its diethylene triamine penta-acetic acid complex is shown to be the most effective method of injecting astatine into a biomolecules. The biological effect of the α-particles emitted from the astatine-211 is investigated using Chinese hamster fibroblasts and Ehrlich carcinoma cells. It is established that the mitotic activity depression, number of degenerating cells, number of cells with chromosome aberrations, and cellular surviving fraction depend on the concentration of the radionuclide in the medium 'in vitro'. The RBE of α-particles in comparison with 60Co γ-rays is 3. Injection of astatine-211 absorbed on tellurium particles into mice with ascitic tumors resulted in prolongation of their life or elimination of the tumors. (author). 39 refs, 7 figs

  14. Measurement of the first ionization potential of astatine by laser ionization spectroscopy


    Rothe, S.; A. N. Andreyev; Antalic, S; Borschevsky, A.; Capponi, L.; Cocolios, T.E.; Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.


    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the io...

  15. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials (United States)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture


    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and physical properties for use in targeted therapies for cancer. Due to the very short range of the emitted α-particles, this therapy is particularly suited to treating occult, disseminated cancers. Astatine is not intrinsically tumour-specific; therefore, it requires an appropriate tumour-specific targeting vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method that combines dry distillation of astatine-211 and a synthesis module for producing radiopharmaceuticals into a process platform. This platform will standardize production of astatinated radiopharmaceuticals, and hence, it will facilitate large clinical studies focused on this promising, but chemically challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies.

  16. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture


    vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method......To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  17. Study of Astatine (III) reactions with O, S and N ligands in solution

    International Nuclear Information System (INIS)

    Full text of publication follows. Astatine (At, Z=85: [Xe]4f145d106s26p5) belongs to the halogen group and is located below iodine in the periodic table. One of its isotopes (211At) appears promising as a therapeutic agent in nuclear medicine (Ref.1) owing to the energy of the alpha particles emitted during the disintegration of its nucleus and its short physical half-life (7.2 h). Since there are no stable isotopes of astatine, the chemistry of this element remains poorly understood. Generally, At is supposed to behave as a halogen (Ref.2) but it has been shown recently in our group that astatine presents a metallic behaviour in aqueous solution: it notably exists as At+ and AtO+ species under the oxidation states +I and +III (Ref.3). At the present time, the number of studies dealing with the complexation properties of the cationic forms of astatine remains limited (Ref.4), owing to its low availability. In this work, we have investigated the reactions of AtO+ species with different hetero-atomic (N, S, O) model ligands. A combined approach based on experimental and theoretical studies has been used (Ref.5). On account of the difficulties of experimental investigations of astatine species, the reactivity of AtO+ was explored using a competition method founded on astatine distributions between two distinct phases. Furthermore, for each AtO+/ ligand complex, the nature of the species formed and the associated thermodynamic constants were determined by computational modeling (DFT calculations). In this framework, an original computational methodology was developed to take into account the specificities of astatine, notably the associated relativistic effects. The computed equilibrium constants have been confronted with the experimental results. This comparison demonstrates an outstanding coherence between experience and theory. Furthermore, the analysis of the results shows a key role of solvent effects on astatine chemistry. Lastly, a specific reactivity for the

  18. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments (209At, 210At, 211At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  19. Astatine-211 Pathway from Radiochemistry to Clinical Investigation

    International Nuclear Information System (INIS)

    Particularly in clinical settings where tumour burden is low and cancers are located in close proximity to essential normal tissue structures, α-particle emitting radionuclides can offer significant advantages for targeted radionuclide therapy. One of the first alpha emitters to be evaluated for this purpose is the 7.2-h half-life radiohalogen Astatine-211 (211At). From a commercialization-potential perspective 211At, is less appealing than the longer half-life alpha particle emitters Radium-223, Actinium-225 and Thorium-227, which have become the focus of many laboratories. However, if methods for providing a better supply of 211At could be developed, this alpha emitter would be the radionuclide of choice for many potential therapeutic applications. With regard to the production of 211At, this can be readily be accomplished by bombarding natural bismuth targets with 28−29.5 MeV alpha particles via the 209Bi(α,2n)211At reaction. The goal is to utilize an alpha particle beam energy that provides the required balance for maximizing 211At production while minimizing creation of 210At, which is problematic because of its 138.4-day half life alpha-particle emitting daughter, 210Po. For most intended clinical applications, alpha particle beam energy of about 29 MeV offers the best compromise between maximizing yield and providing 211At with sufficient radionuclidic purity for clinical use. Clinically relevant levels of 211At have been produced at several institutions using both internal and external cyclotron targets

  20. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach


    Maiti, Moumita; Lahiri, Susanta


    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  1. ECO 203 NEW Tutorial / Uoptutorial




    For more course tutorials visit     ECO 203 Week 1 Question ECO 203 Week 1 DQ 1 Economics Systems ECO 203 Week 1 DQ 2 Role of Government ECO 203 Week 2 Journal Challenges to the American Labor Force ECO 203 Week 2 DQ 1 The Current State of the Economy and Unemployment  ECO 203 Week 2 DQ 2 Who Benefits and Who Loses from Inflation? ECO 203 Week 3 Assignment Efforts to Reduce the Budget Deficit ECO 203 Week 3 Discuss...

  2. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  3. Labelling prospects of astatine-211 with immunoglobulins (IgG): some general considerations

    International Nuclear Information System (INIS)

    The tumour therapeutic potential of the short lived alpha emitting radiohalogen 211At has been already been well recognised in the field of radioimmuno therapy. There is no evidence as such to show that astatine itself is a tumour seeking isotope. Therefore it has to be tagged to tumour seeking compound such as a drug or a protein preferably an antibody (IgG). In this communication, the labelling parameters which are required to be investigated for obtaining a stable product which could be useful as radioimmuno therapeutic agent, are described. (author). 6 refs

  4. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron anity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photodetachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral linewidth of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in o-line tests by the clear observation of the photodetachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148 [1].

  5. Extraction of 211At-astatine from hydrochloric acid solutions by means of TOPO, TBP, and triphenylphosphine

    International Nuclear Information System (INIS)

    The extraction behaviour of astatine was studied under defined conditions from hydrochloride acid solutions (cHCl>0.1 M or 1 and 2M). Therefore other effects like adsorption, reduction or hydrolysis can be excluded. The present work describes the extraction with tri- n- octylphosphinoxide (TOPO), tri- n-butylphosphate (TBP) and tri-phenylphosphine in chloroform. (orig.)

  6. No-carrier-added astatination of N-succinimidyl-3-(tri-n-butylstannyl) benzoate (ATE) via electrophilic destannylation

    International Nuclear Information System (INIS)

    The no-carrier-added synthesis of N-succinimidyl 3-[211At]astato-benzoate from N-succinimidyl 3-(tri-n-butylstannyl)benzoate (ATE) is described. The nature of the solvent in which the 211At was isolated from the target was an important factor influencing both the radiochemical yields and the nature of the incorporated astatine activity. (orig.)

  7. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    211At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At- to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At- anions, but first of all because of the kinetic inertness of low spin rhodium(III) d6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh3+. The experiments related to optimization of the reaction conditions were performed with the 131I, basing on a chemical similarity of I- to At-. The experiments with 211At were then carried out under the conditions found optimal for I-. The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211At-Rh(16-S4-diol) complex

  8. SOC 203 ASH Tutorial course/ Uoptutorial


    Michael Crichton


    For more course tutorials visit   SOC 203 Week 1 DQ 1 The Sociological Imagination SOC 203 Week 1 DQ 2 Homelessness SOC 203 Week 2 DQ 1 Education and Equality SOC 203 Week 2 DQ 2 Title IX SOC 203 Week 2 Final Paper Preparation SOC 203 Week 3 DQ 1 Hate Crimes SOC 203 Week 3 DQ 2 Prisons and the War on Drugs SOC 203 Week 3 The Interconnection of Social Problems SOC 203 Week 4 DQ 1 Gay Parenting SOC 203 Week 4 DQ 2 Reinvent...

  9. SOC 203 ASH Course Tutorial/Tutorialrank




    For more course tutorials visit Tutorial Purchased: 5 Times, Rating: A+   SOC 203 Week 1 DQ 1 The Sociological Imagination SOC 203 Week 1 DQ 2 Homelessness SOC 203 Week 2 DQ 1 Education and Equality SOC 203 Week 2 DQ 2 Title IX SOC 203 Week 2 Final Paper Preparation SOC 203 Week 3 DQ 1 Hate Crimes SOC 203 Week 3 DQ 2 Prisons and the War on Drugs SOC 203 Week 3 The Interconnection of Social Problems SOC 203 We...

  10. ECO 203 ASH course tutorial/tutorialoutlet


    NARESH 34


    For more course tutorials visit   ECO 203 Week 1 DQ 1 Economics Systems ECO 203 Week 1 DQ 2 Role of Government ECO 203 Week 1 Quiz ECO 203 Week 2 DQ 1 The Current State of the Economy and Unemployment ECO 203 Week 2 DQ 2 Who Benefits and Who Loses from Inflation ? ECO 203 Week 2 Quiz ECO 203 Week 3 DQ 1 Government Fiscal Policy ECO 203 Week 3 DQ 2 Budget Deficits and the National Debt ECO 203 Week 3 Assignment Efforts to Reduce t...

  11. 24 CFR 203.203 - Issuance and nature of insured 10-year protection plans. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Issuance and nature of insured 10-year protection plans. 203.203 Section 203.203 Housing and Urban Development Regulations Relating to... Underwriting Procedures Insured Ten-Year Protection Plans (plan) § 203.203 Issuance and nature of insured...

  12. AED 203 uop course tutorial/uop help




    For more course tutorials visit     AED 203 Assignment: Science Experiment AED 203 Capstone Discussion Question AED 203 Final Project: Effective Classroom Management Plan AED 203 WEEK 1 ONE DISCUSSION 1 AED 203 WEEK 1 ONE DISCUSSION 2 AED 203 CheckPoint: Room Plan AED 203 CheckPoint: Effective Lesson Plan AED 203 WEEK 3 THREE DISCUSSION 1 AED 203 WEEK 3 THREE DISCUSSION 2 AED 203 CheckPoint: Monitoring Student Progr...

  13. AED 203 UOP Course Tutorial/TutorialRank




    For more course tutorials visit Tutorial Purchased: 5 Times, Rating: A+ AED 203 Assignment: Science Experiment AED 203 Capstone Discussion Question AED 203 Final Project: Effective Classroom Management Plan AED 203 WEEK 1 ONE DISCUSSION 1 AED 203 WEEK 1 ONE DISCUSSION 2 AED 203 CheckPoint: Room Plan AED 203 CheckPoint: Effective Lesson Plan AED 203 WEEK 3 THREE DISCUSSION 1 AED 203 WEEK 3 THREE DISCUSSION 2 AED 203 CheckPoint: Monitori...

  14. Unexpected Behavior of the Heaviest Halogen Astatine in the Nucleophilic Substitution of Aryliodonium Salts. (United States)

    Guérard, François; Lee, Yong-Sok; Baidoo, Kwamena; Gestin, Jean-François; Brechbiel, Martin W


    Aryliodonium salts have become precursors of choice for the synthesis of (18) F-labeled tracers for nuclear imaging. However, little is known on the reactivity of these compounds with heavy halides, that is, radioiodide and astatide, at the radiotracer scale. In the first comparative study of radiohalogenation of aryliodonium salts with (125) I(-) and (211) At(-) , initial experiments on a model compound highlight the higher reactivity of astatide compared to iodide, which could not be anticipated from the trends previously observed within the halogen series. Kinetic studies indicate a significant difference in activation energy (Ea =23.5 and 17.1 kcal mol(-1) with (125) I(-) and (211) At(-) , respectively). Quantum chemical calculations suggest that astatination occurs via the monomeric form of an iodonium complex whereas iodination occurs via a heterodimeric iodonium intermediate. The good to excellent regioselectivity of halogenation and high yields achieved with diversely substituted aryliodonium salts indicate that this class of compounds is a promising alternative to the stannane chemistry currently used for heavy radiohalogen labeling of tracers in nuclear medicine. PMID:27305065

  15. Main: PPD203 [AT Atlas

    Lifescience Database Archive (English)

    Full Text Available PPD203 PPD2 LED light for Green Fluorescent Protein ... (GFP) detection Development of innovative me ... thods to support membrane protein ... crystallization Hiroaki Kato Graduate School of Ph ...

  16. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei


    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy


    Energy Technology Data Exchange (ETDEWEB)



    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  18. 40 CFR 240.203 - General design. (United States)


    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false General design. 240.203 Section 240.203 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR... design....

  19. 30 CFR 75.203 - Mining methods. (United States)


    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Mining methods. 75.203 Section 75.203 Mineral... SAFETY STANDARDS-UNDERGROUND COAL MINES Roof Support § 75.203 Mining methods. (a) The method of mining... faulty pillar recovery methods. Pillar dimensions shall be compatible with effective control of the...

  20. 24 CFR 203.7 - Commitment process. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Commitment process. 203.7 Section 203.7 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued... Insurance, and Commitments § 203.7 Commitment process. For single family mortgage programs that are...

  1. 50 CFR 223.203 - Anadromous fish. (United States)


    ... pursuant to 50 CFR 223.209 and the government-to-government processes therein that implementing and... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Anadromous fish. 223.203 Section 223.203... Threatened Marine and Anadromous Species § 223.203 Anadromous fish. Available guidance documents cited in...

  2. 12 CFR 203.3 - Exempt institutions. (United States)


    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Exempt institutions. 203.3 Section 203.3 Banks... DISCLOSURE (REGULATION C) § 203.3 Exempt institutions. (a) Exemption based on state law. (1) A state-chartered or state-licensed financial institution is exempt from the requirements of this regulation if...

  3. 47 CFR 97.203 - Beacon station. (United States)


    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Beacon station. 97.203 Section 97.203... SERVICE Special Operations § 97.203 Beacon station. (a) Any amateur station licensed to a holder of a Technician, Technician Plus, General, Advanced or Amateur Extra Class operator license may be a beacon....

  4. 40 CFR 240.203-1 - Requirement. (United States)


    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirement. 240.203-1 Section 240.203-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE THERMAL PROCESSING OF SOLID WASTES Requirements and Recommended Procedures § 240.203-1...

  5. 34 CFR 685.203 - Loan limits. (United States)


    ... academic year, as defined in 34 CFR 668.3. (i) Treatment of Direct Consolidation Loans and Federal... 34 Education 3 2010-07-01 2010-07-01 false Loan limits. 685.203 Section 685.203 Education..., DEPARTMENT OF EDUCATION WILLIAM D. FORD FEDERAL DIRECT LOAN PROGRAM Borrower Provisions § 685.203 Loan...

  6. 40 CFR 203.1 - Definitions. (United States)


    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Definitions. 203.1 Section 203.1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS LOW-NOISE-EMISSION PRODUCTS § 203.1 Definitions. (a) As used in this part, any term not defined herein shall have...

  7. 49 CFR 37.203 - Lift maintenance. (United States)


    ... 49 Transportation 1 2010-10-01 2010-10-01 false Lift maintenance. 37.203 Section 37.203... DISABILITIES (ADA) Over-the-Road Buses (OTRBs) § 37.203 Lift maintenance. (a) The entity shall establish a system of regular and frequent maintenance checks of lifts sufficient to determine if they are...

  8. 50 CFR 648.203 - Gear restrictions. (United States)


    ... Herring Fishery § 648.203 Gear restrictions. (a) Midwater trawl gear may only be used by a vessel issued a... 50 Wildlife and Fisheries 8 2010-10-01 2010-10-01 false Gear restrictions. 648.203 Section 648.203 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND ATMOSPHERIC...

  9. 29 CFR 1614.203 - Rehabilitation Act. (United States)


    ... Commission's ADA regulations at 29 CFR part 1630. ... 29 Labor 4 2010-07-01 2010-07-01 false Rehabilitation Act. 1614.203 Section 1614.203 Labor... EMPLOYMENT OPPORTUNITY Provisions Applicable to Particular Complaints § 1614.203 Rehabilitation Act....

  10. 32 CFR 203.13 - Procurement. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Procurement. 203.13 Section 203.13 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS TECHNICAL ASSISTANCE FOR PUBLIC PARTICIPATION (TAPP) IN DEFENSE ENVIRONMENTAL RESTORATION ACTIVITIES § 203.13 Procurement. Procurements will...

  11. 27 CFR 24.203 - Honey wine. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Honey wine. 24.203 Section 24.203 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Agricultural Wine § 24.203 Honey wine. (a) Subject to paragraph (b) of this section, a winemaker, in...

  12. 7 CFR 1260.203 - Confidential treatment. (United States)


    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Confidential treatment. 1260.203 Section 1260.203 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... Promotion and Research Order Reports, Books and Records § 1260.203 Confidential treatment. All...

  13. 46 CFR 109.203 - Sanitation. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Sanitation. 109.203 Section 109.203 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS OPERATIONS Tests, Drills, and Inspections § 109.203 Sanitation. (a) The master or person in charge shall insure that the...

  14. 1 CFR 20.3 - Organization. (United States)


    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Organization. 20.3 Section 20.3 General... DOCUMENTS HANDLING OF THE UNITED STATES GOVERNMENT MANUAL STATEMENTS § 20.3 Organization. (a) Information about lines of authority and organization may be reflected in a chart if the chart clearly...

  15. 49 CFR 215.203 - Restricted cars. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Restricted cars. 215.203 Section 215.203..., DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Restricted Equipment § 215.203 Restricted cars. (a) This section restricts the operation of any railroad freight car that is— (1) More than...

  16. 24 CFR 904.203 - Planning. (United States)


    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Planning. 904.203 Section 904.203... HOUSING HOMEOWNERSHIP OPPORTUNITIES Homeownership Counseling and Training § 904.203 Planning. (a) The... by contract with an outside organization, or by the LHA staff, in either case with...

  17. 48 CFR 470.203 - Cargo preference. (United States)


    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Cargo preference. 470.203 Section 470.203 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE FOOD ASSISTANCE PROGRAMS COMMODITY ACQUISITIONS 470.203 Cargo preference. An agency having responsibility under this subpart...

  18. 14 CFR 67.203 - Eye. (United States)


    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Eye. 67.203 Section 67.203 Aeronautics and... AND CERTIFICATION Second-Class Airman Medical Certificate § 67.203 Eye. Eye standards for a second-class airman medical certificate are: (a) Distant visual acuity of 20/20 or better in each...

  19. 5 CFR 850.203 - Other elections. (United States)


    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Other elections. 850.203 Section 850.203...) RETIREMENT SYSTEMS MODERNIZATION Applications for Benefits; Elections § 850.203 Other elections. (a) Any other election may be effected in such form as the Director prescribes under § 850.104. Such...

  20. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  1. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian


    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  2. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  3. SOC 203 uop course tutorial/tutorial rank




    For more course tutorials visit Tutorial Purchased: 5 Times, Rating: A+   SOC 203 Week 1 DQ 1 The Sociological Imagination SOC 203 Week 1 DQ 2 Homelessness SOC 203 Week 2 DQ 1 Education and Equality SOC 203 Week 2 DQ 2 Title IX SOC 203 Week 2 Final Paper Preparation SOC 203 Week 3 DQ 1 Hate Crimes SOC 203 Week 3 DQ 2 Prisons and the War on Drugs SOC 203 Week 3 The Interconnection of Social Problems SOC 203 We...

  4. 32 CFR 203.5 - TAPP process. (United States)


    ... to follow the rules and regulations for purchase orders as outlined in the FAR (48 CFR part 13). As a... 32 National Defense 2 2010-07-01 2010-07-01 false TAPP process. 203.5 Section 203.5 National... TAPP process. This section provides an overview of the TAPP process. Specific details referred to...

  5. 41 CFR 50-203.11 - Review. (United States)


    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Review. 50-203.11 Section...-Healey Public Contracts Act § 50-203.11 Review. (a) Within twenty (20) days after service of the decision... administrative law judge an original and four copies of a petition for review of the decision. The petition...

  6. 48 CFR 2424.203 - Policy. (United States)


    ... Policy. See 24 CFR part 15 for the HUD regulations which implement the Freedom of Information Act. ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Policy. 2424.203 Section 2424.203 Federal Acquisition Regulations System DEPARTMENT OF HOUSING AND URBAN...

  7. 42 CFR 1002.203 - Mandatory exclusion. (United States)


    ... 42 Public Health 5 2010-10-01 2010-10-01 false Mandatory exclusion. 1002.203 Section 1002.203 Public Health OFFICE OF INSPECTOR GENERAL-HEALTH CARE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OIG... chapter. (b) As used in this section, the term— Exclude includes the refusal to enter into or renew...

  8. 21 CFR 203.20 - Sales restrictions. (United States)


    ... drug that was: (a) Purchased by a public or private hospital or other health care entity; or (b... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Sales restrictions. 203.20 Section 203.20 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS:...

  9. 32 CFR 203.19 - Appeals process. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Appeals process. 203.19 Section 203.19 National....19 Appeals process. DoD Components will establish an appeals process to settle potential disputes... process. The Department of Defense recognizes that the RAB/TRC may disagree with the findings of...

  10. 33 CFR 203.62 - Drought assistance. (United States)


    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Drought assistance. 203.62... Supplies: Contaminated Water Sources and Drought Assistance § 203.62 Drought assistance. (a) Authority. The... political subdivisions, within areas determined to be drought-distressed. (b) General policy. (1) It is...

  11. 5 CFR 844.203 - Supporting documentation. (United States)


    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Supporting documentation. 844.203 Section... § 844.203 Supporting documentation. (a) An individual or agency filing an application for disability... whatever documentation OPM requires in order to determine whether the individual meets the...

  12. 48 CFR 570.203-2 - Competition. (United States)


    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Competition. 570.203-2... 570.203-2 Competition. (a) Solicit at least three sources to promote competition to the maximum extent practicable. If you have repeated requirements for space in the same market, and if practicable, invite...

  13. 14 CFR 1212.203 - Disclosures. (United States)


    ... Records § 1212.203 Disclosures. (a) The system manager shall keep a disclosure accounting for each... (2) In accordance with § 1212.203(g) (1) and (2), below. (c) The disclosure accounting required by...) The name and address of the recipient person or Agency. (d) The disclosure accounting shall...

  14. 24 CFR 203.34 - Credit standing. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Credit standing. 203.34 Section 203.34 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued....34 Credit standing. A mortgagor must have a general credit standing satisfactory to the Commissioner....

  15. 24 CFR 203.443 - Insurance premium. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance premium. 203.443 Section... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Rehabilitation Loans § 203.443...

  16. 12 CFR 268.203 - Rehabilitation Act. (United States)


    ... Commission's ADA regulation at 29 CFR part 1630. ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Rehabilitation Act. 268.203 Section 268.203... Rehabilitation Act. (a) Model employer. The Board shall be a model employer of individuals with disabilities....

  17. 41 CFR 50-203.8 - Hearing. (United States)


    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Hearing. 50-203.8 Section 50-203.8 Public Contracts and Property Management Other Provisions Relating to Public Contracts..., examine, and cross-examine witnesses and to introduce into the record documentary or other evidence....

  18. 41 CFR 50-203.21 - Decisions. (United States)


    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Decisions. 50-203.21...-Healey Public Contracts Act § 50-203.21 Decisions. (a) Within 30 days after the close of the hearing... record, the Administrative Review Board may issue a tentative decision. The tentative decision...

  19. 37 CFR 203.3 - Organization. (United States)


    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Organization. 203.3 Section... PROCEDURES FREEDOM OF INFORMATION ACT: POLICIES AND PROCEDURES Organization § 203.3 Organization. (a) In... legislative and policy matters. (e) The Office has no field organization. (f) The Office is located in...

  20. 40 CFR 600.203-77 - Abbreviations. (United States)


    ....203-77 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-Procedures for Calculating Fuel Economy Values § 600.203-77 Abbreviations....

  1. 41 CFR 50-203.18 - Evidence. (United States)


    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Evidence. 50-203.18...-Healey Public Contracts Act § 50-203.18 Evidence. (a) Witnesses appearing at the hearing need not be... shall be tendered in quadruplicate. When evidence is embraced in a document containing matter...

  2. 48 CFR 203.1003 - Requirements. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Requirements. 203.1003 Section 203.1003 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL IMPROPER BUSINESS PRACTICES AND PERSONAL CONFLICTS OF INTEREST Contractor Code of Business Ethics and Conduct...

  3. 48 CFR 203.1004 - Contract clauses. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contract clauses. 203.1004 Section 203.1004 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL IMPROPER BUSINESS PRACTICES AND PERSONAL CONFLICTS OF INTEREST Contractor Code of Business Ethics and Conduct...

  4. Stability and in vivo behavior of Rh[16aneS4-diol]211At complex: A potential precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Introduction: The heavy halogen 211At is of great interest for targeted radiotherapy because it decays by the emission of short-range, high-energy α-particles. However, many astatine compounds that have been synthesized are unstable in vivo, providing motivation for seeking other 211At labeling strategies. One relatively unexplored approach is to utilize prosthetic groups based on astatinated rhodium (III) complex stabilized with a tetrathioether macrocyclic ligand – Rh[16aneS4-diol]211At. The purpose of the current study was to evaluate the in vitro and in vivo stability of this complex in comparison to its iodine analog – Rh[16aneS4-diol]131I. Methods: Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I complexes were synthesized and purified by HPLC. The stability of both complexes was evaluated in vitro by incubation in phosphate-buffered saline (PBS) and human serum at different temperatures. The in vivo behavior of the two radiohalogenated complexes was assessed by a paired-label biodistribution study in normal Balb/c mice. Results: Both complexes were synthesized in high yield and purity. Almost no degradation was observed for Rh[16aneS4-diol]131I in PBS over a 72 h incubation. The astatinated analog exhibited good stability in PBS over 14 h. A slow decline in the percentage of intact complex was observed for both tracers in human serum. In the biodistribution study, retention of 211At in most tissues was higher than that of 131I at all time points, especially in spleen and lungs. Renal clearance of Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I predominated, with 84.1 ± 2.3% and 94.6 ± 0.9% of injected dose excreted via the urine at 4 h. Conclusions: The Rh[16aneS4-diol]211At complex might be useful for constructing prosthetic groups for the astatination of biomolecules and further studies are planned to evaluate this possibility

  5. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D., Scott


    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  6. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    International Nuclear Information System (INIS)

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET α-emitter astatine-211 (211At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 (123I), 340-fold for technetium-99m pertechnetate (99mTcO4-) and 60-fold for 211At. Cellular 211At accumulation was found to be dependent on extracellular Na+ ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and 99mTcO4- uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated 211At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and 211At were rapidly (apparent t1/2 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times (123I), 25 times (99mTcO4-) and 10 times (211At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of 123I and 211At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for 123I, 5.2 h for 211At) and preliminary dosimetric calculations indicate high tumour absorbed doses (3.5 Gy/MBqtumour for 131I and 50.3 Gy/MBqtumour for 211At). In

  7. Dicty_cDB: CHS203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHS203 (Link to dictyBase) - - - Contig-U11332-1 - (Link to Or...iginal site) - - CHS203Z 727 - - - - Show CHS203 Library CH (Link to library) Clone ID CHS203 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11332-1 Original site URL http://dictycdb.b...LSYDILSLLDS HLWLKKPLTISPQFLTMIGPELDPTLPNNPFKEFFNKLGTSSHDSGDNIDFKIPSFFEDN SRRHWGVETELSTGSCPICTLSLAENPESSFLGST...SYDILSLLDS HLWLKKPLTISPQFLTMIGPELDPTLPNNPFKEFFNKLGTSSHDSGDNIDFKIPSFFEDN SRRHWGVETELSTGSCPICTLSLAENPESSFLGSTP

  8. 48 CFR 1416.203-4 - Contract clauses. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 1416.203-4 Section 1416.203-4 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR CONTRACTING METHODS AND CONTRACT TYPES TYPES OF CONTRACTS Fixed-Price Contracts 1416.203-4 Contract clauses....

  9. 48 CFR 916.203-4 - Contract clauses. (United States)


    ... accordance with (FAR) 48 CFR 16.203-4. ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 916.203-4 Section 916.203-4 Federal Acquisition Regulations System DEPARTMENT OF ENERGY CONTRACTING...

  10. 20 CFR 702.203 - Employer's report; how given. (United States)


    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Employer's report; how given. 702.203 Section 702.203 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR LONGSHOREMEN'S... Procedures Employer's Reports § 702.203 Employer's report; how given. The employer's report, an original...

  11. 24 CFR 203.37 - Nature of title to realty. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Nature of title to realty. 203.37 Section 203.37 Housing and Urban Development Regulations Relating to Housing and Urban Development... § 203.37 Nature of title to realty. A mortgage, to be eligible for insurance, must be on real...

  12. 5 CFR 2601.203 - Conflict of interest analysis. (United States)


    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Conflict of interest analysis. 2601.203 Section 2601.203 Administrative Personnel OFFICE OF GOVERNMENT ETHICS ORGANIZATION AND PROCEDURES... Acceptance of Gifts § 2601.203 Conflict of interest analysis. (a) A gift shall not be solicited or...

  13. 31 CFR 203.13 - Appeal and dispute resolution. (United States)


    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Appeal and dispute resolution. 203.13 Section 203.13 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL... TAX AND LOAN PROGRAM Electronic Federal Tax Payments § 203.13 Appeal and dispute resolution....

  14. 48 CFR 1336.203 - Government estimate of construction costs. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Government estimate of construction costs. 1336.203 Section 1336.203 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE... Contracting for Construction 1336.203 Government estimate of construction costs. After award, the...

  15. 24 CFR 203.47 - Eligibility of growing equity mortgages. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Eligibility of growing equity mortgages. 203.47 Section 203.47 Housing and Urban Development Regulations Relating to Housing and Urban... Properties § 203.47 Eligibility of growing equity mortgages. A mortgage containing provisions for...

  16. 48 CFR 9.203 - QPL's, QML's, and QBL's. (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false QPL's, QML's, and QBL's. 9.203 Section 9.203 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION ACQUISITION PLANNING CONTRACTOR QUALIFICATIONS Qualifications Requirements 9.203 QPL's, QML's, and QBL's....

  17. 42 CFR 57.203 - Application by school. (United States)


    ... 42 Public Health 1 2010-10-01 2010-10-01 false Application by school. 57.203 Section 57.203 Public... Loans § 57.203 Application by school. (a) Each school seeking a Federal capital contribution must submit... Secretary and the applicant school for a Federal capital contribution under section 721 of the Act...

  18. 48 CFR 1815.203-72 - Risk management. (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Risk management. 1815.203-72 Section 1815.203-72 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND SPACE... Proposals and Information 1815.203-72 Risk management. In all RFPs and RFOs for supplies or services...

  19. 24 CFR 203.261 - Calculation of periodic MIP. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Calculation of periodic MIP. 203.261 Section 203.261 Housing and Urban Development Regulations Relating to Housing and Urban...-Periodic Payment § 203.261 Calculation of periodic MIP. The amount of any periodic MIP shall be...

  20. 33 CFR 203.82 - Requirements of local cooperation. (United States)


    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Requirements of local cooperation. 203.82 Section 203.82 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY... Interests/Cooperation Agreements § 203.82 Requirements of local cooperation. It is Corps policy...

  1. 24 CFR 203.259 - Method of payment of MIP. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Method of payment of MIP. 203.259 Section 203.259 Housing and Urban Development Regulations Relating to Housing and Urban Development... § 203.259 Method of payment of MIP. The payment of any MIP under this subpart shall be made to...

  2. 32 CFR 203.15 - Method of payment. (United States)


    ... ACTIVITIES § 203.15 Method of payment. The SAP set forth in FAR (48 CFR part 13) require purchase orders to... 32 National Defense 2 2010-07-01 2010-07-01 false Method of payment. 203.15 Section 203.15 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE...

  3. 48 CFR 32.203 - Determining contract financing terms. (United States)


    ... financing terms. 32.203 Section 32.203 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Commercial Item Purchase Financing 32.203 Determining contract financing terms. When the criteria in 32.202-1(b) are met, the contracting officer may...

  4. 24 CFR 203.18a - Solar energy system. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Solar energy system. 203.18a... § 203.18a Solar energy system. (a) The dollar limitation provided in § 203.18(a) may be increased by up... to the installation of a solar energy system. (b) Solar energy system is defined as any...

  5. 42 CFR 84.203 - Breathing resistance test; minimum requirements. (United States)


    ... 42 Public Health 1 2010-10-01 2010-10-01 false Breathing resistance test; minimum requirements. 84.203 Section 84.203 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Chemical Cartridge Respirators § 84.203 Breathing resistance test; minimum requirements. (a) Resistance...

  6. 9 CFR 113.203 - Feline Panleukopenia Vaccine, Killed Virus. (United States)


    ... Virus. 113.203 Section 113.203 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.203 Feline Panleukopenia Vaccine, Killed Virus. Feline...

  7. 48 CFR 570.203-1 - Market survey. (United States)


    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Market survey. 570.203-1 Section 570.203-1 Federal Acquisition Regulations System GENERAL SERVICES ADMINISTRATION SPECIAL... 570.203-1 Market survey. Conduct a market survey to identify potential sources. Use...

  8. 32 CFR 48.203 - Election of options. (United States)


    ... 32 National Defense 1 2010-07-01 2010-07-01 false Election of options. 48.203 Section 48.203... RETIRED SERVICEMAN'S FAMILY PROTECTION PLAN Election of Options § 48.203 Election of options. (a) A member... widow, child, or children. To be effective, the election by such a member must be dated,...

  9. 28 CFR 20.3 - Definitions. (United States)


    ... Administration DEPARTMENT OF JUSTICE CRIMINAL JUSTICE INFORMATION SYSTEMS General Provisions § 20.3 Definitions... justice users with respect to the various systems managed by the FBI CJIS Division. (d) Criminal history... such information does not indicate the individual's involvement with the criminal justice system....

  10. 18 CFR 1304.203 - Vegetation management. (United States)


    ... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Vegetation management...-Owned Residential Access Shoreland § 1304.203 Vegetation management. No vegetation management shall be approved on TVA-owned Residential Access Shoreland until a Vegetation Management Plan meeting...

  11. 49 CFR 232.203 - Training requirements. (United States)


    ... EQUIPMENT; END-OF-TRAIN DEVICES Inspection and Testing Requirements § 232.203 Training requirements. (a... refresher training, at an interval not to exceed three years, that includes classroom and “hands-on... to be equipped with a two-way end-of-train telemetry device pursuant to subpart E of this part,...

  12. 43 CFR 17.203 - Discrimination prohibited. (United States)


    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Discrimination prohibited. 17.203 Section... Discrimination prohibited. (a) General. No qualified handicapped person shall, on the basis of handicap, be excluded from participation in, be denied the benefits of, or otherwise be subjected to...

  13. 5 CFR 2606.203 - Granting access. (United States)


    ... include a statement of the procedures to obtain a review of the decision to deny access in accordance with... operational control of the record may require the data subject making the request to submit a signed statement... Access to Records and Accounting of Disclosures § 2606.203 Granting access. (a) The methods for...

  14. 24 CFR 203.342 - Mortgage modification. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage modification. 203.342... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Continuation of Insurance §...

  15. 5 CFR 250.203 - Agency responsibilities. (United States)


    ... MANAGEMENT IN AGENCIES Strategic Human Capital Management § 250.203 Agency responsibilities. (a) To assist in the assessment of the management of human capital in the Federal Government, and to help meet the... annual Human Capital Management Report, as outlined below, based on an approved human...

  16. Tank 241-C-203: Tank characterization plan

    Energy Technology Data Exchange (ETDEWEB)

    Schreiber, R.D.


    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, and WHC 222-S Laboratory. Scope of this plan is to provide guidance for sampling and analysis of samples for tank 241-C-203.

  17. 28 CFR 42.203 - Discrimination prohibited. (United States)


    ... on Employee Selection Guidelines, 28 CFR 50.14. (c) In matters involving employment discrimination... Guidelines on Employee Selection Procedures, 28 CFR 50.14. (e) A recipient, in determining the type of... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Discrimination prohibited. 42.203...

  18. 7 CFR 1220.203 - Nominations. (United States)


    ... CONSUMER INFORMATION Soybean Promotion and Research Order United Soybean Board § 1220.203 Nominations. All... be filled. (e) Nominations may be submitted in order of preference and for the initial Board, in order of preference for staggered terms. Should the Secretary reject any nomination submitted and...

  19. 48 CFR 50.203 - General. (United States)


    ... that will enhance the protection of the nation; and (2) Provide risk management and litigation management protections for sellers of QATTs and others in the supply and distribution chain. (b) The SAFETY....203 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT...

  20. 48 CFR 11.203 - Customer satisfaction. (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Customer satisfaction. 11... PLANNING DESCRIBING AGENCY NEEDS Using and Maintaining Requirements Documents 11.203 Customer satisfaction... reflects the customer's needs and to obtain suggestions for corrective actions. Whenever practicable,...

  1. 20 CFR 404.203 - Definitions. (United States)


    ... Employees' Benefits SOCIAL SECURITY ADMINISTRATION FEDERAL OLD-AGE, SURVIVORS AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts General § 404.203 Definitions. (a) General definitions. As used in this subpart— Ad hoc increase in primary insurance amounts means an increase in primary insurance...

  2. 32 CFR 203.3 - Definitions. (United States)


    ... TECHNICAL ASSISTANCE FOR PUBLIC PARTICIPATION (TAPP) IN DEFENSE ENVIRONMENTAL RESTORATION ACTIVITIES § 203.3... or may be endangered by the release of hazardous substances at the facility. Applicant. Any group of... include a TAPP project description. Assistance provider. An individual, group of individuals, or...

  3. 42 CFR 56.203 - Project elements. (United States)


    ... SERVICES Grants for Planning and Developing Migrant Health Centers § 56.203 Project elements. A project for planning and developing a migrant health center supported under this subpart must: (a) Determine (by survey... loans of cash, services, equipment, full-or part-time staff, space, materials, or facilities....

  4. Proposition 203: A Critical Metaphor Analysis (United States)

    Johnson, Eric


    This project draws on Lakoff and Johnson's (1980) work with metaphor analysis to uncover the rhetorical strategies applied by supporters of the English for the Children organization during the 2000 Arizona Proposition 203 campaign. The data were collected from three sources: (a) "The Arizona Republic"; (b) the "East Valley Tribune"; and (c) the…

  5. 42 CFR 59.203 - Eligibility. (United States)


    ... PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR FAMILY PLANNING SERVICES Grants for Family Planning Service Training § 59.203 Eligibility. (a) Eligible applicants. Any public or... the effective delivery of family planning services: Provided, That the Secretary may in...

  6. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    Energy Technology Data Exchange (ETDEWEB)

    Petrich, T.; Helmeke, H.-J.; Meyer, G.J.; Knapp, W.H.; Poetter, E. [Department of Nuclear Medicine, Medizinische Hochschule Hannover (Germany)


    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET {alpha}-emitter astatine-211 ({sup 211}At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 ({sup 123}I), 340-fold for technetium-99m pertechnetate ({sup 99m}TcO{sub 4}{sup -}) and 60-fold for {sup 211}At. Cellular {sup 211}At accumulation was found to be dependent on extracellular Na{sup +} ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and {sup 99m}TcO{sub 4}{sup -} uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated {sup 211}At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and {sup 211}At were rapidly (apparent t{sub 1/2} 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times ({sup 123}I), 25 times ({sup 99m}TcO{sub 4}{sup -}) and 10 times ({sup 211}At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of {sup 123}I and {sup 211}At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for {sup 123}I, 5.2 h for {sup 211}At) and

  7. Milk secretion of 203Hg after administration of 203Hg-methylmercuric chloride and its metabolism in lactating goats

    International Nuclear Information System (INIS)

    In order to study the mechanism of milk contamination with mercury compounds, a single dose of 203Hg-labeled methylmercury chloride was administered intravenously to three lactating goats. The secretion into milk, and urinary and fecal excretion of 203Hg were determined for 21 days after the administration. The 203Hg concentration in milk reached the highest level of 7 x 10-1 ppm 7 hr. after the administration, followed by slow decrease with time to 2 x 10-1 ppm 21 days after the administration. The total amount of 203Hg secreted into milk for 21 days reached 0.4% of the dose. 203Hg distribution in cream, casein and whey was 0.2, 0.1 and 0.09% of the dose, respectively. 203Hg was mainly excreted into feces, and amounted 29% of the dose for 21 days, whereas 2.3% was excreted into urine. The 203Hg level in blood cells was larger than blood serum. Among the organs of the animals sacrificed 21 days after the administration, kidney showed the highest concentration of 0.01%/g, while liver had the largest distribution of 6% of the dose. Further, the biological half-life of 203Hg after the administration of 203Hg-labeled methylmercury chloride was calculated to be 40.5 days in the lactating goats. (Kobatake, H.)

  8. 15 CFR 2011.203 - Issuance of specialty sugar certificates. (United States)


    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Issuance of specialty sugar certificates. 2011.203 Section 2011.203 Commerce and Foreign Trade Regulations Relating to Foreign Trade Agreements OFFICE OF THE UNITED STATES TRADE REPRESENTATIVE ALLOCATION OF TARIFF-RATE QUOTA ON...

  9. 24 CFR 203.382 - Cancellation of hazard insurance. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Cancellation of hazard insurance. 203.382 Section 203.382 Housing and Urban Development Regulations Relating to Housing and Urban... Cancellation of hazard insurance. The mortgagee shall cancel any hazard insurance policy as of the date of...

  10. Production of 203Pb by proton irradiation of Bi

    International Nuclear Information System (INIS)

    Production of lead-203 by proton irradiation of bismuth metal has been investigated as a replacement method for commercially available lead-203. Targets of bismuth metal (0.1 cm thick) were irradiated for periods of 1-3 hours with 90 MeV protons. After processing of the target, the estimated yield of lead-2-3 was 30 millicuries/microamp

  11. 48 CFR 236.203 - Government estimate of construction costs. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Government estimate of...-ENGINEER CONTRACTS Special Aspects of Contracting for Construction 236.203 Government estimate of construction costs. Follow the procedures at PGI 236.203 for handling the Government estimate of...

  12. 48 CFR 23.203 - Energy-efficient products. (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Energy-efficient products. 23.203 Section 23.203 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SOCIOECONOMIC PROGRAMS ENVIRONMENT, ENERGY AND WATER EFFICIENCY, RENEWABLE ENERGY TECHNOLOGIES, OCCUPATIONAL SAFETY, AND DRUG-FREE WORKPLACE Energy and...

  13. 33 CFR 203.51 - Levee owner's manual. (United States)


    ... Maintenance Manual specified by 33 CFR 208.10(a)(10) will fulfill the requirement of providing a levee owner's... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Levee owner's manual. 203.51... Program § 203.51 Levee owner's manual. (a) Authority. In accordance with section 202(f) of Public Law...

  14. 31 CFR 203.10 - Electronic payment methods. (United States)


    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Electronic payment methods. 203.10... TAX AND LOAN PROGRAM Electronic Federal Tax Payments § 203.10 Electronic payment methods. (a) General. Electronic payment methods for Federal tax payments available under this subpart include ACH debit...

  15. 41 CFR 105-54.203-2 - Active charters file. (United States)


    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Active charters file. 105-54.203-2 Section 105-54.203-2 Public Contracts and Property Management Federal Property Management... charters file. The GSA Committee Management Officer retains each original signed charter in a file...

  16. 48 CFR 5416.203-4 - Contract clauses. (United States)


    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Contract clauses. 5416.203... DEFENSE TYPES OF CONTRACTS Fixed Price Contracts 5416.203-4 Contract clauses. (S-90) When the contracting... reported or made available in a consistent manner in a publication, electronic database, or other form,...

  17. 31 CFR 203.19 - Sources of balances. (United States)


    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Sources of balances. 203.19 Section 203.19 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE PAYMENT OF FEDERAL TAXES AND THE...

  18. 48 CFR 352.203-70 - Anti-lobbying. (United States)


    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Anti-lobbying. 352.203-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 352.203-70 Anti-lobbying. As prescribed in 303.808-70, the Contracting Officer shall insert the following clause: Anti-Lobbying...

  19. 24 CFR 203.255 - Insurance of mortgage. (United States)


    ... obligations under § 203.10 concerning informed consumer choice for prospective FHA mortgagors); (4) Not... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance of mortgage. 203.255... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER...

  20. 12 CFR 303.203 - Applications for capital distributions. (United States)


    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Applications for capital distributions. 303.203 Section 303.203 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION PROCEDURE AND RULES OF PRACTICE... institution's financial obligations or otherwise improve its financial condition. If the proposed action...

  1. 10 CFR 63.203 - Implementation of Subpart K. (United States)


    ... 10 Energy 2 2010-01-01 2010-01-01 false Implementation of Subpart K. 63.203 Section 63.203 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN A GEOLOGIC... Implementation of Subpart K. DOE must demonstrate that normal operations at the Yucca Mountain site will and...

  2. 24 CFR 203.554 - Enforcement of late charges. (United States)


    ... on the part of the mortgagor is the failure to pay a late charge or charges (§ 203.25), except as provided in § 203.556. (b) A late charge attributable to a particular installment payment due under the... mortgagor of his obligation to pay a late charge, such a charge may be deducted from any subsequent...

  3. 9 CFR 205.203 - Place of filing EFS. (United States)


    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Place of filing EFS. 205.203 Section 205.203 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE CLEAR TITLE-PROTECTION FOR PURCHASERS OF...

  4. 24 CFR 203.316 - Termination by prepayment of mortgage. (United States)


    ... mortgage. 203.316 Section 203.316 Housing and Urban Development Regulations Relating to Housing and Urban... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Termination of Insurance...

  5. 48 CFR 1326.203 - Transition of work. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Transition of work. 1326.203 Section 1326.203 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE SOCIOECONOMIC... work. The designee authorized to determine that transitioning response, relief, and/or...

  6. 48 CFR 26.203 - Transition of work. (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Transition of work. 26.203... PROGRAMS OTHER SOCIOECONOMIC PROGRAMS Disaster or Emergency Assistance Activities 26.203 Transition of work... emergency response work to local firms (e.g., unnecessarily broad scopes of work or long periods...

  7. Dicty_cDB: SSE203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSE203 (Link to dictyBase) - - - Contig-U12218-1 SSE203P (Link to Original ... kkkkkkkkkkkkkkkkkkkkk Frame C: fllnn**vnhyllli*iql*mlp *kv*mpiqfidyq*ltmtvi*kelsqiei*d*qlihh ffqrimkidwkn* ...

  8. Dicty_cDB: SSH203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH203 (Link to dictyBase) - - - Contig-U02469-1 SSH203E (Link to Original ... CP000901_3200( CP000901 |pid:none) Yersinia pestis Angola , complet... 37 0.16 AF303741_314( AF303741 |pid:no ...

  9. 24 CFR 203.400 - Method of payment. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Method of payment. 203.400 Section... FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Payment of Insurance Benefits § 203.400 Method of payment. If the application for insurance benefits is acceptable to the Commissioner payment...

  10. 42 CFR 447.203 - Documentation of payment rates. (United States)


    ... (CONTINUED) MEDICAL ASSISTANCE PROGRAMS PAYMENTS FOR SERVICES Payment Methods: General Provisions § 447.203 Documentation of payment rates. (a) The agency must maintain documentation of payment rates and make it... 42 Public Health 4 2010-10-01 2010-10-01 false Documentation of payment rates. 447.203 Section...

  11. Dicty_cDB: SLF203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLF203 (Link to dictyBase) - - - Contig-U16200-1 SLF203Z (Link to Original ... qriprcrktrnrlqesqersc**ttttsyc*krsp*tpq*n litqrch**vtt *sr*dqt*ignrncqqnrnakkdgrflwwfqslnqfdffliqc*kkky yk ...

  12. 48 CFR 203.570-3 - Contract clause. (United States)


    ..., DEPARTMENT OF DEFENSE GENERAL IMPROPER BUSINESS PRACTICES AND PERSONAL CONFLICTS OF INTEREST Other Improper Business Practices 203.570-3 Contract clause. Use the clause at 252.203-7001, Prohibition on Persons... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contract clause....

  13. 49 CFR 1540.203 - Security threat assessment. (United States)


    ... check conducted by TSA. (2) A security threat assessment conducted under 49 CFR part 1572 for the... 49 Transportation 9 2010-10-01 2010-10-01 false Security threat assessment. 1540.203 Section 1540... Security Threat Assessments § 1540.203 Security threat assessment. (a) Each operator subject to...

  14. 48 CFR 28.203-3 - Acceptance of real property. (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Acceptance of real property. 28.203-3 Section 28.203-3 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION... administrative costs of the Government, including legal fees, associated with the liquidation of pledged...

  15. 14 CFR 1216.203 - Definition of key terms. (United States)


    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Definition of key terms. 1216.203 Section 1216.203 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION ENVIRONMENTAL QUALITY... saturated soil conditions for growth and reproduction. Wetlands generally include swamps, marshes, bogs,...

  16. 48 CFR 852.203-70 - Commercial advertising. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Commercial advertising. 852.203-70 Section 852.203-70 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS... solicitation, he/she will not advertise the award of the contract in his/her commercial advertising in such...

  17. 48 CFR 552.203-71 - Restriction on Advertising. (United States)


    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Restriction on Advertising. 552.203-71 Section 552.203-71 Federal Acquisition Regulations System GENERAL SERVICES ADMINISTRATION CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses...

  18. Equilibrium and pre-equilibrium emissions in proton-induced reactions on 203,205Tl

    Indian Academy of Sciences (India)

    A Kaplan; A Aydin; E Tel; B Şarer


    In this study, the excitation functions for the reactions 203Tl(, )203Pb, 203Tl(, 3)203Pb, 203Tl(, 2)202Pb, 205Tl(, 4)202Pb, 203Tl(, 3)201Pb, 205Tl(, 5)201Pb, 203Tl(, 4)200Pb and 205Tl(, 6)200Pb have been calculated using pre-equilibrium and equilibrium reaction mechanisms. Calculated results based on hybrid model, geometry-dependent hybrid model and cascade-exciton model have been compared with the experimental data.

  19. Durable donor engraftment after radioimmunotherapy using α-emitter astatine-211-labeled anti-CD45 antibody for conditioning in allogeneic hematopoietic cell transplantation. (United States)

    Chen, Yun; Kornblit, Brian; Hamlin, Donald K; Sale, George E; Santos, Erlinda B; Wilbur, D Scott; Storer, Barry E; Storb, Rainer; Sandmaier, Brenda M


    To reduce toxicity associated with external γ-beam radiation, we investigated radioimmunotherapy with an anti-CD45 mAb labeled with the α-emitter, astatine-211 ((211)At), as a conditioning regimen in dog leukocyte antigen-identical hematopoietic cell transplantation (HCT). Dose-finding studies in 6 dogs treated with 100 to 618 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) without HCT rescue demonstrated dose-dependent myelosuppression with subsequent autologous recovery, and transient liver toxicity in dogs treated with (211)At doses less than or equal to 405 μCi/kg. Higher doses of (211)At induced clinical liver failure. Subsequently, 8 dogs were conditioned with 155 to 625 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) before HCT with dog leukocyte antigen-identical bone marrow followed by a short course of cyclosporine and mycophenolate mofetil immunosuppression. Neutropenia (1-146 cells/μL), lymphopenia (0-270 cells/μL), and thrombocytopenia (1500-6560 platelets/μL) with prompt recovery was observed. Seven dogs had long-term donor mononuclear cell chimerism (19%-58%), whereas 1 dog treated with the lowest (211)At dose (155 μCi/kg) had low donor mononuclear cell chimerism (5%). At the end of follow-up (18-53 weeks), only transient liver toxicity and no renal toxicity had been observed. In conclusion, conditioning with (211)At-labeled anti-CD45 mAb is safe and efficacious and provides a platform for future clinical trials of nonmyeloablative transplantation with radioimmunotherapy-based conditioning. PMID:22134165

  20. 30 CFR 203.78 - Do I keep relief approved by MMS under §§ 203.60-203.77 for my lease, unit or project if prices... (United States)


    ....77 for my lease, unit or project if prices rise significantly? If prices rise above a base price....60-203.77 for my lease, unit or project if prices rise significantly? 203.78 Section 203.78 Mineral... prescribed in this section. (a) The following table shows the base price threshold for various types...

  1. 27 CFR 555.203 - Types of magazines. (United States)


    ... EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Storage § 555.203 Types of magazines. For...) Type 2 magazines. Mobile and portable indoor and outdoor magazines for the storage of high...

  2. 18 CFR 701.203 - Schedule of fees. (United States)


    ... ORGANIZATION Availability of Information § 701.203 Schedule of fees. (a) The Public Information Officer will to... requester is advised promptly upon physical receipt of the request of the anticipated cost and agrees...

  3. 30 CFR 20.3 - Application procedures and requirements. (United States)


    ..., EVALUATION, AND APPROVAL OF MINING PRODUCTS ELECTRIC MINE LAMPS OTHER THAN STANDARD CAP LAMPS § 20.3... accrediting organization; (2) Complete technical explanation of how the product complies with each...

  4. 46 CFR 108.203 - Berths and lockers. (United States)


    ... EQUIPMENT Construction and Arrangement Accommodation Spaces § 108.203 Berths and lockers. (a) Each sleeping... pipe, ventilating duct, or other overhead installation. (i) Each berth must have a berth light....

  5. Distribution of lead-203 in human peripheral blood in vitro

    International Nuclear Information System (INIS)

    In-vitro experiments using 203Pb were performed to identify the lead binding components in human peripheral blood. The distribution of lead in plasma, in the red cell membrane, and within the red cell was also investigated. Studies of the distribution of 203Pb in the whole blood showed that at a lead concentration of 2.45 μmol/l (50 μg/100 ml) about 94% of lead had been incorporated by the erythrocytes and 6% remained in the plasma. After extraction of lipid by a methanol/chloroform mixture, about 75% of the lead was found to be associated with the protein fraction. The lipid contained about 21% of the 203Pb, the remainder being in the aqueous plasma. SDS polyacrylamide gel electrophoresis of blood plasma showed that almost 90% of the 203Pb was present in the albumin fraction; the remainder was likely to be associated with high molecular weight globulins. Several binding sites were identified on the erythrocyte membrane. The high molecular weight component, about 130 000-230 000, was the most important 203Pb binding site. Chemical modification of membrane proteins suggested that the carboxyl groups are the major ligand responsible for most of the lead binding. SH groups of the membrane may have a minor role, but amino groups did not appear to affect the lead binding. The binding of lead to erythrocytes was not confined to membranes, over 80% of lead in blood penetrates into erythrocytes and binds to intracellular components. Gel chromatography of the haemolysate showed that over 90% of the 203Pb was attached to the haemoglobin molecule. (author)

  6. 78 FR 20168 - Twenty Fourth Meeting: RTCA Special Committee 203, Unmanned Aircraft Systems (United States)


    ...: Meeting Notice of RTCA Special Committee 203, Unmanned Aircraft Systems. SUMMARY: The FAA is issuing this... Document--Operational Functional Requirements and Safety Objectives for Unmanned Aircraft Systems and... Federal Aviation Administration Twenty Fourth Meeting: RTCA Special Committee 203, Unmanned...

  7. Tank 241-B-203 push mode core sampling and analysis plan. Revision 1

    International Nuclear Information System (INIS)

    This Sampling and Analysis Plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for two push-mode core samples from tank 241-B-203 (B-203)

  8. 24 CFR 203.420 - Nature of Mutual Mortgage Insurance Fund. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Nature of Mutual Mortgage Insurance Fund. 203.420 Section 203.420 Housing and Urban Development Regulations Relating to Housing and Urban... and Distributive Shares § 203.420 Nature of Mutual Mortgage Insurance Fund. The Mutual...

  9. 77 FR 25781 - Twenty-First Meeting: RTCA Special Committee 203, Unmanned Aircraft Systems (United States)


    ...: Meeting Notice of RTCA Special Committee 203, Unmanned Aircraft Systems. SUMMARY: The FAA is issuing this notice to advise the public of the twenty-first meeting of RTCA Special Committee 203, Unmanned Aircraft... Federal Aviation Administration Twenty-First Meeting: RTCA Special Committee 203, Unmanned...

  10. 77 FR 3029 - Twentieth Meeting: RTCA Special Committee 203, Unmanned Aircraft Systems (United States)


    ... Federal Aviation Administration Twentieth Meeting: RTCA Special Committee 203, Unmanned Aircraft Systems... RTCA Special Committee 203, Unmanned Aircraft Systems. SUMMARY: The FAA is issuing this notice to advise the public of the twentieth meeting of RTCA Special Committee 203, Unmanned Aircraft...

  11. 77 FR 50207 - Twenty-Second Meeting: RTCA Special Committee 203, Unmanned Aircraft Systems (United States)


    ...: Meeting notice of RTCA Special Committee 203, Unmanned Aircraft Systems. SUMMARY: The FAA is issuing this notice to advise the public of the twenty-second meeting of RTCA Special Committee 203, Unmanned Aircraft... Federal Aviation Administration Twenty-Second Meeting: RTCA Special Committee 203, Unmanned...

  12. 47 CFR 54.203 - Designation of eligible telecommunications carriers for unserved areas. (United States)


    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Designation of eligible telecommunications carriers for unserved areas. 54.203 Section 54.203 Telecommunication FEDERAL COMMUNICATIONS COMMISSION... Support § 54.203 Designation of eligible telecommunications carriers for unserved areas. (a) If no...

  13. 14 CFR 203.3 - Filing requirements for adherence to Montreal Agreement. (United States)


    ... Montreal Agreement. 203.3 Section 203.3 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF... DEFENSES § 203.3 Filing requirements for adherence to Montreal Agreement. All direct U.S. and foreign air... liability limitations of the Warsaw Convention and Hague Protocol approved by CAB Order E-23680, dated...

  14. 24 CFR 3280.203 - Flame spread limitations and fire protection requirements. (United States)


    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Flame spread limitations and fire protection requirements. 3280.203 Section 3280.203 Housing and Urban Development Regulations Relating to... Fire Safety § 3280.203 Flame spread limitations and fire protection requirements. (a) Establishment...

  15. 5 CFR 581.203 - Information minimally required to accompany legal process. (United States)


    ... accompany legal process. 581.203 Section 581.203 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT... Process § 581.203 Information minimally required to accompany legal process. (a) Sufficient identifying information must accompany the legal process in order to enable processing by the governmental entity...

  16. 5 CFR 582.203 - Information minimally required to accompany legal process. (United States)


    ... accompany legal process. 582.203 Section 582.203 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS COMMERCIAL GARNISHMENT OF FEDERAL EMPLOYEES' PAY Service of Legal Process § 582.203 Information minimally required to accompany legal process. (a) Sufficient...

  17. 33 CFR 203.61 - Emergency water supplies due to contaminated water source. (United States)


    ... Water Act (see 40 CFR 141), is exceeded. (ii) The water supply has been identified as a source of... contaminated water source. 203.61 Section 203.61 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT... PROCEDURES Emergency Water Supplies: Contaminated Water Sources and Drought Assistance § 203.61...

  18. 24 CFR 203.345 - Postponement of principal payments-mortgagors in military service. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Postponement of principal payments-mortgagors in military service. 203.345 Section 203.345 Housing and Urban Development Regulations Relating to... Forbearance Relief for Military Personnel § 203.345 Postponement of principal payments—mortgagors in...

  19. 30 CFR 203.85 - What is in an economic viability and relief justification report? (United States)


    ... justification report? 203.85 Section 203.85 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE... Required Reports § 203.85 What is in an economic viability and relief justification report? This report... economic viability and relief justification report must contain the following items for an oil and...

  20. 30 CFR 203.84 - What is in a net revenue and relief justification report? (United States)


    ... 30 CFR 220.013 or: (1) OCS rental payments on the lease(s) in the application; (2) Damages and losses... justification report? 203.84 Section 203.84 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE... Required Reports § 203.84 What is in a net revenue and relief justification report? This report...

  1. 24 CFR 203.422 - Right and liability under Mutual Mortgage Insurance Fund. (United States)


    ... Mortgage Insurance Fund and Distributive Shares § 203.422 Right and liability under Mutual Mortgage... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Right and liability under Mutual Mortgage Insurance Fund. 203.422 Section 203.422 Housing and Urban Development Regulations Relating...

  2. 24 CFR 4001.203 - Calculation of upfront and annual mortgage insurance premiums for Program mortgages. (United States)


    ... mortgage insurance premiums for Program mortgages. 4001.203 Section 4001.203 Housing and Urban Development....203 Calculation of upfront and annual mortgage insurance premiums for Program mortgages. (a) Applicable premiums. Any mortgage presented for endorsement under section 257 on or after October 1,...

  3. 18 CFR 382.203 - Annual charges under the Interstate Commerce Act. (United States)


    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Annual charges under the Interstate Commerce Act. 382.203 Section 382.203 Conservation of Power and Water Resources FEDERAL... § 382.203 Annual charges under the Interstate Commerce Act. (a) The adjusted costs of administration...

  4. 48 CFR 12.203 - Procedures for solicitation, evaluation, and award. (United States)


    ... solicitation, evaluation, and award. 12.203 Section 12.203 Federal Acquisition Regulations System FEDERAL... Acquisition of Commercial Items 12.203 Procedures for solicitation, evaluation, and award. Contracting... conjunction with the policies and procedures for solicitation, evaluation and award prescribed in part...

  5. 14 CFR 1252.203 - Special benefits for children and the elderly. (United States)


    ... elderly. 1252.203 Section 1252.203 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION... Determining Age Discrimination § 1252.203 Special benefits for children and the elderly. If a recipient operating a program or activity provides special benefits to the elderly or to children, such use of...

  6. 33 CFR 203.47 - Modifications to non-Federal flood control works. (United States)


    ... flood control works. 203.47 Section 203.47 Navigation and Navigable Waters CORPS OF ENGINEERS... DISASTER PROCEDURES Rehabilitation Assistance for Flood Control Works Damaged by Flood or Coastal Storm: The Corps Rehabilitation and Inspection Program § 203.47 Modifications to non-Federal flood...

  7. 33 CFR 203.44 - Rehabilitation of non-Federal flood control works. (United States)


    ... flood control works. 203.44 Section 203.44 Navigation and Navigable Waters CORPS OF ENGINEERS... DISASTER PROCEDURES Rehabilitation Assistance for Flood Control Works Damaged by Flood or Coastal Storm: The Corps Rehabilitation and Inspection Program § 203.44 Rehabilitation of non-Federal flood...

  8. 29 CFR 825.203 - Scheduling of intermittent or reduced schedule leave. (United States)


    ... 29 Labor 3 2010-07-01 2010-07-01 false Scheduling of intermittent or reduced schedule leave. 825.203 Section 825.203 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT... Family and Medical Leave Act § 825.203 Scheduling of intermittent or reduced schedule leave....

  9. 24 CFR 203.43e - Eligibility of mortgages covering houses in federally impacted areas. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Eligibility of mortgages covering houses in federally impacted areas. 203.43e Section 203.43e Housing and Urban Development Regulations... Requirements and Underwriting Procedures Eligible Properties § 203.43e Eligibility of mortgages covering...

  10. 48 CFR 627.203 - Patent indemnification of Government by contractor. (United States)


    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Patent indemnification of Government by contractor. 627.203 Section 627.203 Federal Acquisition Regulations System DEPARTMENT OF STATE GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Patents 627.203 Patent indemnification...

  11. 48 CFR 52.203-13 - Contractor Code of Business Ethics and Conduct. (United States)


    ... Business Ethics and Conduct. 52.203-13 Section 52.203-13 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.203-13 Contractor Code of Business Ethics and Conduct. As prescribed in 3.1004(a), insert the following clause: Contractor Code of Business Ethics and Conduct (APR 2010) (a)...

  12. 30 CFR 203.72 - Can my lease receive more than one suspension volume? (United States)


    ... volume? 203.72 Section 203.72 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR... receive more than one suspension volume? Yes. You may apply for royalty relief that involves more than one suspension volume under § 203.62 in two circumstances. (a) Each field that includes your lease may receive...

  13. 46 CFR 16.203 - Employer, MRO, and SAP responsibilities. (United States)


    ... meet the training requirements and follow the procedures in 49 CFR Part 40. (2) MROs may report... and follow the procedures in 49 CFR Part 40. ... 46 Shipping 1 2010-10-01 2010-10-01 false Employer, MRO, and SAP responsibilities. 16.203...

  14. 47 CFR 80.203 - Authorization of transmitters for licensing. (United States)


    ... radio transmitters requested by station applicants or licensees must also follow the certification... certification of all marine radio transmitters operating in the 2-27.5 MHz band or the 156-162 MHz band received... RADIO SERVICES STATIONS IN THE MARITIME SERVICES General Technical Standards § 80.203 Authorization...

  15. 48 CFR 836.203 - Government estimate of construction costs. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Government estimate of... Contracting for Construction 836.203 Government estimate of construction costs. The overall amount of the Government estimate must not be disclosed until after award of the contract. After award, the...

  16. 48 CFR 436.203 - Government estimate of construction costs. (United States)


    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Government estimate of... Contracting for Construction 436.203 Government estimate of construction costs. For acquisitions using sealed bid procedures, the contracting officer may disclose the overall amount of the Government's...

  17. 27 CFR 31.203 - Possession of used liquor bottles. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Possession of used liquor... BUREAU, DEPARTMENT OF THE TREASURY LIQUORS ALCOHOL BEVERAGE DEALERS Reuse and Possession of Used Liquor Bottles § 31.203 Possession of used liquor bottles. The possession of used liquor bottles by any...

  18. 12 CFR Supplement I to Part 203 - Staff Commentary (United States)


    ... to the exemption from Regulation X (Real Estate Settlement Procedures, 24 CFR 3500.5(b)(1)) for a... Affairs of the Federal Reserve Board issues formal staff interpretations of Regulation C (12 CFR part 203... meanings in certain parts of the mortgage lending industry, and other terms may be used in place of...

  19. 31 CFR 203.20 - Investment account requirements. (United States)


    ... collector depositaries that accept term investments, investor depositaries, or retainer depositaries. Such... § 203.16(a) for an investor or retainer depositary processing tax deposits through PATAX. (2) EFTPS—(i... procedural instructions. (e) Balance limits—(1) Retainer and investor depositaries. A retainer or...

  20. 30 CFR 203.49 - May I substitute the deep gas drilling provisions in § 203.0 and §§ 203.40 through 203.47 for the... (United States)


    ... Relief for Drilling Deep Gas Wells on Leases Not Subject to Deep Water Royalty Relief § 203.49 May I... water less than 200 meters deep. (b) To exercise the option under paragraph (a) of this section, you... 30 Mineral Resources 2 2010-07-01 2010-07-01 false May I substitute the deep gas...

  1. 47 CFR 25.203 - Choice of sites and frequencies. (United States)


    ... facilities operating in the 25.05-25.25 GHz band may be licensed only in Economic Areas where no existing FS.... Editorial Note: For Federal Register citations affecting § 25.203, see the List of CFR Sections Affected.... These maps, together with the pertinent data on which the computation of these contours is...

  2. 24 CFR 203.350 - Assignment of mortgage. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Assignment of mortgage. 203.350... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Assignment of Mortgage §...

  3. 20 CFR 416.203 - Initial determinations of SSI eligibility. (United States)


    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Initial determinations of SSI eligibility... INCOME FOR THE AGED, BLIND, AND DISABLED Eligibility General § 416.203 Initial determinations of SSI eligibility. (a) What happens when you apply for SSI benefits. When you apply for SSI benefits we will ask...

  4. 24 CFR 203.270 - Open-end insurance charges. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Open-end insurance charges. 203.270... (Continued) OFFICE OF ASSISTANT SECRETARY FOR HOUSING-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF HOUSING AND... SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Open-End Insurance Charges-All...

  5. 26 CFR 601.203 - Offers in compromise. (United States)


    ... STATEMENT OF PROCEDURAL RULES Rulings and Other Specific Matters § 601.203 Offers in compromise. (a) General... Department of Justice for prosecution or defense. Certain functions of the Commissioner with respect to... prosecution are pending in the Office of the Chief Counsel, the Department of Justice, or in an office of...

  6. 24 CFR 203.18b - Increased mortgage amount. (United States)


    ... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES... Secretary under § 203.18(a)(1) does not accurately reflect the median house prices in an area, the party may...) Requests for an increased mortgage limit based upon documentation of median house prices for the...

  7. 24 CFR 570.203 - Special economic development activities. (United States)


    ... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Special economic development... § 570.203 Special economic development activities. A recipient may use CDBG funds for special economic... part of an economic development project. Guidelines for selecting activities to assist under...

  8. 24 CFR 1003.203 - Special economic development activities. (United States)


    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Special economic development... Eligible Activities § 1003.203 Special economic development activities. A grantee may use ICDBG funds for special economic development activities in addition to other activities authorized in this subpart...

  9. 33 CFR 203.72 - Eligibility criteria and procedures. (United States)


    ..., DEPARTMENT OF DEFENSE EMERGENCY EMPLOYMENT OF ARMY AND OTHER RESOURCES, NATURAL DISASTER PROCEDURES Advance Measures § 203.72 Eligibility criteria and procedures. (a) Threat of flooding. An imminent threat of... readily apparent that damages will be incurred if preventive action is not taken immediately. (b)...

  10. 12 CFR 1806.203 - Selection Process, actual award amounts. (United States)


    ... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Selection Process, actual award amounts. 1806... OF THE TREASURY BANK ENTERPRISE AWARD PROGRAM Awards § 1806.203 Selection Process, actual award... round: (1) To select Applicants not previously selected, using the calculation and selection...

  11. 48 CFR 43.203 - Change order accounting procedures. (United States)


    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Change order accounting... CONTRACT MANAGEMENT CONTRACT MODIFICATIONS Change Orders 43.203 Change order accounting procedures. (a) Contractors' accounting systems are seldom designed to segregate the costs of performing changed...

  12. 10 CFR 830.203 - Unreviewed safety question process. (United States)


    ... 10 Energy 4 2010-01-01 2010-01-01 false Unreviewed safety question process. 830.203 Section 830... Unreviewed safety question process. (a) The contractor responsible for a hazard category 1, 2, or 3 DOE... a procedure for its USQ process on a schedule that allows DOE approval in a safety evaluation...

  13. 37 CFR 203.2 - Authority and functions. (United States)


    ... and functions. (a) The administration of the copyright law was entrusted to the Library of Congress by an act of Congress in 1870, and the Copyright Office has been a separate department of the Library....2 Section 203.2 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS...

  14. 5 CFR 870.203 - Post-election BIA. (United States)


    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Post-election BIA. 870.203 Section 870...-election BIA. (a) The BIA of an individual who elects a Living Benefit under subpart K of this part is the amount of insurance left after the effective date of the Living Benefit election. This amount is...

  15. 5 CFR 847.203 - Elections of CSRS coverage. (United States)


    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Elections of CSRS coverage. 847.203... REGULATIONS (CONTINUED) ELECTIONS OF RETIREMENT COVERAGE BY CURRENT AND FORMER EMPLOYEES OF NONAPPROPRIATED FUND INSTRUMENTALITIES Elections To Continue Retirement Coverage After a Qualifying Move §...

  16. 203Hg binding in the liver and kidney of the frog, Rana tigrina

    International Nuclear Information System (INIS)

    Following a single i.p. dose of the radioisotope, 203Hg was found to accumulate in both the high and low molecular weight (MW) fractions of the kidney and liver of the frog. The course of 203Hg appearance in the 2 fractions varied in the liver; 203Hg was exclusively associated with the higher MW fractions at 2 days whereas the radiotracer appeared in both low and high MW fractions at 4 and 7 days after administration. In the kidneys, however, 203Hg was associated with high and low MW fractions at all the intervals studied. Low MW 203Hg binding fraction appeared to be a metallothionein-like substance. (Auth.)

  17. The expression and function of microRNA-203 in lung cancer. (United States)

    Jin, Jianhua; Deng, Jianzhong; Wang, Fang; Xia, Xiyi; Qiu, Tiefeng; Lu, Wenbin; Li, Xianwen; Zhang, Hua; Gu, Xiaoyan; Liu, Yungang; Cao, Weiguo; Shao, Wenlong


    We aimed to determine the expression of microRNA-203 (miR-203) in human lung cancer cell lines and to evaluate the effects of miR-203 by targeting survivin, on the lung cancer cell line 95-D to provide potential new strategies for treating lung cancer. The expression of miR-203 was detected using quantitative real-time PCR (qRT-PCR) in the in vitro cultured lung cancer cells A549, HCC827, NCI-H1299, and 95-D as well as in normal human bronchial epithelial cells. Following a 72-h transfection with the miR-203 precursor in 95-D lung cancer cells, the change in miR-203 expression was detected using qRT-PCR and the resulting effect on survivin protein expression was ascertained by Western blot analysis. The influence of miR-203 on the viability of 95-D lung cancer cells was evaluated using 3-(4,5-dimethylthiazol-2-yl)-2, 5-diphenyltetrazolium bromide (MTT) assay. The effect of miR-203 on 95-D cell proliferation was analyzed using flow cytometry. The consequences of miR-203 expression on 95-D cell apoptosis were analyzed by Annexin V/propidium iodide double staining coupled with flow cytometry. The role of miR-203 in the invasive potential of 95-D cells was studied using a transwell chamber assay. A luciferase reporter gene system was used to verify that survivin is a target gene for miR-203. By qRT-PCR, the expression of miR-203 was lower in lung cancer cells than in normal bronchial epithelial cells (p transfection with the miR-203 precursor (p transfection with the miR-203 precursor, survivin protein levels in 95-D cells were significantly decreased (p transfection with the miR-203 precursor (p < 0.05). The expression of miR-203 is downregulated in lung cancer cells. miR-203 negatively regulates survivin protein expression and inhibits the proliferation and invasion of lung cancer cells. Therapeutic strategies that enhance miR-203 expression or silence survivin could potentially benefit lung cancer patients. PMID:23073851

  18. Tank 241-B-203 Push Mode Core Sampling and Analysis Plan

    Energy Technology Data Exchange (ETDEWEB)

    Jo, J. [Westinghouse Hanford Co., Richland, WA (United States)


    This Sampling and Analysis Plan (SAP) will identify characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements in accordance with the Tank Safety Screening Data Quality Objective (Babad and Redus 1994). This Data Quality Objective (DQO) is described in the Tank Characterization Plan (Jo, 1995) for tank 241-B-203 (B-203). This SAP will also identify procedures and requirements for collecting and characterizing samples from tank B-203 by the core sampling method.

  19. Treatment of cultured glioma cells with the EGFR-TKI gefitinib (''Iressa'', ZD1839) increases the uptake of astatinated EGF despite the absence of gefitinib-mediated growth inhibition

    International Nuclear Information System (INIS)

    The EGFR-TKI (epidermal growth factor receptor tyrosine kinase inhibitor) gefitinib (''Iressa'', ZD1839), a reversible growth inhibitor of EGFR-expressing tumour cells, has been shown to enhance the antitumour effect of ionising radiation, and also to increase the uptake of radioiodinated EGF. Thus, combination of gefitinib treatment and radionuclide targeting is an interesting option for therapy of brain tumours that are difficult to treat with conventional methods. The aim of this study was to evaluate how pre-treatment with gefitinib affects binding of astatinated EGF (211At-EGF) to cultured glioma U343 cells, which express high levels of EGFR. The growth of U343 cells in the presence of gefitinib was investigated, and it was found that gefitinib does not significantly inhibit the growth of these cells. Nevertheless, the uptake of 211At-EGF in U343 cells was markedly increased (up to 3.5 times) in cells pre-treated with gefitinib (1 μM). This indicates that a combination of gefitinib treatment and radionuclide targeting to EGFR might be a useful therapeutic modality, even for patients who do not respond to treatment with gefitinib alone. (orig.)

  20. 75 FR 60495 - Eighteenth Plenary Meeting: RTCA Special Committee 203: Unmanned Aircraft Systems (United States)


    ...: Unmanned Aircraft Systems. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 203: Unmanned Aircraft Systems. DATES: The meeting will be held October 19-21... Special Committee 203: Unmanned Aircraft Systems meeting. The agenda will include: Tuesday, October 19 9...

  1. 76 FR 24957 - Nineteenth Meeting: RTCA Special Committee 203: Unmanned Aircraft Systems (United States)


    ... Federal Aviation Administration Nineteenth Meeting: RTCA Special Committee 203: Unmanned Aircraft Systems...: Unmanned Aircraft Systems. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 203: Unmanned Aircraft Systems. DATES: The meeting will be held May 17-19,...

  2. 75 FR 26321 - Seventeenth Plenary Meeting: RTCA Special Committee 203: Unmanned Aircraft Systems (United States)


    ...: Unmanned Aircraft Systems. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 203: Unmanned Aircraft Systems. DATES: The meeting will be held June 8-10, 2010... given for a Special Committee 203: Unmanned Aircraft Systems meeting. The agenda will include:...

  3. 21 CFR 20.3 - Certification and authentication of Food and Drug Administration records. (United States)


    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Certification and authentication of Food and Drug Administration records. 20.3 Section 20.3 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND... authentication of Food and Drug Administration records. (a) Upon request, the Food and Drug Administration...

  4. 48 CFR 1836.203 - Government estimate of construction costs.(NASA supplements paragraph (c)) (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Government estimate of construction costs.(NASA supplements paragraph (c)) 1836.203 Section 1836.203 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND SPACE ADMINISTRATION SPECIAL CATEGORIES OF CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS...

  5. 5 CFR 451.203 - Responsibilities of the Office of Personnel Management. (United States)


    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Responsibilities of the Office of Personnel Management. 451.203 Section 451.203 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL... Management. (a) The Office of Personnel Management, in accordance with Executive Order 10717, as...

  6. 7 CFR 1901.203 - Title VIII of the Civil Rights Act of 1968. (United States)


    ... 7 Agriculture 12 2010-01-01 2010-01-01 false Title VIII of the Civil Rights Act of 1968. 1901.203... OF AGRICULTURE PROGRAM REGULATIONS PROGRAM-RELATED INSTRUCTIONS Civil Rights Compliance Requirements § 1901.203 Title VIII of the Civil Rights Act of 1968. FmHA or its successor agency under Public Law...

  7. 76 FR 63602 - Voting Rights Act Amendments of 2006, Determinations Under Section 203 (United States)


    ... language assistance provisions of the Act. As of this date, those jurisdictions that are listed as covered by Section 203 have a legal obligation to provide the minority language assistance prescribed by the... other changes, the sunset date for minority language assistance provisions set forth in Section 203...

  8. 24 CFR 203.346 - Postponement of foreclosure-mortgagors in military service. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Postponement of foreclosure... Forbearance Relief for Military Personnel § 203.346 Postponement of foreclosure—mortgagors in military service... foreclosure or acquire the property by other means as provided in § 203.355 of this subpart. No...

  9. 5 CFR 2638.203 - Duties of the designated agency ethics official. (United States)


    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Duties of the designated agency ethics official. 2638.203 Section 2638.203 Administrative Personnel OFFICE OF GOVERNMENT ETHICS GOVERNMENT ETHICS OFFICE OF GOVERNMENT ETHICS AND EXECUTIVE AGENCY ETHICS PROGRAM RESPONSIBILITIES Designated Agency...

  10. 21 CFR 203.50 - Requirements for wholesale distribution of prescription drugs. (United States)


    ... sale, purchase, or trade of such drug. This identifying statement shall include: (1) The proprietary... prescription drugs. 203.50 Section 203.50 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL PRESCRIPTION DRUG MARKETING Wholesale Distribution §...

  11. 47 CFR 101.203 - Communications concerning safety of life and property. (United States)


    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Communications concerning safety of life and property. 101.203 Section 101.203 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY... concerning safety of life and property. (a) Handling and transmission of messages concerning the safety...

  12. 24 CFR 203.256 - Insurance of open-end advance. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance of open-end advance. 203... Development (Continued) OFFICE OF ASSISTANT SECRETARY FOR HOUSING-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF... Insurance § 203.256 Insurance of open-end advance. Insurance on an open-end advance will be evidenced...

  13. 31 CFR 541.203 - Holding of funds in interest-bearing accounts; investment and reinvestment. (United States)


    ... money market fund or in U.S. Treasury bills. (2) For purposes of this section, a rate is commercially... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Holding of funds in interest-bearing accounts; investment and reinvestment. 541.203 Section 541.203 Money and Finance: Treasury...

  14. 31 CFR 544.203 - Holding of funds in interest-bearing accounts; investment and reinvestment. (United States)


    ....), provided the funds are invested in a money market fund or in U.S. Treasury bills. (2) For purposes of this... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Holding of funds in interest-bearing accounts; investment and reinvestment. 544.203 Section 544.203 Money and Finance: Treasury...

  15. 31 CFR 542.203 - Holding of funds in interest-bearing accounts; investment and reinvestment. (United States)


    ... under the Securities Exchange Act of 1934, provided the funds are invested in a money market fund or in... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Holding of funds in interest-bearing accounts; investment and reinvestment. 542.203 Section 542.203 Money and Finance: Treasury...

  16. 31 CFR 540.203 - Holding of funds in interest-bearing accounts; investment and reinvestment. (United States)


    ... funds are invested in a money market fund or U.S. Treasury Bills. (2) For purposes of this section, a... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Holding of funds in interest-bearing accounts; investment and reinvestment. 540.203 Section 540.203 Money and Finance: Treasury...

  17. 31 CFR 586.203 - Holding of funds in interest-bearing accounts; investment and reinvestment. (United States)


    ... the funds are invested in a money market fund or in U.S. Treasury bills. (2) For purposes of this... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Holding of funds in interest-bearing accounts; investment and reinvestment. 586.203 Section 586.203 Money and Finance: Treasury...

  18. 31 CFR 551.203 - Holding of funds in interest-bearing accounts; investment and reinvestment. (United States)


    ... money market fund or in U.S. Treasury bills. (2) For purposes of this section, a rate is commercially... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Holding of funds in interest-bearing accounts; investment and reinvestment. 551.203 Section 551.203 Money and Finance: Treasury...

  19. 31 CFR 547.203 - Holding of funds in interest-bearing accounts; investment and reinvestment. (United States)


    ... the funds are invested in a money market fund or in U.S. Treasury bills. (2) For purposes of this... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Holding of funds in interest-bearing accounts; investment and reinvestment. 547.203 Section 547.203 Money and Finance: Treasury...

  20. 31 CFR 588.203 - Holding of funds in interest-bearing accounts; investment and reinvestment. (United States)


    ... are invested in a money market fund or in U.S. Treasury bills. (2) For purposes of this section, a... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Holding of funds in interest-bearing accounts; investment and reinvestment. 588.203 Section 588.203 Money and Finance: Treasury...

  1. 31 CFR 597.203 - Holding of funds in interest-bearing accounts; investment and reinvestment. (United States)


    ... under the Securities Exchange Act of 1934, provided the funds are invested in a money market fund or in... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Holding of funds in interest-bearing accounts; investment and reinvestment. 597.203 Section 597.203 Money and Finance: Treasury...

  2. 31 CFR 548.203 - Holding of funds in interest-bearing accounts; investment and reinvestment. (United States)


    ... money market fund or in U.S. Treasury bills. (2) For purposes of this section, a rate is commercially... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Holding of funds in interest-bearing accounts; investment and reinvestment. 548.203 Section 548.203 Money and Finance: Treasury...

  3. 31 CFR 587.203 - Holding of funds in interest-bearing accounts; investment and reinvestment. (United States)


    ..., provided the funds are invested in a money market fund or in U.S. Treasury bills. (2) For purposes of this... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Holding of funds in interest-bearing accounts; investment and reinvestment. 587.203 Section 587.203 Money and Finance: Treasury...

  4. 31 CFR 543.203 - Holding of funds in interest-bearing accounts; investment and reinvestment. (United States)


    ... are invested in a money market fund or in U.S. Treasury bills. (2) For purposes of this section, a... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Holding of funds in interest-bearing accounts; investment and reinvestment. 543.203 Section 543.203 Money and Finance: Treasury...

  5. 31 CFR 538.203 - Holding of funds in interest-bearing accounts; investment and reinvestment. (United States)


    ... under the Securities Exchange Act of 1934, provided the funds are invested in a money market fund or in... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Holding of funds in interest-bearing accounts; investment and reinvestment. 538.203 Section 538.203 Money and Finance: Treasury...

  6. 31 CFR 546.203 - Holding of funds in interest-bearing accounts; investment and reinvestment. (United States)


    ... money market fund or in U.S. Treasury bills. (2) For purposes of this section, a rate is commercially... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Holding of funds in interest-bearing accounts; investment and reinvestment. 546.203 Section 546.203 Money and Finance: Treasury...

  7. 33 CFR 203.48 - Inspection guidelines for non-Federal flood control works. (United States)


    ...-Federal flood control works. 203.48 Section 203.48 Navigation and Navigable Waters CORPS OF ENGINEERS... DISASTER PROCEDURES Rehabilitation Assistance for Flood Control Works Damaged by Flood or Coastal Storm..., construction, and maintenance of non-Federal flood control works. The guidelines are not intended to...

  8. 33 CFR 203.50 - Nonstructural alternatives to rehabilitation of flood control works. (United States)


    ... rehabilitation of flood control works. 203.50 Section 203.50 Navigation and Navigable Waters CORPS OF ENGINEERS... DISASTER PROCEDURES Rehabilitation Assistance for Flood Control Works Damaged by Flood or Coastal Storm... of flood control works. (a) Authority. Under Public Law 84-99, the Chief of Engineers is...

  9. 40 CFR 266.203 - Standards applicable to the transportation of solid waste military munitions. (United States)


    ... under 40 CFR part 261, are listed or identified as a hazardous waste (and thus are subject to regulation under 40 CFR parts 260 through 270), unless all the following conditions are met: (i) The waste military... transportation of solid waste military munitions. 266.203 Section 266.203 Protection of Environment...

  10. 34 CFR 303.203 - Payments to the Secretary of the Interior. (United States)


    ... 34 Education 2 2010-07-01 2010-07-01 false Payments to the Secretary of the Interior. 303.203 Section 303.203 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF... Secretary of the Interior. The amount of the payment to the Secretary of the Interior under § 303.180...

  11. 50 CFR 226.203 - Critical habitat for northern right whales. (United States)


    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Critical habitat for northern right whales. 226.203 Section 226.203 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND... Critical habitat for northern right whales. (a) Great South Channel. The area bounded by 41°40′ N/69°45′...

  12. 17 CFR 275.203(b)(3)-1 - Definition of “client” of an investment adviser. (United States)


    ... generally to the public as an investment adviser, within the meaning of section 203(b)(3) of the Act (15 U.S... than the United States, and is regulated as a public investment company under the laws of the country... investment adviser. 275.203(b)(3)-1 Section 275.203(b)(3)-1 Commodity and Securities Exchanges SECURITIES...

  13. 45 CFR 46.203 - Duties of IRBs in connection with research involving pregnant women, fetuses, and neonates. (United States)


    ... involving pregnant women, fetuses, and neonates. 46.203 Section 46.203 Public Welfare DEPARTMENT OF HEALTH... Pregnant Women, Human Fetuses and Neonates Involved in Research § 46.203 Duties of IRBs in connection with research involving pregnant women, fetuses, and neonates. In addition to other responsibilities assigned...

  14. 49 CFR 375.203 - What actions of an individual shipper may limit or reduce my normal liability? (United States)


    ... reduce my normal liability? 375.203 Section 375.203 Transportation Other Regulations Relating to... PROTECTION REGULATIONS Before Offering Services to My Customers Liability Considerations § 375.203 What actions of an individual shipper may limit or reduce my normal liability? (a) If an individual...

  15. 14 CFR 203.4 - Montreal Agreement as part of airline-passenger contract and conditions of carriage. (United States)


    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Montreal Agreement as part of airline-passenger contract and conditions of carriage. 203.4 Section 203.4 Aeronautics and Space OFFICE OF THE... CONVENTION LIABILITY LIMITS AND DEFENSES § 203.4 Montreal Agreement as part of airline-passenger contract...

  16. 30 CFR 203.44 - What administrative steps must I take to use the royalty suspension volume? (United States)


    ... 30 CFR part 250, subpart L. (d) You must provide the information in paragraph (b) of this section by... the royalty suspension volume? 203.44 Section 203.44 Mineral Resources MINERALS MANAGEMENT SERVICE... Relief § 203.44 What administrative steps must I take to use the royalty suspension volume? (a) You...

  17. COH-203, a novel microtubule inhibitor, exhibits potent anti-tumor activity via p53-dependent senescence in hepatocellular carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Qi, Huan; Zuo, Dai-Ying; Bai, Zhao-Shi; Xu, Jing-Wen; Li, Zeng-Qiang [Department of Pharmacology, Shenyang Pharmaceutical University, Shenyang (China); Shen, Qi-Rong; Wang, Zhi-Wei [Key Laboratory of Structure-Based Drug Design and Discovery, Ministry of Education, Shenyang Pharmaceutical University, Shenyang (China); Zhang, Wei-Ge, E-mail: [Key Laboratory of Structure-Based Drug Design and Discovery, Ministry of Education, Shenyang Pharmaceutical University, Shenyang (China); Wu, Ying-Liang, E-mail: [Department of Pharmacology, Shenyang Pharmaceutical University, Shenyang (China)


    Highlights: • COH-203 exhibits anti-hepatoma effects in vitro and in vivo with low toxicity. • COH-203 inhibits tubulin polymerization. • COH-203 induces mitotic arrest followed by mitotic slippage in BEL-7402 cells. • COH-203 induces p53-dependent senescence in BEL-7402 cells. - Abstract: 5-(3-Hydroxy-4-methoxyphenyl)-4-(3,4,5-trimethoxyphenyl)-3H-1, 2-dithiol-3-one (COH-203) is a novel synthesized analogue of combretastatin A-4 that can be classified as a microtubule inhibitor. In this study, we evaluated the anti-hepatoma effect of COH-203 in vitro and in vivo and explored the underlying molecular mechanisms. COH-203 was shown to be more effective in inhibiting the proliferation of liver cancer cells compared with normal liver cells. COH-203 also displayed potent anti-tumor activity in a hepatocellular carcinoma xenograft model without significant toxicity. Mechanistic studies demonstrated that treatment with COH-203 induced mitotic arrest by inhibiting tubulin polymerization in BEL-7402 liver cancer cells. Long-term COH-203 treatment in BEL-7402 cells led to mitotic slippage followed by senescence via the p14{sup Arf}–p53–p21 and p16{sup INK4α}–Rb pathways. Furthermore, suppression of p53 via pifithrin-α (p53 inhibitor) and p53-siRNA attenuated COH-203-induced senescence in BEL-7402 cells, suggesting that COH-203 induced senescence p53-dependently. In conclusion, we report for the first time that COH-203, one compound in the combretastatin family, promotes anti-proliferative activity through the induction of p-53 dependent senescence. Our findings will provide a molecular rationale for the development of COH-203 as a promising anti-tumor agent.

  18. Tank characterization report for single-shell tank 241-B-203

    Energy Technology Data Exchange (ETDEWEB)

    Jo, J., Westinghouse Hanford


    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in tank 241-B-203. This report supports the requirements of Tri-Party Agreement Milestone M-44-09.

  19. 24 CFR 203.427 - Statute of limitations on payment of distributive shares. (United States)


    ... HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Mutual Mortgage Insurance Fund and Distributive Shares § 203.427 Statute of limitations on payment of...

  20. 24 CFR 203.426 - Inapplicability to housing in older declining urban areas. (United States)


    ... HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Mutual Mortgage Insurance Fund and Distributive Shares § 203.426 Inapplicability to housing in older...

  1. Yeast Interacting Proteins Database: YJR091C, YDR203W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available 0) YDR203W - Dubious open reading frame unlikely to encode a functional protein, based on availab...y gene name - Prey description Dubious open reading frame unlikely to encode a functional protein, based on availab

  2. 45-Day safety screen results for tank 241-U-203, push mode, cores 79 and 80

    International Nuclear Information System (INIS)

    Two one-segment core samples from tank 241-U-203 (U-203) were received by the 222-S Laboratories and underwent safety screening analysis, consisting of differential scanning calorimetry (DSC), thermogravimetric analysis (TGA), and total alpha activity. In addition to the safety screening requirements, inductively coupled plasma (ICP) spectrographic analysis for lithium was performed to determine the extent of hydrostatic head fluid contamination during the sampling event. No notification limits were exceeded for these analyses

  3. Productive replication of Malacosoma neustria nucleopolyhedrovirus (ManeNPV) in Md203 cell line


    DEMİR, İsmail; GÜREL, Nurten; NALÇACIOĞLU, Remziye; İNCE, İkbal A.; DEMİRBAĞ, Zihni


    A plaque-purified genotypic variant, derived from a field isolate of the Malacosoma neustria nucleopolyhedrovirus (ManeNPV) from Turkey was characterized based on in vitro replication properties in a cell line, Md203 derived from Malacosoma disstria. The life cycle of ManeNPV was studied based on the cytopathic effects (CPEs), polyhedral inclusion body (PIB) formation, budded virus (BV) production, viral DNA replication and polyhedrin protein expression in ManeNPV-infected Md203 cells. Infec...

  4. MiRNA-203 suppresses cell proliferation, migration and invasion in colorectal cancer via targeting of EIF5A2 (United States)

    Deng, Biao; Wang, Bin; Fang, Jiaqing; Zhu, Xuchao; Cao, Zhongwei; Lin, Qi; Zhou, Lisheng; Sun, Xing


    While it is known that miR-203 is frequently downregulated in many types of human cancer, little is known regarding its expression and functional role in colorectal cancer (CRC). In this study, we aimed to investigate the expression and the potential mechanisms of miR-203 in colorectal cancer. MiR-203 was significantly downregulated in CRC tissues compared with matched normal adjacent tissues. Our clinical data show that decreased miR-203 was associated with an advanced clinical tumor-node-metastasis stage, lymph node metastasis, and poor survival in CRC patients. Furthermore, externally induced expression of miR-203 significantly inhibited CRC cell proliferation and invasion in vitro and in vivo. Mechanistically, we identified EIF5A2 as a direct and functional target of miR-203. The levels of miR-203 were inversely correlated with levels of the EIF5A2 in the CRC tissues. Restoration of EIF5A2 in the miR-203-overexpressing CRC cells reversed the suppressive effects of miR-203. Our results demonstrate that miR-203 serves as a tumor suppressor gene and may be useful as a new potential therapeutic target in CRC. PMID:27376958

  5. Prognostic value of microRNA-203a expression in breast cancer. (United States)

    Gomes, Bruno Costa; Martins, Manuela; Lopes, Paulina; Morujão, Inês; Oliveira, Mário; Araújo, António; Rueff, José; Rodrigues, António Sebastião


    Tumor heterogeneity and the poor outcome of breast cancer (BC) patients have led researchers to define new markers of this disease. In recent years, microRNA expression patterns have proven to be valuable disease indicators. The level of miR-203a, in particular, was shown to be altered in different types of cancer. The objective of the present study was to assess the relationship between miR-203a expression and clinicopathological features of BC in a Portuguese cohort. The expression levels of miR‑203a were analyzed in 109 formalin‑fixed paraffin-embedded paired normal and tumor tissue samples. Significant overexpression of miR‑203a in the tumor tissues was found (1.7-fold higher) compared to the expression in the normal adjacent tissues (p=0.003). In addition, several clinicopathological characteristics presented an association with higher miR-203a expression levels. Tumors with diameter ≤18.5 mm (1.5-fold; p=0.019), tumors positive for estrogen receptor (fold-change, 1.71; p=0.042), progesterone receptor (fold-change, 1.50; p=0.046) and negative for HER2 (fold-change, 1.50; p=0.016) and high Ki-67 index (fold-change, 2.60; p=0.024) presented a significant difference in miR-203a expression compared with adjacent normal tissues. Tumors without invasion of lymph nodes also presented higher expression of miR-203a (fold-change, 2.40; p=0.004). With regard to histological classification, ductal carcinomas in situ (fold-change, 2.20; p=0.028) and invasive carcinoma NOS (fold-change, 1.71; p=0.009) displayed significantly higher expression of miR-203a. Moreover, we found a significant downregulation of miR-203a with increased stage in invasive lobular carcinomas, suggesting that miR-203a could represent a potential marker to discriminate stages in invasive lobular carcinomas. PMID:27431784

  6. miR-203 inhibits melanoma invasive and proliferative abilities by targeting the polycomb group gene BMI1

    Energy Technology Data Exchange (ETDEWEB)

    Chang, Xiao [Department of Dermatology and Venereal Disease, Xuanwu Hospital, Capital Medical University, Beijing 100053 (China); Sun, Yong [Department of Burn and Plastic Surgery, Huai’an First People’s Hospital, Nanjing Medical University, Huai’an 223300 (China); Han, Siqi [Department of Medical Oncology, Jinling Hospital, Nanjing 210002 (China); Zhu, Wei [Department of Dermatology and Venereal Disease, Xuanwu Hospital, Capital Medical University, Beijing 100053 (China); Zhang, Haiping, E-mail: [Department of Dermatology and Venereal Disease, Xuanwu Hospital, Capital Medical University, Beijing 100053 (China); Lian, Shi, E-mail: [Department of Dermatology and Venereal Disease, Capital Medical University, Beijing 100069 (China)


    Highlights: • First reported deregulation of miR-203 and up-regulation of BMI1 in metastatic melanoma. • miR-203 decreased BMI1 expression by directly binding to 3′UTR. • Further found miR-203 overexpression suppressed cell invasion and stemness. • Re-expression of BMI1 rescued miR-203-mediated suppression. • miR-203-BMI1 axis may be potential therapeutic targets of melanoma metastasis. - Abstract: Metastasis is the major problem in malignant melanoma, posing a therapeutic challenge to clinicians. The investigation of the underlying mechanism driving this progress remains a large unmet need. In this study, we revealed a miR-203-BMI1 axis that regulated melanoma metastasis. We found significantly deregulation of miR-203 and up-regulation of BMI1 in melanoma, particularly in metastatic melanoma. An inverse correlation between the levels of miR-203 and BMI1 was further observed in melanoma tissues and cell lines. We also identified BMI1 as a downstream target gene of miR-203, which bound to the 3′UTR of BMI1. Overexpression of miR-203 was associated with decreased BMI1 expression and impaired cell invasion and tumor sphere formation activities. Re-expression of BMI1 markedly rescued miR-203-mediated suppression of these events. Taken together, our results demonstrated that miR-203 regulated melanoma invasive and proliferative abilities in part by targeting BMI1, providing new insights into potential mechanisms of melanoma metastasis.

  7. miR-203 inhibits melanoma invasive and proliferative abilities by targeting the polycomb group gene BMI1

    International Nuclear Information System (INIS)

    Highlights: • First reported deregulation of miR-203 and up-regulation of BMI1 in metastatic melanoma. • miR-203 decreased BMI1 expression by directly binding to 3′UTR. • Further found miR-203 overexpression suppressed cell invasion and stemness. • Re-expression of BMI1 rescued miR-203-mediated suppression. • miR-203-BMI1 axis may be potential therapeutic targets of melanoma metastasis. - Abstract: Metastasis is the major problem in malignant melanoma, posing a therapeutic challenge to clinicians. The investigation of the underlying mechanism driving this progress remains a large unmet need. In this study, we revealed a miR-203-BMI1 axis that regulated melanoma metastasis. We found significantly deregulation of miR-203 and up-regulation of BMI1 in melanoma, particularly in metastatic melanoma. An inverse correlation between the levels of miR-203 and BMI1 was further observed in melanoma tissues and cell lines. We also identified BMI1 as a downstream target gene of miR-203, which bound to the 3′UTR of BMI1. Overexpression of miR-203 was associated with decreased BMI1 expression and impaired cell invasion and tumor sphere formation activities. Re-expression of BMI1 markedly rescued miR-203-mediated suppression of these events. Taken together, our results demonstrated that miR-203 regulated melanoma invasive and proliferative abilities in part by targeting BMI1, providing new insights into potential mechanisms of melanoma metastasis

  8. Consecutive Renal Scanning with 131I And 203Hg in Obstructive Uropathy

    International Nuclear Information System (INIS)

    Two patients with obstructive uropathy were scanned after injections of 131I sodium orthoiodohippurate (OlH) and 203Hg chlormerodrin. The 131I OIH scan was performed 30 min after the injection with the patient in the prone position. The 203Hg chlormerodrin was injected as soon as a negligible amount of 131I OIH was detected over the kidney, and the patient was scanned again 30 min later. A third patient and a normal subject were scanned 20 min after the simultaneous injection of 131I OIH and 203Hg chlormerodrin. Three scans with different analyser settings were done in sequence. The first scan was done with a window setting for 131I, and the second scan included both 131I and 203Hg; in the third scan, the analyser was set for 203Hg only. Evidence of hydronephroses, hydroureter and the residual functioning renal tissue were demonstrated by this scanning technique. The intravenous pyelograms in all three cases had failed to give satisfactory results. The simultaneous injection technique was found advantageous over the separate injection technique. (author)

  9. Gavatero-203, nueva variedad de sorgo forrajero para el estado de Sinaloa Gavatero-203, new sorghum forage cultivar for the State of Sinaloa

    Directory of Open Access Journals (Sweden)

    Luis Alberto Hernández Espinal


    Full Text Available La nueva variedad de sorgo Gavatero-203, fue desarrollado en el Campo Experimental Valle de Culiacán del INIFAP y registrado con el número 2205-SOG-529-090209/C en el catálogo de variedades factibles de certificación de México. Esta variedad se adapta a las áreas productoras de sorgo para el estado de Sinaloa. Gavatero-203 es una variedad de grano rojo y se recomienda para condiciones de riego y temporal. El rendimiento promedio de la variedad es de 2 849 kg ha-1 de grano y 35 367 kg ha-1 de forraje verde, supera en promedio 18.5% y 15.4% respectivamente al rendimiento de híbridos comerciales de compañías privadas, que se cultivan en la región bajo las mismas condiciones. Gavatero-203 tiene mejor calidad bromatológica que los híbridos comerciales en el forraje, con un 7.3% de proteína y 66.4% de digestibilidad, supera en promedio 1% y 6% respectivamente, a los híbridos comerciales. Es tolerante a enfermedades que se presentan en la región, como son: ergot (Claviceps african, antracnosis (Colletotrichum graminícola, tizón de la panoja (Fusarium moniliforme y pudrición carbonosa del tallo (Macrophomina phaseolina. El forraje de sorgo Gavatero-203, se recomienda como un material de doble propósito en prácticas de conservación de forraje como henificado y ensilaje.The new sorghum variety Gavatero-203 was developed at Culiacán Valley Experiment Station of the National Research Forestry, Agriculture and Livestock Institute (INIFAP and was registered with the number 2205-SOG-529-090209/C in the Catalogue of Feasible Varieties of Certification in Mexico. This variety is adapted to sorghum-producing areas in State of Sinaloa, Mexico.The variety Gavatero-203 has red grain and is recommended either for irrigation and rainfall areas. The average yield of the variety is 2 849 kg ha-1 of grain and 35 367 kg ha-1 of green forage, which is 18.5% and 15.4% higher than the grain and fresh forage yield of commercial hybrids from private

  10. 9 CFR 203.5 - Statement with respect to market agencies paying the expenses of livestock buyers. (United States)


    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Statement with respect to market agencies paying the expenses of livestock buyers. 203.5 Section 203.5 Animals and Animal Products GRAIN... sales conducted by such market agencies, such as, expenses for meals, lodging, travel, entertainment...

  11. 5 CFR 890.203 - Application for approval of, and proposal of amendments to, health benefit plans. (United States)


    ... marketing purposes; (iii) Health care delivery system: A health care delivery system providing reasonable... of amendments to, health benefit plans. 890.203 Section 890.203 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL EMPLOYEES HEALTH...

  12. 12 CFR 347.203 - Deposit insurance required for all branches of foreign banks engaged in domestic retail deposit... (United States)


    ... foreign banks engaged in domestic retail deposit activity in the same State. 347.203 Section 347.203 Banks... engaged in domestic retail deposit activity in the same State. The FDIC will not insure deposits in any... foreign bank in the same state that engages in domestic retail deposit activity will be an insured branch....

  13. 75 FR 59688 - Foreign-Trade Zone 203-Moses Lake, WA; Application for Reorganization and Expansion Under... (United States)


    ... FR 1170, 1/12/09; correction 74 FR 3987, 1/22/09). The ASF is an option for grantees for the... 203 was approved by the Board on October 18, 1994 (Board Order 702, 59 FR 54433, 10/31/94). The... Foreign-Trade Zones Board Foreign-Trade Zone 203--Moses Lake, WA; Application for Reorganization...

  14. 24 CFR 203.16 - Certificate and contract regarding use of dwelling for transient or hotel purposes. (United States)


    ... use of dwelling for transient or hotel purposes. 203.16 Section 203.16 Housing and Urban Development... use of dwelling for transient or hotel purposes. Every application filed with respect to insurance of... housing or any part thereof covered by the mortgage for transient or hotel purposes, together with...

  15. 30 CFR 203.46 - To which production do I apply the royalty suspension supplements from drilling one or two... (United States)


    ... MANAGEMENT RELIEF OR REDUCTION IN ROYALTY RATES OCS Oil, Gas, and Sulfur General Royalty Relief for Drilling Deep Gas Wells on Leases Not Subject to Deep Water Royalty Relief § 203.46 To which production do I... suspension supplements from drilling one or two certified unsuccessful wells on my lease? 203.46 Section...

  16. 13 CFR 127.203 - What are the rules governing the requirement that economically disadvantaged women must own EDWOSBs? (United States)


    ... in the same or similar line of business. (b) Limitation on personal net worth. In order to be... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the rules governing the requirement that economically disadvantaged women must own EDWOSBs? 127.203 Section 127.203 Business...

  17. 31 CFR 593.203 - Holding of blocked funds in interest-bearing accounts; investment and reinvestment. (United States)


    ... (15 U.S.C. 78a et seq.), provided the funds are invested in a money market fund or in U.S. Treasury... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Holding of blocked funds in interest-bearing accounts; investment and reinvestment. 593.203 Section 593.203 Money and Finance:...

  18. 12 CFR Appendix B to Part 203 - Form and Instructions for Data Collection on Ethnicity, Race, and Sex (United States)


    ... Ethnicity, Race, and Sex B Appendix B to Part 203 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF... to Part 203—Form and Instructions for Data Collection on Ethnicity, Race, and Sex I. Instructions on Collection of Data on Ethnicity, Race, and Sex You may list questions regarding the ethnicity, race, and...

  19. 40 CFR 2.203 - Notice to be included in EPA requests, demands, and forms; method of asserting business... (United States)


    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Notice to be included in EPA requests... at time of submission. 2.203 Section 2.203 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY..., proprietary, or company confidential. Allegedly confidential portions of otherwise non-confidential...

  20. 49 CFR 40.203 - What problems cause a drug test to be cancelled unless they are corrected? (United States)


    ... 49 Transportation 1 2010-10-01 2010-10-01 false What problems cause a drug test to be cancelled unless they are corrected? 40.203 Section 40.203 Transportation Office of the Secretary of Transportation PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Problems in Drug Tests §...

  1. 16 CFR Appendix D to Part 436 - Sample Item 20(3) Table-Status of Franchise Outlets (United States)


    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Sample Item 20(3) Table-Status of Franchise Outlets D Appendix D to Part 436 Commercial Practices FEDERAL TRADE COMMISSION TRADE REGULATION RULES... Item 20(3) Table—Status of Franchise Outlets Status of Franchise Outlets For years 2004 to 2006...

  2. 胃癌患者外周血microRNA-203的检测及意义

    Institute of Scientific and Technical Information of China (English)




  3. 胃癌患者外周血microRNA-203的检测及意义

    Institute of Scientific and Technical Information of China (English)



    目的 探讨胃癌患者外周血microRNA-203的表达及临床意义.方法 采用RT-PCR方法检测20例胃癌患者、10例健康志愿者外周血中microRNA-203的表达.结果 胃癌组和正常对照组外周血中microRNA-203的表达有显著差异(P<0.01).胃癌组外周血中microRNA-203的表达水平较正常对照组明显下调.结论 外周血中microRNA-203的检测可作为胃癌早期诊断的标志物.

  4. Rewiring of an Epithelial Differentiation Factor, miR-203, to Inhibit Human Squamous Cell Carcinoma Metastasis

    Directory of Open Access Journals (Sweden)

    Nathan Benaich


    Full Text Available Metastatic colonization of distant organs underpins the majority of human-cancer-related deaths, including deaths from head and neck squamous cell carcinoma (HNSCC. We report that miR-203, a miRNA that triggers differentiation in multilayered epithelia, inhibits multiple postextravasation events during HNSCC lung metastasis. Inducible reactivation of miR-203 in already established lung metastases reduces the overall metastatic burden. Using an integrated approach, we reveal that miR-203 inhibits metastasis independently of its effects on differentiation. In vivo genetic reconstitution experiments show that miR-203 inhibits lung metastasis by suppressing the prometastatic activities of three factors involved in cytoskeletal dynamics (LASP1, extracellular matrix remodeling (SPARC, and cell metabolism (NUAK1. Expression of miR-203 and its downstream effectors correlates with HNSCC overall survival outcomes, indicating the therapeutic potential of targeting this signaling axis.

  5. 30 CFR 203.55 - Under what conditions can my end-of-life royalty relief arrangement for an oil and gas lease be... (United States)


    ... royalty relief arrangement for an oil and gas lease be ended? 203.55 Section 203.55 Mineral Resources... ROYALTY RATES OCS Oil, Gas, and Sulfur General Royalty Relief for End-Of-Life Leases § 203.55 Under what conditions can my end-of-life royalty relief arrangement for an oil and gas lease be ended? (a) If you...

  6. 75 FR 2925 - Sixteenth Plenary Meeting: RTCA Special Committee 203: Unmanned Aircraft Systems (United States)


    ...: Unmanned Aircraft Systems. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 203: Unmanned Aircraft Systems. DATES: The meeting will be held February 16-18...: Unmanned Aircraft Systems meeting. The agenda will include: February 16, 2010 Opening Plenary...

  7. 29 CFR 2530.203-3 - Suspension of pension benefits upon employment. (United States)


    ... more hours of service (as defined in 29 CFR 2530.200b-2(a)(1) and (2)) for an employer which maintains... 29 Labor 9 2010-07-01 2010-07-01 false Suspension of pension benefits upon employment. 2530.203-3... ADMINISTRATION, DEPARTMENT OF LABOR MINIMUM STANDARDS FOR EMPLOYEE PENSION BENEFIT PLANS UNDER THE...

  8. 29 CFR 780.203 - Performance of operations on a farm but not by the farmer. (United States)


    ... 29 Labor 3 2010-07-01 2010-07-01 false Performance of operations on a farm but not by the farmer... Operations § 780.203 Performance of operations on a farm but not by the farmer. Logging or sawmill operations on a farm undertaken on behalf of the farmer or on behalf of the buyer of the logs or the...

  9. 76 FR 1599 - Foreign-Trade Zone 203-Moses Lake, Washington; Application for Manufacturing Authority, SGL... (United States)


    ... Foreign-Trade Zones Board Foreign-Trade Zone 203--Moses Lake, Washington; Application for Manufacturing Authority, SGL Automotive Carbon Fibers, LLC, (Carbon Fiber Manufacturing), Moses Lake, WA An application has been submitted to the Foreign-Trade Zones Board (the Board) by the Port of Moses Lake...

  10. 7 CFR 205.203 - Soil fertility and crop nutrient management practice standard. (United States)


    ... sludge (biosolids) as defined in 40 CFR part 503; and (3) Burning as a means of disposal for crop... 7 Agriculture 3 2010-01-01 2010-01-01 false Soil fertility and crop nutrient management practice... Requirements § 205.203 Soil fertility and crop nutrient management practice standard. (a) The producer...

  11. 24 CFR 203.10 - Informed consumer choice for prospective FHA mortgagors. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Informed consumer choice for... HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Eligibility Requirements and Underwriting Procedures Miscellaneous Regulations § 203.10 Informed consumer choice for prospective...

  12. 24 CFR 203.430 - Sale of interests in insured mortgages. (United States)


    ... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Sale, Assignment and Pledge of Insured Mortgage § 203.430 Sale of interests in insured mortgages. No mortgagee may sell or...

  13. 24 CFR 203.404 - Amount of payment-assigned mortgages. (United States)


    ... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Payment of Insurance Benefits § 203.404 Amount of payment—assigned mortgages. Upon an acceptable assignment of a mortgage,...

  14. 24 CFR 203.436 - Claim procedure-graduated payment mortgages. (United States)


    ... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Graduated Payment Mortgages § 203... principal or interest. (b) The phrases unpaid principal balance of the loan or principal of the...

  15. 5 CFR 720.203 - Responsibilities of the Office of Personnel Management. (United States)


    ... innovative internal recruitment is appropriate; and (4) Other factors which may be considered by the agency... members of minority groups and providing guidance on internal and external recruitment activities directed... Recruitment Program § 720.203 Responsibilities of the Office of Personnel Management. (a) The Office...

  16. 48 CFR 1652.203-70 - Misleading, deceptive, or unfair advertising. (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Misleading, deceptive, or... CLAUSES Texts of FEHBP Clauses 1652.203-70 Misleading, deceptive, or unfair advertising. As prescribed in 1603.7003, the following clause shall be inserted in all FEHBP contracts: Misleading, Deceptive,...

  17. 14 CFR 121.203 - Nontransport category airplanes: Landing limitations: Destination airport. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Nontransport category airplanes: Landing...: CERTIFICATION AND OPERATIONS OPERATING REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Airplane Performance Operating Limitations § 121.203 Nontransport category airplanes: Landing limitations:...

  18. 42 CFR 50.203 - Sterilization of a mentally competent individual aged 21 or older. (United States)


    ... 42 Public Health 1 2010-10-01 2010-10-01 false Sterilization of a mentally competent individual... HUMAN SERVICES GRANTS POLICIES OF GENERAL APPLICABILITY Sterilization of Persons in Federally Assisted Family Planning Projects § 50.203 Sterilization of a mentally competent individual aged 21 or...

  19. 28 CFR 31.203 - Open meetings and public access to records. (United States)


    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Open meetings and public access to... Grants General Requirements § 31.203 Open meetings and public access to records. The State must assure... advisory group established pursuant to section 223(a)(3) will follow applicable State open meeting...

  20. 33 CFR 203.43 - Inspection of Federal flood control works. (United States)


    ... accordance with 33 CFR 208.10 and Engineer Regulation (ER) 1130-2-530, Flood Control Operations and... PROCEDURES Rehabilitation Assistance for Flood Control Works Damaged by Flood or Coastal Storm: The Corps Rehabilitation and Inspection Program § 203.43 Inspection of Federal flood control works. (a)...

  1. 33 CFR 203.45 - Rehabilitation of Federal flood control works. (United States)


    ... PROCEDURES Rehabilitation Assistance for Flood Control Works Damaged by Flood or Coastal Storm: The Corps Rehabilitation and Inspection Program § 203.45 Rehabilitation of Federal flood control works. Rehabilitation of Federal flood control projects will be identical to rehabilitation of non-Federal projects (§...

  2. 33 CFR 203.85 - Rehabilitation of Federal flood control projects. (United States)


    ... PROCEDURES Local Interests/Cooperation Agreements § 203.85 Rehabilitation of Federal flood control projects. Some sponsors of Federal flood control projects are not required to furnish written assurances of local... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Rehabilitation of Federal...

  3. 33 CFR 203.42 - Inspection of non-Federal flood control works. (United States)


    ... PROCEDURES Rehabilitation Assistance for Flood Control Works Damaged by Flood or Coastal Storm: The Corps Rehabilitation and Inspection Program § 203.42 Inspection of non-Federal flood control works. (a) Required inspections. The Corps will conduct inspections of non-Federal flood control works. These inspections are...

  4. 20 CFR 718.203 - Establishing relationship of pneumoconiosis to coal mine employment. (United States)


    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Establishing relationship of pneumoconiosis... DETERMINING COAL MINERS' TOTAL DISABILITY OR DEATH DUE TO PNEUMOCONIOSIS Determining Entitlement to Benefits § 718.203 Establishing relationship of pneumoconiosis to coal mine employment. (a) In order for...

  5. 21 CFR 203.60 - Request and receipt forms, reports, and records. (United States)


    ... SERVICES (CONTINUED) DRUGS: GENERAL PRESCRIPTION DRUG MARKETING Request and Receipt Forms, Reports, and Records § 203.60 Request and receipt forms, reports, and records. (a) Use of electronic records, electronic signatures, and handwritten signatures executed to electronic records. (1) Provided...

  6. 24 CFR 972.203 - Definition of “conversion.” (United States)


    ... DEVELOPMENT CONVERSION OF PUBLIC HOUSING TO TENANT-BASED ASSISTANCE Voluntary Conversion of Public Housing Developments Purpose; Definition of Conversion § 972.203 Definition of “conversion.” For purposes of this subpart, the term “conversion” means the removal of public housing units from the inventory of a...

  7. 34 CFR 403.203 - What are the State's responsibilities for a State assessment? (United States)


    ... TECHNOLOGY EDUCATION PROGRAM What Are the Administrative Responsibilities of a State Under the State Vocational and Applied Technology Education Program? § 403.203 What are the State's responsibilities for a... 34 Education 3 2010-07-01 2010-07-01 false What are the State's responsibilities for a...

  8. MiR-203 controls proliferation, migration and invasive potential of prostate cancer cell lines

    DEFF Research Database (Denmark)

    Viticchiè, Giuditta; Lena, Anna Maria; Latina, Alessia;


    cell lines compared to normal epithelial prostatic cells. Overexpression of miR-203 in brain or bone metastatic prostate cell lines (DU145 and PC3) is sufficient to induce a mesenchymal to epithelial transition with inhibition of cell proliferation, migration and invasiveness. We have identified CKAP2...

  9. 27 CFR 19.203 - Alternation of distilled spirits plant and bonded wine cellar premises. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Alternation of distilled... Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DISTILLED SPIRITS PLANTS Qualification of Distilled Spirits Plants Alternate Operations § 19.203 Alternation of...

  10. 78 FR 6400 - Twenty Third Meeting: RTCA Special Committee 203, Unmanned Aircraft Systems (United States)


    ...: Meeting Notice of RTCA Special Committee 203, Unmanned Aircraft Systems. SUMMARY: The FAA is issuing this... Breakout Sessions System Engineering Workgroup Human Factors Subgroup C&C Workgroup S&A Workgroup Safety....--Workgroup Breakout Sessions System Engineering Workgroup Human Factors Subgroup C&C Workgroup S&A...

  11. 24 CFR 203.204 - Requirements and limitations of a plan. (United States)


    ... structural defect claim, Plans must, unless prohibited by applicable law, provide for binding arbitration... time of settlement. In the case of optional coverage beyond the coverage required under § 203.205, the... protection measures. (f) Unless prohibited by applicable law, Plans must, at a minimum, stipulate that...

  12. 24 CFR 203.675 - Notice to occupants of pending acquisition. (United States)


    ... illness or injury provisions of § 203.674(a), the occupant shall provide to the HUD Field Office, at the... notify the mortgagor and each head of household who is actually occupying a unit of the property of its... severely aggravating the illness or injury, and a statement by a State-certified physician establishing...

  13. 6 CFR 27.203 - Calculating the screening threshold quantity by security issue. (United States)


    ... Act, 42 U.S.C. 6901 et. seq., except for the waste described in 40 CFR 261.33; (8) in naturally... SECRETARY CHEMICAL FACILITY ANTI-TERRORISM STANDARDS Chemical Facility Security Program § 27.203 Calculating... either as compressed air or as part of combustion; (6) Contained in articles, as defined in 40 CFR...

  14. Basophil sensitivity through CD63 or CD203c is a functional measure for specific immunotherapy

    Directory of Open Access Journals (Sweden)

    Dahl Ronald


    Full Text Available Abstract Background Subcutaneous Immunotherapy (SCIT modifies the allergic response and relieves allergic symptoms. SCIT is the only and a very effective treatment for insect venom allergy. We hypothesized that basophil sensitivity, measured through the basophil activation test, would decrease during SCIT up dosing. Expression of CD203c was compared to CD63 as marker for basophil activation, using a Bland Altman plot and ROC curves. Methods Patients (n = 18 starting subcutaneous SCIT for wasp allergy with an up dosing scheme of 7 to 11 weeks were enrolled. Heparinised blood samples were drawn at weeks 1-4, 7 and at the first maintenance visit. Basophils were stimulated at 7 log dilutions of V. vespula allergen for 15 min, and were stained with CD203c and CD63. Basophils were identified as CD203c+ leukocytes, and the proportion of CD63+ and CD203c+ cells were plotted against allergen concentration. A sigmoid curve was fitted to the points, and the allergen concentration at which half of the maximal activation was achieved, LC50, was calculated. In another series of experiments, LC50 calculated in whole blood (AP was subtracted from LC50 calculated with basophils suspended in plasma from a nonatopic donor (HS to determine the protective effect of soluble factors in blood of patients treated with SCIT. Results Heparin blood basophil activation was similar through CD63 and CD203c. Basophils were significantly more sensitized three weeks after initiation of SCIT compared to baseline (p Conclusion Basophil activation is a versatile and sensitive tool that measures changes in the humoral immune response to allergen during SCIT.

  15. Astatination of closo-dodecaborate(2-) anion

    Czech Academy of Sciences Publication Activity Database

    Orlova, A.; Lebeda, Ondřej; Tolmachev, V.; Lundquist, H.; Carlsson, J.; Sjöberg, S.

    Cambridge : The Royal Society of Chemistry , 2000 - (Davidson, M.; Hughes, A.; Marder, T.; Wade , K.), s. 144-147 [Conference "Contemporary Boron Chemistry ". Durham (GB), 11.07.1999-15.07.1999] Institutional research plan: CEZ:AV0Z1048901 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  16. Revised final report for tank 241-C-203, auger samples 95-AUG-20 and 95-AUG-21. Revision 1

    International Nuclear Information System (INIS)

    Two auger samples from tank 241-C-203 (C-203) were received at the 222-S Laboratories and underwent safety screening analyses, consisting of differential scanning calorimetry (DSC), thermogravimetric analysis (TGA), and total alpha activity. No notification limits were exceeded for the analyses. Two samples were submitted for a density determination at the request of Characterization Plant Engineering. SCOPE This document is the revised final report for the tank C-203 auger samples collected on April 5, 1995 (samples 95-AUG-20 and 95-AUG-021)

  17. 75 FR 23572 - Airworthiness Directives; Airbus Model A300 B2-1C, B2-203, B2K-3C, B4-103, B4-203, B4-2C... (United States)


    ... CONTACT: Dan Rodina, Aerospace Engineer, International Branch, ANM-116, Transport Airplane Directorate... (75 FR 11428, March 11, 2010), for certain Airbus Model A300 B2-1C, B2-203, B2K-3C, B4-103, B4-203, B4... total flight \\1\\ '' has been corrected to read ''>17,500 total flight cycles \\1\\.'' (The word...

  18. In vivo distribution and excretion studies and in vitro blood studies on the kinetics of lead-203 in beagle dogs

    International Nuclear Information System (INIS)

    Studies on the kinetics of the distribution of lead-203 in body fluids have been carried out in vitro, and in animal studies using beagle dogs. In vitro, the distribution of carrier free lead-203 between plasma and cells of canine blood at 370C was measured after the addition of isotope. In animal studies, activity in plasma was measured for about 150 hours, and activity in blood cells, urine and feces measured for about 400 hours after exposure to lead-203. Linear compartmental models for distribution of the isotope are presented for both in vitro and in vivo experimental systems. The models contain compartments for both untransformed lead, for isotope added in saline or citric acid, and transformed lead, as obtained by lead-203 incubation in plasma

  19. HPLC determination of brain biogenic amines following treatment with bispyridinium aldoxime K203. (United States)

    Hashemi, F; Laufer, R; Szegi, P; Csomor, V; Kalász, H; Tekes, Kornélia


    Effect of a new acetylcholine-esterase reactivator, K203 as a new potential antidote in organophosphate intoxications was studied on dopamine (DA), homovanillic acid (HVA), serotonin (5-HT) and 5-hydroxyindolacetic acid (5-HIAA) levels in seven brain regions (cerebellum, spinal cord, hippocampus, hypothalamus, striatum, medulla oblongata and frontal cortex) of rats by an optimized and validated HPLC method. No significant change in brain level of these neurotransmitters was found either 15 or 60 min following treatment. However, when 5-HIAA/5-HT ratios were calculated as measure of turnover, significant decreases were found in the cerebellum, hippocampus, hypothalamus and the frontal cortex 15 min following K203 administration, but after 60 min only in the frontal cortex. PMID:24631794

  20. Pump-limited, 203 W, single-frequency monolithic fiber amplifier based on laser gain competition. (United States)

    Zeringue, Clint; Vergien, Christopher; Dajani, Iyad


    We present high power results of a Yb-doped fiber amplifier seeded with a combination of broad and single-frequency laser signals. This two-tone concept was used in conjunction with externally applied or intrinsically formed thermal gradients to demonstrate combined stimulated Brillouin scattering suppression in a copumped monolithic, polarization-maintaining (PM) fiber. Depending on the input parameters and the thermal gradient, the output power of the single-frequency signal ranged from 80 to 203 W with slope efficiencies from 70% to 80%. The 203 W amplifier was pump limited and is, to the best of our knowledge, the highest reported in the literature for monolithic, PM single-frequency fiber amplifiers. PMID:21368926

  1. Development of a new radiolabel (lead-203) and new chelating agents for labeling monoclonal anntibodies for imaging

    Energy Technology Data Exchange (ETDEWEB)

    Srivastava, S.C.; Mease, R.C.; Meinken, G.E.; Mausner, L.F.; Steplewski, Z.


    High liver uptake and slow body clearance presently limit the usefulness of /sup 111/In labeled antibodies for tumor imaging. We have investigated /sup 203/Pb as an alternate and better antibody label. The DTPA and cyclohexyl EDTA (CDTA) conjugates of an anticolon carcinoma antibody, 17-1A were labeled (bicyclic anhydride method) with /sup 203/Pb and /sup 111/In with 60 and 90% labeling yields, respectively. The biodistribution of /sup 203/Pb-17-1A conjugates was compared with the corresponding /sup 111/In-labeled preparations and with /sup 203/Pb-DTPA, /sup 203/Pb-nitrate and nonrelevant antibody controls in normal and human tumor (SW948) xenografted nude mice at 24, and 96 hr. Lead-203-labeled CDTA and DTPA antibody conjugates gave similar in vivo distributions. Even though the lead bound to these chelate-antibody conjugates was more labile in serum and in vivo, compared to indium, it cleared much faster from the liver and the whole body. A new series of chelating agents based on the incorporation of a trans-1,2- diaminocyclohexane moiety into the carbon backbone of polyaminocarboxylates is being synthesized. These are expected to provide stronger complexing ability for lead and produce greater in vivo stability. These ligands are also expected to be superior to EDTA and DTPA for labeling antibodies with other radiometals, including indium. 32 refs., 3 tabs.

  2. Tank 241-T-203, core 190 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Steen, F.H.


    This document is the analytical laboratory report for tank 241-T-203 push mode core segments collected on April 17, 1997 and April 18, 1997. The segments were subsainpled and analyzed in accordance with the Tank 241-T-203 Push Mode Core Sampling andanalysis Plan (TSAP) (Schreiber, 1997a), the Safety Screening Data Quality Objective (DQO)(Dukelow, et al., 1995) and Leffer oflnstructionfor Core Sample Analysis of Tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204 (LOI)(Hall, 1997). The analytical results are included in the data summary report (Table 1). None of the samples submitted for Differential Scanning Calorimetry (DSC), Total Alpha Activity (AT) and Total Organic Carbon (TOC) exceeded notification limits as stated in the TSAP (Schreiber, 1997a). The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems (TWRS) Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997b) and not considered in this report.

  3. Tank 241-T-203, core 190 analytical results for the final report

    International Nuclear Information System (INIS)

    This document is the analytical laboratory report for tank 241-T-203 push mode core segments collected on April 17, 1997 and April 18, 1997. The segments were subsainpled and analyzed in accordance with the Tank 241-T-203 Push Mode Core Sampling andanalysis Plan (TSAP) (Schreiber, 1997a), the Safety Screening Data Quality Objective (DQO)(Dukelow, et al., 1995) and Leffer oflnstructionfor Core Sample Analysis of Tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204 (LOI)(Hall, 1997). The analytical results are included in the data summary report (Table 1). None of the samples submitted for Differential Scanning Calorimetry (DSC), Total Alpha Activity (AT) and Total Organic Carbon (TOC) exceeded notification limits as stated in the TSAP (Schreiber, 1997a). The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems (TWRS) Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997b) and not considered in this report

  4. Microanalysis of oligosaccharide HS203 in beagle dog plasma by postcolumn fluorescence derivatization method. (United States)

    Sun, Shumeng; Zhao, Xia; Li, Guangsheng; Yu, Guangli; Xing, Xiaoxu; Zeng, Yangyang; Wu, Jian; Wang, Jianing


    A rapid and sensitive postcolumn fluorescence derivatization method was developed for microanalysis of antidiabetic oligosaccharide HS203 in beagle dog plasma. After plasma protein was removed by a simple and fast ultrafiltration method, chromatographic separation was performed on an Asahipak GS-320 HQ column with a mobile phase of 50 mmol/L phosphate buffer (pH 6.7) and acetonitrile (83/17, v/v). The column effluent was monitored by fluorescence detection at 249 nm (excitation) and 435 nm (emission) using guanidine hydrochloride as a postcolumn derivatizing reagent. A satisfactory resolution of the analyte was achieved and the limit of detection was found to be 4 ng (more sensitive than silver staining of HS203 in polyacrylamide gel electrophoresis). The method described above was successfully applied to a pharmacokinetic study of HS203 and to monitor blood glucose level simultaneously in beagle dog. It is also possible to be applied for microanalysis of other oligosaccharides in biological samples. PMID:24750771

  5. 203Pb-Labeled Alpha-Melanocyte-Stimulating Hormone Peptide as an Imaging Probe for Melanoma Detection

    Energy Technology Data Exchange (ETDEWEB)

    Yubin, Miao; Figueroa, Said D.; Fisher, Darrell R.; Moore, Herbert A.; Testa, Richard F.; Hoffman, Timothy J.; Quinn, Thomas P.


    Abbreviations: a-MSH; alpha melanocyte stimulating hormone, DOTA; 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid, Re(Arg11)CCMSH; DOTA-[Cys3,4,10, D-Phe7, Arg11]a-MSH3-13, NDP; [Nle4,d-Phe7] a-MSH3-13. Abstract Peptide-targeted alpha therapy with 200 mCi of 212Pb-DOTA-Re(Arg11)CCMSH cured 45% of B16/F1 murine melanoma-bearing C57 mice in a 120-day study, highlighting its melanoma treatment potential. However, there is a need to develop an imaging surrogate for patient specific dosimetry and to monitor the tumor response to 212Pb-DOTA-Re(Arg11)CCMSH therapy. The purpose of this study was to evaluate the potential of 203Pb-DOTA-Re(Arg11)CCMSH as a matched-pair SPECT imaging agent for 212Pb-DOTA-Re(Arg11)CCMSH. Method: DOTA-Re(Arg11)CCMSH was labeled with 203Pb in 0.5 M NH4OAc buffer at pH 5.4. The internalization and efflux of 203Pb-DOTA-Re(Arg11)CCMSH were determined in B16/F1 melanoma cells. The pharmacokinetics of 203Pb-DOTA-Re(Arg11)CCMSH were examined in B16/F1 melanoma-bearing C57 mice. A micro-SPECT/CT imaging study was performed with 203Pb-DOTA-Re(Arg11)CCMSH in a B16/F1 melanoma-bearing C57 mouse at 2 h post-injection. Results: 203Pb-DOTA-Re(Arg11)CCMSH was easily prepared in NH4OAc buffer and completely separated from the excess non-radiolabeled peptide by RP-HPLC. 203Pb-DOTA-Re(Arg11)CCMSH displayed fast internalization and extended retention in B16/F1 cells. Approximately 73% of 203Pb-DOTA-Re(Arg11)CCMSH activity internalized after a 20-min incubation at 25C. After incubating the cells in culture media for 20 min, 78% of internalized activity remained in the cells. 203Pb-DOTA-Re(Arg11)CCMSH exhibited similar biodistribution pattern with 212Pb-DOTA-Re(Arg11)CCMSH in B16/F1 melanoma-bearing mice. 203Pb-DOTA-Re(Arg11)CCMSH exhibited the peak tumor uptake of 12.00 +/- 3.20 %ID/g at 1 h post-injection. The tumor uptake gradually decreased to 3.43 +/- 1.12 %ID/g at 48 h post-injection. 203Pb-DOTA-Re(Arg11)CCMSH exhibited the peak tumor to kidney

  6. Production and radiochemical separation of 203Pb radioisotope for nuclear medicine

    International Nuclear Information System (INIS)

    Complete text of publication follows. The heavy metal pollution due to their industrial production, waste repository or accident as the cyanide spill in river Tisza in 2002, increase the scientific interest for using an ideal trace isotope for monitoring these type of events. The lead is one of the most toxic and commonly used heavy metal, its poisoning is often deadly because very difficult to recognize and identify. The neuro-scientific study of biodegradation effect of lead could be an impressive scientific field of application of 203Pb radioisotope. However the targeted radionuclide therapy especially the α-emitting radioisotope therapy is also strongly interested to find an ideal tracer for the 213Bi and 212Pb therapy. Therefore the 203Pb is a potential radioisotope for this role due to its radiation behaviour and as heavy metal element. The 203Tl(p,n) 203Pb nuclear reaction was chosen for the production. The irradiation was done at the compact cyclotron of Atomki with proton beam 14.5 MeV energy and beam current of 7 μAs. The thickness of the target material was 840 μm, the irradiation time was 3 hours and the produced activity was 40 MBq at EOB. It corresponds to 1.87 MBq/μAh physical yield of the reaction which correlating with the cross section curve. A new technique was developed for target preparation. The metal Tl was pressed into a copper backing and covered with a HAWAR foil with thickness of 11 μm. The covering foil saved the surface of the Tl from the oxidation and also transferred the dissipating heat to the cooling He gas. The back side of the target was cooled with pressured cold water. The irradiated Tl target was pressed out from the copper backing, which had only the thickness of 0.2 mm. Then the Thallium was dissolved in nitric acid. The excess acid was evaporated slowly. The nitrate form was transferred to chloride form by 8 mol/dm 3 HCl and the Thallium was kept in 3+ oxidation stage by hydrogen peroxide. The separation was carried out

  7. 16 CFR 20.3 - Misrepresentation of the terms “rebuilt,” “factory rebuilt,” “remanufactured,” etc. (United States)


    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Misrepresentation of the terms ârebuilt,â âfactory rebuilt,â âremanufactured,â etc. 20.3 Section 20.3 Commercial Practices FEDERAL TRADE COMMISSION... INDUSTRY § 20.3 Misrepresentation of the terms “rebuilt,” “factory rebuilt,” “remanufactured,” etc. (a)...

  8. Production and in vivo imaging of (203)Pb as a surrogate isotope for in vivo (212)Pb internal absorbed dose studies. (United States)

    Máthé, Domokos; Szigeti, Krisztián; Hegedűs, Nikolett; Horváth, Ildikó; Veres, Dániel S; Kovács, Béla; Szűcs, Zoltán


    (212)Pb is a clinically relevant therapeutic alpha emitter isotope. A surrogate, (203)Pb, if prepared with sufficiently high specific activity could be used to estimate (212)Pb in vivo absorbed doses. An improved production procedure of (203)Pb with a simple, new separation method and high specific radioactivity for imaging is reported. We determined the in-vivo biodistribution of (203)Pb in mice by SPECT/CT. This highlights application possibilities of (203)Pb for further in vivo and clinical uses (radiolabeled (212)Pb-peptide co-injection, dosimetry calculation). PMID:27156049

  9. Residual Waste from Hanford Tanks 241-C-203 and 241-C-204. 2. Contaminant Release Model

    International Nuclear Information System (INIS)

    Fusion analyses, water leaches, selective extractions, empirical solubility measurements, and thermodynamic modeling were used with results from solid-phase characterization studies [see companion paper (1)] to determine total concentrations, contaminant-phase associations, and develop contaminant release models for residual sludge from single-shell underground waste tanks 241-C-203 and 241-C-204 at the U.S. Department of Energy?s Hanford Site in southeastern Washington state. U and Tc are primary contaminants of concern because of their long half-lives and their generally high mobility in oxidizing soil and groundwater environments. Uranium release was determined to be controlled by two phases; ?ejkaite [Na4(UO2)(CO3)3] and poorly crystalline Na2U2O7 [or clarkeite Na[(UO2)O(OH)](H2O)0-1] which were identified in C-203 and C-204 sludge samples (1). U release was determined to occur in three stages from these phases. In the first stage, U release will be controlled by the solubility of ?ejkaite, which is suppressed by high concentrations of sodium released from dissolution of NaNO3 in the residual sludges. Equilibrium solubility calculations indicate the U released during this stage will have a maximum concentration of 0.021 M. When all the NaNO3 has dissolved from the sludge, the solubility of the remaining ?ejkaite will increase to 0.28 M. After ?ejkaite has completely dissolved, the maximum concentration of U released is expected to be controlled by the solubility of Na2U2O7 at a concentration of 3.0 ? 10-5 M. For Tc, a significant fraction of its concentration in the residual sludge was determined to be relatively insoluble (20 wt% for C-203 and 80 wt% for C-204). Because of the low concentrations of Tc in these sludge materials, the characterization studies did not identify any discrete Tc solids phases. Therefore, release of the readily soluble fraction of Tc was assumed to be controlled by the solubility of NaTcO4 at 7.1 M. Selective extraction results

  10. Final report for tank 241-B-203, push mode cores 115, 120 and 122

    International Nuclear Information System (INIS)

    This is the final laboratory report for tank 241-B-203 (B-203), cores 115, 120 and 122. Two fourteen-segment and one eleven-segment push-mode core samples from tank B-203 and a field blank sample were received at the 222-S Laboratory. Cores 115 (11 segments) and 120 (14 segments) were obtained from riser 2 and core 122 (14 segments) was obtained from riser 7. Core 115 was archived due to poor sample recovery and not analyzed (with an exception of liner liquid). The other two core samples underwent safety screening analyses in accordance with the sampling and analysis plan, differential scanning calorimetry (DSC), thermogravimetric analysis (TGA), total alpha analysis, and bulk density measurements. Bromide analysis by ion chromatography (IC) and lithium analysis by inductively coupled plasma atomic emission spectroscopy (ICP) were performed to determine if the samples were contaminated with any lithium bromide solution that may have been used during sampling. Total organic carbon (TOC) and cyanide (CN) analyses were completed for two samples with high exotherms. In addition to the core sample analysis, the tank headspace flammability was measured prior to core sampling as required by the SAP and Safety Screening DQO. None of the data indicate that the tank is unsafe when compared to the criteria in the Safety Screening Data Quality Objective. The tank has a high moisture content (approximately 75%). Two samples exceeded the DSC notification limit. However, re-analysis of these samples could not reproduce the same results (no exotherms detected). Also, secondary TOC and CN analyses on these samples indicated negligible fuel content. The one-sided 95-percent confidence intervals for total alpha results are well below the notification limit. Furthermore, the vapor in the tank B-203 dome space is far below the 25% lower flammability limit (LFL) stated in the SAP. Therefore, the results show that this tank may be considered safe. Water with a lithium bromide tracer, was

  11. Ovarian masses in children and adolescents in China: analysis of 203 cases


    Liu, Hongqian; Wang, Xiangao; Lu, Donghao; Liu, Zhihong; Shi, Gang


    Objective The true incidence of ovarian tumors in children is unknown. Few studies beyond case reports and case series have been published concerning pediatric ovarian tumors. Herein we review a large number of ovarian tumor cases. Methods The charts of 203 patients who presented with adnexal masses were reviewed. Results The patient’s ranged in age from 2 to 18 years (mean = 15.6 years), with 30 being premenarchal (14.8%). The incidence of ovarian tumor increases with age, especially in pati...

  12. Glutamic acid 203 of the cAMP-dependent protein kinase catalytic subunit participates in the inhibition by two isoforms of the protein kinase inhibitor. (United States)

    Baude, E J; Dignam, S S; Olsen, S R; Reimann, E M; Uhler, M D


    Although the protein kinase inhibitors (PKIs) are known to be potent and specific inhibitors of the catalytic (C) subunit of cAMP-dependent protein kinase, little is known about their physiological roles. Glutamate 203 of the C alpha isoform (C alpha E203) has been implicated in the binding of the arginine 15 residue of the skeletal isoform of PKI (PKI alpha R15) (Knighton, D. R., Zheng, J., Ten Eyck, L. F., Xuong, N., Taylor, S.S., and Sowadski, J. M. (1991) Science 253, 414-420). To investigate the role of C alpha E203 in the binding of PKI and in vivo C-PKI interactions, in vitro mutagenesis was used to change the C alpha E203 codon of the murine C alpha cDNA to alanine and glutamine codons. Initially, the C alpha E203 mutant proteins were expressed and purified from Escherichia coli. C alpha E203 is not essential for catalysis as all of the C subunit mutants were enzymatically active. The mutation of Glu203 did increase the apparent Km for Leu-Arg-Arg-Ala-Ser-Leu-Gly (Kemptide) severalfold but did not affect the apparent Km for ATP. The Vmax(app) was not affected by the mutation of C alpha E203. The mutation of C alpha E203 compromised the ability of PKI alpha (5-24), PKI alpha, and PKI beta to inhibit phosphotransferase activity. PKI alpha was altered using in vitro mutagenesis to probe the role of Arg15 in interacting with C alpha E203. The PKI alpha R15A mutant was reduced in its inhibition of C alpha. Preliminary studies of the expression of these C alpha mutants in COS cells gave similar results. These results suggest that the C alpha E203 mutants may be useful in assessing the role of PKI in vivo. PMID:7905001

  13. Study on selection and evaluation of japonica rice mutant E203 with superior grain quality

    International Nuclear Information System (INIS)

    Dry seeds of F0 come from the crossing of japonica rice Hainan 68 x Jia 52 were treated with 100 Gy of 60Co γ-rays, and the F1 were treated with 200 Gy of 60Co γ-rays. A japonica rice mutant with superior grain quality was selected in the following generation, and named as E203. It was demonstrated that the mutant had excellent milling and cooking quality as compared with its original parents and japonica rice variety Xiushui 11 with superior grain quality in Zhejiang province, better milling quality and almost the same cooking quality as compared with koshihikari--a famous japonica rice variety with superior quality introduced from Japan. It also had higher yield and stronger blast resistant ability. The above results show that it is possible and effective to improve grain quality of japonica rice by means of irradiation E203 with the improved comprehensive agronomic characters might be directly applied to the rice production, and might be used as a good gene resource of rice for improving grain quality in japonica rice breeding

  14. A catalog of 203 galaxy clusters serendipitously detected in the ROSAT PSPC pointed observations

    DEFF Research Database (Denmark)

    Vikhlinin, A.; McNamara, B.R.; Forman, W.; Jones, C.; Quintana, H.; Hornstrup, Allan


    We present a catalog of 203 clusters of galaxies serendipitously detected in 647 ROSAT PSPC high Galactic latitude pointings covering 158 deg(2). This is one of the largest X-ray-selected cluster samples, comparable in size only to the ROSAT All-Sky Survey sample of nearby clusters (Ebeling et al....... 1997). We detect clusters in the inner 17.'5 of the ROSAT PSPC field of view using the spatial extent of their X-ray emission. Fluxes of detected clusters range from 1.6 x 10(-14) to 8 x 10(-12) ergs s(-1) cm(-2) in the 0.5-2 keV energy band. X-ray luminosities range from 10(42) ergs s(-1......, optimized for finding extended sources in the presence of source confusion, is described in detail. Selection effects necessary for a statistical analysis of the cluster sample are comprehensively studied by Monte Carlo simulations. We have optically confirmed 203 of 223 X-ray sources as clusters of...

  15. Thermal effect on photolysis in 203Hg, 35S and 131I labeled mercury (II) iodide thiocyanate powders

    International Nuclear Information System (INIS)

    203Hg, 35S or 131I labeled mercury (II) iodide thiocyanate (HgISCN) powders were prepared, respectively. When the powders were exposed to sunlight, some parts of the crystals of the powders were decomposed and the decomposed atoms diffused toward crystal surface. This diffusion velocity was accelerated by thermal treatment of the darkened powders. The velocity is larger in order of 35S, 203Hg, 131I. Decomposed products consist of colloidal mercury, mercury iodide, mercury sulfide, sulfur dioxide and iodine. Mechanism of photochromism of HgISCN was discussed. (author)

  16. Photoelectrical properties of solid solution of (TIGaSe2)0.7(TIInS2)0.3

    International Nuclear Information System (INIS)

    Synthesis and development of new semiconductor compounds with complex of technical important properties, with a perfect crystal lattice and a high degree of purity is one of the main objectives of semiconductor Physics. In this paper it was studied some photoresistive characteristics of receivers based on (TIGaSe2)0.7(TIInS2)0.3 compounds. Bridgman method was also used, due to the layering structure. The experimental results showed that the photoresists based on (TIGaSe2)0.7(TIInS2)0.3 are photosensitive in the impurity region

  17. 5 CFR 894.203 - If I have a self plus one enrollment, when may I change which family member I want to cover or... (United States)


    ..., when may I change which family member I want to cover or change to self only? 894.203 Section 894.203... plus one enrollment, when may I change which family member I want to cover or change to self only? You may change your covered family member under a self plus one enrollment or change to self only...

  18. 25 CFR 162.203 - When can the regulations in this subpart be superseded or modified by tribal laws and leasing... (United States)


    ... modified by tribal laws and leasing policies? 162.203 Section 162.203 Indians BUREAU OF INDIAN AFFAIRS... When can the regulations in this subpart be superseded or modified by tribal laws and leasing policies... resolution establishing a general policy for the leasing of tribal and individually-owned agricultural...

  19. 30 CFR 203.42 - What conditions and limitations apply to royalty relief for deep wells and phase 1 ultra-deep wells? (United States)


    ... ROYALTY RATES OCS Oil, Gas, and Sulfur General Royalty Relief for Drilling Deep Gas Wells on Leases Not Subject to Deep Water Royalty Relief § 203.42 What conditions and limitations apply to royalty relief for... RSV under § 203.41 as a result of drilling any subsequent deep wells or phase 1 ultra-deep wells....

  20. 24 CFR 257.203 - Calculation of up-front and annual mortgage insurance premiums for H4H program mortgages. (United States)


    ... mortgage insurance premiums for H4H program mortgages. 257.203 Section 257.203 Housing and Urban... FOR HOUSING-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT MORTGAGE AND... mortgage insurance premiums for H4H program mortgages. (a) Applicable premiums. Any mortgage presented...

  1. 30 CFR 203.54 - How does my relief arrangement for an oil and gas lease operate if prices rise sharply? (United States)


    ... gas lease operate if prices rise sharply? 203.54 Section 203.54 Mineral Resources MINERALS MANAGEMENT... arrangement for an oil and gas lease operate if prices rise sharply? In those months when your current reference price rises by at least 25 percent above your base reference price, you must pay the...

  2. 7 CFR 330.203 - Action on applications for permits to move plant pests; form of and conditions in permits. (United States)


    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Action on applications for permits to move plant pests... PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.203 Action on applications for permits to move plant pests; form of and conditions...

  3. 48 CFR 203.104-4 - Disclosure, protection, and marking of contractor bid or proposal information and source... (United States)


    ..., and marking of contractor bid or proposal information and source selection information. 203.104-4....104-4 Disclosure, protection, and marking of contractor bid or proposal information and source selection information. (d)(3) For purposes of FAR 3.104-4(d)(3) only, DoD follows the...

  4. 78 FR 56655 - Foreign-Trade Zone (FTZ) 203-Moses Lake, Washington; Notification of Proposed Production Activity... (United States)


    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF COMMERCE Foreign-Trade Zones Board Foreign-Trade Zone (FTZ) 203--Moses Lake, Washington; Notification of Proposed Production Activity; AREVA Inc. (Fuel Rod Assemblies); Richland, Washington The Moses Lake Public...

  5. 76 FR 30908 - Foreign-Trade Zone 203-Moses Lake, Washington, Export-Only Manufacturing Authority, SGL... (United States)


    ... FR 1599, 1/11/2011). Section 400.32(b)(1)(ii) of the FTZ Board's regulations (15 CFR part 400) allows... Foreign-Trade Zones Board Foreign-Trade Zone 203--Moses Lake, Washington, Export-Only Manufacturing..., 2011, an application was submitted by the Port of Moses Lake Public Corporation, grantee of...

  6. 42 CFR 137.203 - May a Self-Governance Tribe participate in a voluntary national uniform data collection effort... (United States)


    ... 42 Public Health 1 2010-10-01 2010-10-01 false May a Self-Governance Tribe participate in a... HUMAN SERVICES TRIBAL SELF-GOVERNANCE Operational Provisions Health Status Reports § 137.203 May a Self-Governance Tribe participate in a voluntary national uniform data collection effort with the IHS? Yes,...

  7. Activation analysis of thallium in urine using the 203Tl(n,2n) 202Tl reaction

    International Nuclear Information System (INIS)

    The method developed by the authors of thallium determination in human urine, based on the 203Tl(n,2n)202Tl reaction followed by chemical separation and measurement of the produced 202Tl by gamma spectrometry, is described. Its application in some cases of intoxication by thallium is reported. The advantages and limitations of the described technique are discussed. (author)

  8. 42 CFR 413.203 - Transplant center costs for organs sent to foreign countries or transplanted in patients other... (United States)


    ...) Services and Organ Procurement Costs § 413.203 Transplant center costs for organs sent to foreign countries or transplanted in patients other than Medicare beneficiaries. (a) A transplant center's total costs... 42 Public Health 2 2010-10-01 2010-10-01 false Transplant center costs for organs sent to...

  9. 21 CFR 203.36 - Fulfillment houses, shipping and mailing services, comarketing agreements, and third-party... (United States)


    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Fulfillment houses, shipping and mailing services... Samples § 203.36 Fulfillment houses, shipping and mailing services, comarketing agreements, and third... manufacturer or authorized distributor of record that uses a fulfillment house, shipping or mailing service,...

  10. Measurement of Hg-203 activity induced in LiPb breeder material in D-T like neutron field

    International Nuclear Information System (INIS)

    Highlights: • Hg-203 produced in Pb and LiPb irradiated in 14 MeV D-T neutron field was measured. • MCNP5 with FENDL-2.1 transport library was used for experiment simulation. • Hg-203 activity was calculated with FISPACT-2007 with EAF-2010 library and MCNP. • C/E equals 0.85 for JEFF and FISPACT, 1.16 for JENDL and ca. 5 for FENDL library. -- Abstract: Hg-203 (T1/2 46.59 days) produced from Pb isotopes by fast neutrons is one of the most important radionuclide dominating in Pb in fusion power plant a few months after irradiation. Pb in Li15.7Pb breeder material will be irradiated in the HCLL TBM model by high fluxes of 14 MeV D-T fusion neutrons during test in ITER. The objective of the present work was to validate available computational tools and nuclear data used for calculation of Hg-203 activity produced in Pb and LiPb material irradiated in 14 MeV D-T like neutron fields. The samples of Pb and LiPb were irradiated in several day long experiment performed at FNG Laboratory in Frascati. Hg-203 activity in samples was measured after complete decay of Pb-203 interfering radioisotope with the use of HPGe spectrometers. The MCNP model of the experiment was developed and neutron fluxes in each sample were calculated with the use of FENDL-2.1 transport library. Hg-203 activities in samples were calculated using two methods: FISPACT-2007 code with EAF-2010 library and based on MCNP calculated reaction rates (Pb-206(n, α) and Pb-207(n, n′α)) with the use of JEFF-3.1, JENDL-4.0 and FENDL-2.1 libraries. Finally, the experimental and simulated results were compared and C/E values with assessed uncertainties calculated. The C/E value for JEFF-3.1 and EAF-2010 is 0.85 and for JENDL-4.0 is 1.16. The results with the use of FENDL-2.1 data are nearly one order of magnitude overestimated against experiment

  11. Distribution and retention of 203Hg-labelled methylmercury chloride in the peripheral and central nervous system of mice

    International Nuclear Information System (INIS)

    Distribution and retention of mercury in the nervous system was studied by macroautoradiography of the saggital whole body sections of mice killed 6 hours, 24 hours, 4 days, 8 days and 12 days after one dose of 203Hg-labeled methylmercury chloride (M203HgCl) was administered orally. To make a direct comparison of the distribution of M203HgCl at different times, sections of five mice killed at different times were exposed and developed simultaneously on a single sheet of film. A few days after administration, M203HgCl was distributed in larger amounts in the peripheral nerves, spinal cord, and brain than in cardiac blood. The trigeminal nerve, whose maximum concentration was observed 24 hours after administration, showed a rapid and high uptake, while accumulation in the sciatic nerve was definitely lower and slower, reaching a peak about 4 days after administration. In the central nervous system, M203HgCl increasingly accumulated day by day, reaching a peak between 4 and 8 days after administration. Concentration was especially high in the hippocampus, basal ganglia, and cortices of the occipital lobe and cerebellum. Accumulation in the spinal cord was somewhat lower than in the brain. A larger amount of mercury was retained in the central gray matter than in the white matter. In general, the uptake of mercury into the peripheral nerves was more rapid than the uptake into the brain and the spinal cord, in which a more delayed uptake and a more prolonged retention were observed. It is believed that the findings discussed in this experiment concerning the trigeminal nerve and the basal ganglia have not been reported previously. (Bell, E.)

  12. The SO-20.3 MC and A modernization plan final report

    International Nuclear Information System (INIS)

    Materials Control and Accountability (MC and A) provides assurance to the nation that nuclear materials are controlled in accordance with their strategic and economic importance and that the misuse, theft or diversion of these materials will be detected. MC and A plays an important part in security at nuclear facilities, especially in addressing threats such as theft of materials, environmental contamination, and nuclear safety incidents associated with nuclear materials. For this reason, it is important that MC and A takes advantage of new technologies and methods in order to provide information on a site's nuclear materials in the most timely and useful manner possible. Within the U.S. Department of Energy (DOE), the Office of Security Policy, Policy Integration and Technical Support Program (SO-20.3) is responsible for the development of safeguards and security technology that enables DOE and NNSA facilities to safeguard their Special Nuclear Materials. The SO-20.3 Program tasked safeguards personnel at Los Alamos National Laboratory to lead a project with representatives from the Y-12 Plant, Lawrence Livermore National Laboratory, and the Savannah River Site to prepare an MC and A Modernization Plan that provides recommendations for development new technologies and methodologies for MC and A in both new and existing DOE facilities. The team was tasked with taking into account new concerns about the protection of nuclear material following the attacks of September 11, 2001. Opportunities for applying new MC and A approaches and technologies that provide increased freedom of operation, increased security and provide a potential for cost savings in existing and new DOE facilities are discussed in this report.

  13. Biodistribution and radiation dosimetry of a positron emission tomographic ligand, 18F-SP203, to image metabotropic glutamate subtype 5 receptors in humans

    International Nuclear Information System (INIS)

    A new PET ligand, 3-fluoro-5-(2-(2-18F-(fluoromethyl)-thiazol-4-yl)ethynyl)benzonitrile (18F-SP203), is a positron emission tomographic radioligand selective for metabotropic glutamate subtype 5 receptors. The purposes of this study were to estimate the radiation-absorbed doses of 18F-SP203 in humans and to determine from the distribution of radioactivity in bone structures with various proportions of bone and red marrow whether 18F-SP203 undergoes defluorination. Whole-body images were acquired for 5 h after injecting 18F-SP203 in seven healthy humans. Urine was collected at various time points. Radiation-absorbed doses were estimated by the Medical Internal Radiation Dose scheme. After injecting 18F-SP203, the two organs with highest radiation exposure were urinary bladder wall and gallbladder wall, consistent with both urinary and fecal excretion. In the skeleton, most of the radioactivity was in bone structures that contain red marrow and not in those without red marrow. Although the dose to red marrow (30.9 μSv/MBq) was unusually high, the effective dose (17.8 μSv/MBq) of 18F-SP203 was typical of that of other 18F radiotracers. 18F-SP203 causes an effective dose in humans typical of several other 18F radioligands and undergoes little defluorination. (orig.)

  14. Regulation of Cell Proliferation and Migration by miR-203 via GAS41/miR-10b Axis in Human Glioblastoma Cells (United States)

    Pal, Dhananjaya; Mukhopadhyay, Debasmita; Ramaiah, M. Janaki; Sarma, Pranjal; Bhadra, Utpal; Bhadra, Manika Pal


    Glioma amplified sequence 41(GAS41) is a potent transcription factor that play a crucial role in cell proliferation and survival. In glioblastoma, the expression of GAS41 at both transcriptional and post transcriptional level needs to be tightly maintained in response to cellular signals. Micro RNAs (miRNA) are small non coding RNA that act as important regulators for modulating the expression of various target genes. Studies have shown that several miRNAs play role in the post-transcriptional regulation of GAS41. Here we identified GAS41 as a novel target for endogenous miR-203 and demonstrate an inverse correlation of miR-203 expression with GAS41 in glioma cell lines (HNGC2 and U87). Over expression of miR-203 negatively regulates GAS41 expression in U87 and HNGC2 cell lines. Moreover, miR-203 restrained miR-10b action by suppressing GAS41. GAS41 is essential for repressing p53 in tumor suppressor pathway during cell proliferation. Enforced expression of GAS41 produced contradictory effect on miR-203 but was able to enhance p53 tumor suppressor pathway associated protein. It was also found that miR-203 maintains the stability of p53 as knock down of p53 expression using siRNA resulted in down regulation of pri-miR and mature miR-203 expression. Conversely reconstitution of miR-203 expression induced apoptosis and inhibited migratory property of glioma cells. Taken together, we show that miR-203 is a key negative regulator of GAS41 and acts as tumor suppressor microRNA in glioma. PMID:27467502

  15. 30 CFR 203.60 - Who may apply for royalty relief on a case-by-case basis in deep water in the Gulf of Mexico or... (United States)


    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Who may apply for royalty relief on a case-by-case basis in deep water in the Gulf of Mexico or offshore of Alaska? 203.60 Section 203.60 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT RELIEF OR REDUCTION IN ROYALTY RATES OCS Oil, Gas,...

  16. 30 CFR 203.31 - If I have a qualified phase 2 or qualified phase 3 ultra-deep well, what royalty relief would... (United States)


    ... which is 16,000 feet TVD SS and your lease is located in water 100 meters deep. Then in 2008, you drill...-Deep Wells on Leases Not Subject to Deep Water Royalty Relief § 203.31 If I have a qualified phase 2 or... water less than 400 meters deep (see § 203.30(a)), has no existing deep or ultra-deep wells and that...

  17. Hanford Tanks 241-C-203 and 241-C-204: Residual Waste Contaminant Release Model and Supporting Data

    International Nuclear Information System (INIS)

    This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy

  18. Hanford Tanks 241-C-203 and 241 C 204: Residual Waste Contaminant Release Model and Supporting Data

    International Nuclear Information System (INIS)

    This report was revised in May 2007 to correct 90Sr values in Chapter 3. The changes were made on page 3.9, paragraph two and Table 3.10; page 3.16, last paragraph on the page; and Tables 3.21 and 3.31. The rest of the text remains unchanged from the original report issued in October 2004. This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy.

  19. Effects of Fe203 Nanoparticles on Water Permeability and Strength Assessments of High Strength Self-Compacting Concrete

    Institute of Scientific and Technical Information of China (English)

    Ali Khoshakhlagh; All Nazar; Gholarnreza Khala


    In this work, compressive, flexural and split tensile strength together with coefficient of water absorption of high performance self-compacting concrete containing different amount of Fe2Os nanoparticles have been investigated. The strength and the water permeability of the specimens have been improved by adding Fe2Os nanoparticles in the cement paste up to 4.0 wt%. Fe203 nanoparticle as a foreign nucleation site could accelerate C-S-H gel formation as a result of increased crystalline Ca(OH)2 amount especially at the early age of hydration and hence increase the strength of the specimens. In addition, Fe203 nanoparticles are able to act as nanofillers and recover the pore structure of the specimens by decreasing harmful pores to improve the water permeability. Several empirical relations have been presented to predict the flexural and the split tensile strength of the specimens by means of the corresponding compressive strength at a certain age of curing. Accelerated peak appearance in conduction calorimetry tests, more weight loss in thermogravimetric analysis and more rapid appearance of peaks related to hydrated products in X-ray diffraction results indicate that Fe203 nanoparticles up to 4 wt% could improve the mechanical and the physical properties of the specimens.

  20. Hanford Tanks 241-C-203 and 241-C-204: Residual Waste Contaminant Release Model and Supporting Data

    Energy Technology Data Exchange (ETDEWEB)

    Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.


    This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy.

  1. Hanford Tanks 241-C-203 and 241 C 204: Residual Waste Contaminant Release Model and Supporting Data

    Energy Technology Data Exchange (ETDEWEB)

    Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.


    This report was revised in May 2007 to correct 90Sr values in Chapter 3. The changes were made on page 3.9, paragraph two and Table 3.10; page 3.16, last paragraph on the page; and Tables 3.21 and 3.31. The rest of the text remains unchanged from the original report issued in October 2004. This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy.

  2. Effects of some chelating agents on the uptake and distribution of 203Hg2+ in the brown trout (Salmo trutta): Studies on ethyl- and isopropylxanthate diethyl- and diisopropyldithiophosphate, dimethyl- and diethyldithiocarbamate and pyridinethione

    International Nuclear Information System (INIS)

    Brown trout, Salmo trutta, were exposed to water containing 0.1 μg/l 203Hg2+, alone or with potassium ethylxanthate (PEX), sodium isopropylxanthate (SIX), sodium diethyldithiophosphate (SEP), sodium diisopropyldithiophosphate (SIP), sodium dimethyldithiocarbamate (SMC), sodium diethyldithiocarbamate (SEC) or sodium pyridinethione (SPyr), respectively. After 1 week the uptake and distribution of the 203Hg2+ in the fish were examined by gamma spectrometry, SIX, SIP, SMC, SEC and SPyr induced 2-3 times higher 203Hg2+ concentrations in most tissues in comparison with trout exposed to 203Hg2+ only. In the trout exposed to PEX slightly enhanced 203Hg2+ levels were found only in some tissues, and after exposure to SEP a few tissues showed decreased 203Hg2+ concentrations. Determinations of chloroform/water partition coefficients showed that lipophilic chelates are formed between all the examined substances and the 203Hg2+. However, SIX, SIP, SMC, SEC and SPyr, which induced markedly increased tissue levels of the metal, formed 203Hg2+ complexes with higher lipophilicities than SEX and SEP. A facilitated penetration of the lipophilic 203Hg2+ complexes over the gill membranes may underly the increment in the tissue levels of the metal, and the relative lipophilicity of the complexes may be of importance for this effect. In some instances, as with SEP, the 203Hg2+ chelated in complexes with low lipophilicity may even be less able to acumulate in some tissues than the non-complexed metal. (orig.)

  3. A catalog of 203 galaxy clusters serendipitously detected in the ROSAT PSPC pointed observations

    DEFF Research Database (Denmark)

    Vikhlinin, A.; McNamara, B.R.; Forman, W.;


    ), corresponding to very poor groups, to similar to 5 x 10(44) ergs s(-1), corresponding to rich clusters. The cluster redshifts range from z = 0.015 to z > 0.5. The catalog lists X-ray fluxes, core radii, and spectroscopic redshifts for 73 clusters and photometric redshifts for the remainder. Our detection method......We present a catalog of 203 clusters of galaxies serendipitously detected in 647 ROSAT PSPC high Galactic latitude pointings covering 158 deg(2). This is one of the largest X-ray-selected cluster samples, comparable in size only to the ROSAT All-Sky Survey sample of nearby clusters (Ebeling et al....... 1997). We detect clusters in the inner 17.'5 of the ROSAT PSPC field of view using the spatial extent of their X-ray emission. Fluxes of detected clusters range from 1.6 x 10(-14) to 8 x 10(-12) ergs s(-1) cm(-2) in the 0.5-2 keV energy band. X-ray luminosities range from 10(42) ergs s(-1...

  4. Maternal-fetal distribution of mercury ( sup 203 Hg) released from dental amalgam fillings

    Energy Technology Data Exchange (ETDEWEB)

    Vimy, M.J.; Takahashi, Y.; Lorscheider, F.L. (Univ. of Calgary, Alberta (Canada))


    In humans, the continuous release of Hg vapor from dental amalgam tooth restorations is markedly increased for prolonged periods after chewing. The present study establishes a time-course distribution for amalgam Hg in body tissues of adult and fetal sheep. Under general anesthesia, five pregnant ewes had twelve occlusal amalgam fillings containing radioactive 203Hg placed in teeth at 112 days gestation. Blood, amniotic fluid, feces, and urine specimens were collected at 1- to 3-day intervals for 16 days. From days 16-140 after amalgam placement (16-41 days for fetal lambs), tissue specimens were analyzed for radioactivity, and total Hg concentrations were calculated. Results demonstrate that Hg from dental amalgam will appear in maternal and fetal blood and amniotic fluid within 2 days after placement of amalgam tooth restorations. Excretion of some of this Hg will also commence within 2 days. All tissues examined displayed Hg accumulation. Highest concentrations of Hg from amalgam in the adult occurred in kidney and liver, whereas in the fetus the highest amalgam Hg concentrations appeared in liver and pituitary gland. The placenta progressively concentrated Hg as gestation advanced to term, and milk concentration of amalgam Hg postpartum provides a potential source of Hg exposure to the newborn. It is concluded that accumulation of amalgam Hg progresses in maternal and fetal tissues to a steady state with advancing gestation and is maintained. Dental amalgam usage as a tooth restorative material in pregnant women and children should be reconsidered.

  5. Optimization of procedures for mercury-203 instrumental neutron activation analysis in human urine

    International Nuclear Information System (INIS)

    Mercury, a known neurotoxin, has been implicated in etiology and pathogenesis of such disease states as Alzheimer's and Parkinson's diseases. There is concern that the exposure to mercury vapor released from dental amalgam restorations is a potential health hazard. Measurement of mercury concentrations in blood or urine may be useful in diagnosis of mercury poisoning and in assessing the extent exposure. This study describes the optimization of pre-neutron activation analysis procedures such as sampling, selection of irradiation and counting vials and acid digestion in order to minimize mercury loss via volatilization and/or permeation through containers. Therefore, the determination of mercury can be complicated by these potential losses. In the optimized procedure 20mL of urine was spiked with three different concentrations of mercury, digested with concentrated nitric acid, and placed in polypropylene vials for irradiation and counting. Analysis was performed by subtracting the Se-75 photopeak contribution to the 279 keV Hg-203 photopeak and applying the method of standard additions. Urinary mercury concentrations in normal human subjects were determined to be of the order of 10ng/mL. (author). 22 refs., 1 fig., 5 tabs

  6. Maternal-fetal distribution of mercury (203Hg) released from dental amalgam fillings

    International Nuclear Information System (INIS)

    In humans, the continuous release of Hg vapor from dental amalgam tooth restorations is markedly increased for prolonged periods after chewing. The present study establishes a time-course distribution for amalgam Hg in body tissues of adult and fetal sheep. Under general anesthesia, five pregnant ewes had twelve occlusal amalgam fillings containing radioactive 203Hg placed in teeth at 112 days gestation. Blood, amniotic fluid, feces, and urine specimens were collected at 1- to 3-day intervals for 16 days. From days 16-140 after amalgam placement (16-41 days for fetal lambs), tissue specimens were analyzed for radioactivity, and total Hg concentrations were calculated. Results demonstrate that Hg from dental amalgam will appear in maternal and fetal blood and amniotic fluid within 2 days after placement of amalgam tooth restorations. Excretion of some of this Hg will also commence within 2 days. All tissues examined displayed Hg accumulation. Highest concentrations of Hg from amalgam in the adult occurred in kidney and liver, whereas in the fetus the highest amalgam Hg concentrations appeared in liver and pituitary gland. The placenta progressively concentrated Hg as gestation advanced to term, and milk concentration of amalgam Hg postpartum provides a potential source of Hg exposure to the newborn. It is concluded that accumulation of amalgam Hg progresses in maternal and fetal tissues to a steady state with advancing gestation and is maintained. Dental amalgam usage as a tooth restorative material in pregnant women and children should be reconsidered

  7. Critical experiments on low-enriched uranium oxide systems with H/U = 2.03

    International Nuclear Information System (INIS)

    Seven critical experiments were performed on a horizontal split table machine using 4.48% enriched 235U uranium oxide (U3O8). The oxide was compacted to a density of 4.68 g/cm3 and placed in 152-mm cubical aluminum cans. Water was added to achieve an H/U atomic ratio of 2.03. Various arrays of oxide cans were distributed on each half of the split table and the separation between halves reduced until criticality occurred. The critical table separation varied from 4.3 mm to 29.3 mm. These experiments were performed in both plastic and concrete reflectors. The first five experiments required the addition of a high-enriched (approx. 93% 235U) metal driver to achieve criticality. Critical uranium driver masses ranged from 2.765 kg to 13.730 kg for 5 x 5 x 5 arrays of uranium oxide cans. In all five cases, the center can of the array was deleted to accommodate the driver. The uranium oxide mass was 1859.6 kg. Two additional experiments in the plastic reflector contained either 9.3-mm- or 24.3-mm-thick plastic moderator material between the oxide cans. These latter experiments did not require a driver to achieve criticality; and the uranium oxide mass was 723.9 kg for the configuration having the thinner interstitial moderator and 452.4 kg for the other


    Institute of Scientific and Technical Information of China (English)



    The transport engineering has massive tunnel construction, and the tunnel construction is likely to be affected by adverse geological structures. In order to reduce the influence of geological disaster on tunnel construction, researchers use the TSP2O3 geological forecast system to carry out the survey in front of the tunnel face and provide in advance geological prediction that could give instructions for the following construction; nevertheless, due to the existence of much misinformation in the practical application, these means often fail to report the situation or the accurate of the report is too low. These problems often result from the insufficient data acquisition and data processing. Through standard data acquisition and reasonable data processing, the adverse effect might be reduced, and the application accuracy of the TSP203 system in the geological forecast could be improved.%为了减少地质灾害对隧道施工的影响,采用 TSP203超前地质预报系统对隧道掌子面前方进行探测,提供超前地质预报,为后续施工提供指导.但是,在实际应用中出现了很多误报、漏报或者准确性太低的情况,这些问题往往是由于数据采集和数据处理中的不足带来的.通过规范的数据采集和合理的数据处理,可以减少这些不足的不良影响,从而提高TSP203系统在超前地质预报应用中的准确性.

  9. Synthesis and characterization in monkey of [{sup 11}C]SP203 as a radioligand for imaging brain metabotropic glutamate 5 receptors

    Energy Technology Data Exchange (ETDEWEB)

    Simeon, Fabrice G.; Liow, Jeih-San; Zhang, Yi; Hong, Jinsoo; Gladding, Robert L.; Zoghbi, Sami S.; Innis, Robert B.; Pike, Victor W. [National Institutes of Health, Molecular Imaging Branch, National Institute of Mental Health, Bethesda, MD (United States)


    [{sup 18}F]SP203 (3-fluoro-5-(2-(2-([{sup 18}F]fluoromethyl)-thiazol-4-yl)ethynyl)benzonitrile) is an effective high-affinity and selective radioligand for imaging metabotropic 5 receptors (mGluR5) in human brain with PET. To provide a radioligand that may be used for more than one scanning session in the same subject in a single day, we set out to label SP203 with shorter-lived {sup 11}C (t{sub 1/2} = 20.4 min) and to characterize its behavior as a radioligand with PET in the monkey. Iodo and bromo precursors were obtained by cross-coupling 2-fluoromethyl-4-((trimethylsilyl)ethynyl)-1,3-thiazole with 3,5-diiodofluorobenzene and 3,5-dibromofluorobenzene, respectively. Treatment of either precursor with [{sup 11}C]cyanide ion rapidly gave [{sup 11}C]SP203, which was purified with high-performance liquid chromatography. PET was used to measure the uptake of radioactivity in brain regions after injecting [{sup 11}C]SP203 intravenously into rhesus monkeys at baseline and under conditions in which mGluR5 were blocked with 3-[(2-methyl-1,3-thiazol-4-yl)ethynyl]pyridine (MTEP). The emergence of radiometabolites in monkey blood in vitro and in vivo was assessed with radio-HPLC. The stability of [{sup 11}C]SP203 in human blood in vitro was also measured. The iodo precursor gave [{sup 11}C]SP203 in higher radiochemical yield (>98 %) than the bromo precursor (20-52 %). After intravenous administration of [{sup 11}C]SP203 into three rhesus monkeys, radioactivity peaked early in brain (average 12.5 min) with a regional distribution in rank order of expected mGluR5 density. Peak uptake was followed by a steady decline. No radioactivity accumulated in the skull. In monkeys pretreated with MTEP before [{sup 11}C]SP203 administration, radioactivity uptake in brain was again high but then declined more rapidly than in the baseline scan to a common low level. [{sup 11}C]SP203 was unstable in monkey blood in vitro and in vivo, and gave predominantly less lipophilic radiometabolites

  10. Epidermal anti-Inflammatory properties of 5,11,14 20:3: Effects on mouse ear edema, PGE2 levels in cultured keratinocytes, and PPAR activation

    Directory of Open Access Journals (Sweden)

    Baur Markus


    Full Text Available Abstract Background 5,11,14 20:3 is similar to 20:4n-6 but lacks the internal Δ8 double bond essential for prostaglandin and eicosanoid synthesis. When previously fed to laboratory animals as a gymnosperm seed oil component it has shown anti-inflammatory properties. Results Herein, topically applied Podocarpus nagi methyl esters (containing 26% 5,11,14 20:3 were incorporated into mouse ear phospholipids, reduced 20:4n-6, and reduced 20:4n-6- and TPA-induced mouse ear edema. Purified 5,11,14 20:3 was taken up by cultured human skin keratinocytes, reduced 20:4n-6, and reduced PGE2 levels dramatically. Purified 5,11,14 20:3 did not affect PPARα, PPARγ, or PPARδ transactivation. Conclusions Topical application of 5,11,14 20:3 to skin surfaces can thus reduce inflammatory processes, most likely by displacing 20:4n-6 from phospholipid pools and reducing downstream inflammatory products derived from 20:4n-6 such as PGE2 and leukotrienes. It could have potential use in treating clinical skin disorders resulting from overproduction of 20:4n-6-derived eicosanoid products.

  11. Conventional superconductivity at 203 kelvin at high pressures in the sulfur hydride system (United States)

    Drozdov, A. P.; Eremets, M. I.; Troyan, I. A.; Ksenofontov, V.; Shylin, S. I.


    A superconductor is a material that can conduct electricity without resistance below a superconducting transition temperature, Tc. The highest Tc that has been achieved to date is in the copper oxide system: 133 kelvin at ambient pressure and 164 kelvin at high pressures. As the nature of superconductivity in these materials is still not fully understood (they are not conventional superconductors), the prospects for achieving still higher transition temperatures by this route are not clear. In contrast, the Bardeen-Cooper-Schrieffer theory of conventional superconductivity gives a guide for achieving high Tc with no theoretical upper bound--all that is needed is a favourable combination of high-frequency phonons, strong electron-phonon coupling, and a high density of states. These conditions can in principle be fulfilled for metallic hydrogen and covalent compounds dominated by hydrogen, as hydrogen atoms provide the necessary high-frequency phonon modes as well as the strong electron-phonon coupling. Numerous calculations support this idea and have predicted transition temperatures in the range 50-235 kelvin for many hydrides, but only a moderate Tc of 17 kelvin has been observed experimentally. Here we investigate sulfur hydride, where a Tc of 80 kelvin has been predicted. We find that this system transforms to a metal at a pressure of approximately 90 gigapascals. On cooling, we see signatures of superconductivity: a sharp drop of the resistivity to zero and a decrease of the transition temperature with magnetic field, with magnetic susceptibility measurements confirming a Tc of 203 kelvin. Moreover, a pronounced isotope shift of Tc in sulfur deuteride is suggestive of an electron-phonon mechanism of superconductivity that is consistent with the Bardeen-Cooper-Schrieffer scenario. We argue that the phase responsible for high-Tc superconductivity in this system is likely to be H3S, formed from H2S by decomposition under pressure. These findings raise hope for the

  12. Fabry-Perot Kinematics of HH 202, 203-204 in the Orion Nebula Are they part of a Big Bipolar Outflow?

    CERN Document Server

    Rosado, M; Arias, L; Le Coarer, E; Rosado, Margarita; Fuente, Eduardo de la; Arias, Lorena


    We present a kinematic study of the Herbig-Haro objects HH 202, 203 and 204 using Halpha and [NII] Fabry-Perot velocity maps. For HH 202 we find new features that could belong to this HH object or that perhaps are associated with an outflow different from HH 202. Because of its high velocity (up to 100 km/seg) this outflow probably can be a HH flow not catalogued previously. Large internal motions are found in the fainter regions of HH 203-204, as well as evidence of transverse density gradients. We show that the apex of HH 204 is the zone of maximum velocity in agreement with bow shock models. From our studies, we find kinematic evidence that suggests that HH 203-204 and HH 202 are part of a single and large (approx 0.55 pc) HH flow.

  13. Investigation of 203,205Hg with the (d,pγ) reaction - identification of the i13/2 neutron hole state in 205Hg

    International Nuclear Information System (INIS)

    Low lying levels in 203Hg and 205Hg were studied with the (d, p) deuteron break-up reaction at Ed=14 and 18 MeV. Gamma-rays and conversion-electrons were measured in coincidence with protons. In addition delayed spectra were recorded with μs and ms beam pulsing. The i13/2 neutron hole state was identified in 205Hg and confirmed in 203Hg. The known level structure of 205Hg below 2 MeV is confirmed and extended. For 203Hg we observe the γ-decay of several levels below 1.5 MeV, which were previously known from transfer reactions. (orig.)

  14. Upregulation of miR-203 and miR-210 affect growth and differentiation of keratinocytes after exposure to sulfur mustard in normoxia and hypoxia. (United States)

    Deppe, Janina; Steinritz, Dirk; Santovito, Donato; Egea, Virginia; Schmidt, Annette; Weber, Christian; Ries, Christian


    Exposure of the skin to sulfur mustard (SM) results in long-term complications such as impaired tissue regeneration. Previous own studies in normal human epidermal keratinocytes (NHEK) treated with SM demonstrated reduced proliferation, premature differentiation and a restricted functionality of hypoxia-mediated signaling in the cells. Here, we investigated the involvement of microRNAs, miR-203 and miR-210, in these mechanisms. SM significantly upregulated the expression of miR-203 in NHEK when cultivated under normoxic and hypoxic conditions. SM had no effect on miR-210 under normoxia. However, miR-210 levels were greatly increased in NHEK when grown in hypoxia and further elevated upon exposure of the cells to SM. In normoxia and hypoxia, inhibition of miR-203 by transfection of NHEK with complementary oligonucleotides, anti-miR-203, attenuated the SM-induced impairment of metabolic activity and proliferation, and counteracted SM-promoted keratin-1 expression in these cells. Consistent ameliorating effects on dysregulated metabolic activity, proliferation and keratin-1 expression in SM-treated NHEK were obtained upon inhibition of miR-210 in these cells grown in hypoxia. Our findings provide evidence that miR-203 and miR-210 are key regulators in normal and SM-impaired keratinocyte functionality, and suggest potential usefulness of inhibitors against miR-203 and miR-210 for target-directed therapeutical intervention to improve re-epithelialization of SM-injured skin. PMID:26383628

  15. Hanford Tanks 241-C-202 and 241-C-203 Residual Waste Contaminant Release Models and Supporting Data

    Energy Technology Data Exchange (ETDEWEB)

    Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Mattigod, Shas V.; Schaef, Herbert T.; Arey, Bruce W.


    As directed by Congress, the U. S. Department of Energy (DOE) established the Office of River Protection in 1998 to manage DOE's largest, most complex environmental cleanup project – retrieval of radioactive waste from Hanford tanks for treatment and eventual disposal. Sixty percent by volume of the nation's high-level radioactive waste is stored at Hanford in aging deteriorating tanks. If not cleaned up, this waste is a threat to the Columbia River and the Pacific Northwest. CH2M Hill Hanford Group, Inc., is the Office of River Protection's prime contractor responsible for the storage, retrieval, and disposal of Hanford's tank waste. As part of this effort, CH2M HILL Hanford Group, Inc. contracted with Pacific Northwest National Laboratory (PNNL) to develop release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for DOE.

  16. Hanford Tanks 241-C-202 and 241-C-203 Residual Waste Contaminant Release Models and Supporting Data

    International Nuclear Information System (INIS)

    As directed by Congress, the U. S. Department of Energy (DOE) established the Office of River Protection in 1998 to manage DOE's largest, most complex environmental cleanup project retrieval of radioactive waste from Hanford tanks for treatment and eventual disposal. Sixty percent by volume of the nation's high-level radioactive waste is stored at Hanford in aging deteriorating tanks. If not cleaned up, this waste is a threat to the Columbia River and the Pacific Northwest. CH2M Hill Hanford Group, Inc., is the Office of River Protection's prime contractor responsible for the storage, retrieval, and disposal of Hanford's tank waste. As part of this effort, CH2M HILL Hanford Group, Inc. contracted with Pacific Northwest National Laboratory PNNL to develop release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for DOE.

  17. Process for producing astatine-211 for radiopharmaceutical use

    International Nuclear Information System (INIS)

    A one-step chemical manipulation is described in combination with a distillation and collection process for producing At-211 comprising; a. providing a target of irradiated Bismuth coated to a predetermined thickness of a backing member, b. providing a vapor-producing still operably connected with a condenser that has a water cooled condensate collector formed of a dry silica gel mesh maintained at a temperature above the freezing point of water, and providing an effluent gas filter that is operably connected to receive effluent gas from the condenser, c. heating the target in the still at a temperature in the range of about 6300-6800C for a time period in the range of 50 to 80 minutes, to evole At-211 vapor from the target, c. providing a dry carrier gas having an oxygen concentration that is sufficient to form Bi/sub 2/O/sub 3/ thereby to essentially preclude vaporization of Bi metal, passing the carrier gas through the still to carry the At-211 vapor to the condenser, and to carry effluent from the condenser to the effluent gas filter, e. eluting At-211 from the condensate collector of the condenser with a controlled volume of eluent containing predetermined solvents that are compatible with a given desired radiopharmaceutical procedure, and f. collecting the At-211 in the controlled volume of eluent for use in the given radiopharmaceutical procedure

  18. Electro-acupuncture Treatment on 203 Cases for T2MD with Obesity%电针治疗T2DM伴肥胖203例研究

    Institute of Scientific and Technical Information of China (English)

    张娜; 刘志诚; 徐斌


    观察电针治疗2型糖尿(T2DM)病肥胖患者的疗效。方法:电针治疗203例T2DM伴肥胖患者。观察治疗3个月前后患者空腹血糖(FBS)、空腹胰岛素(FINS)、胰岛素敏感指数(ISI)、胰岛素抵抗指数(Homa-IR)、胰岛素分泌指数(Homa-茁)、肥胖度(A)、体质量(Kg)、体质指数(BMI)和体脂百分率(F%)的变化,观察肥胖和证型对电针降糖疗效的影响。结果:与治疗前相比,203例患者经治疗后,FINS、Homa-IR、FBS都有显著回降(P<0.01),ISI、Homa-茁显著回升(P<0.01),治疗前后比较胰岛茁细胞功能改善均有显著统计学意义;A、体质量、BMI、F%均显著下降(P<0.01)。肥胖能影响电针加耳针降糖疗效,证型无影响。结论:电针能显著纠正T2DM伴肥胖患者的血糖,保护胰岛茁细胞功能,并且能降低患者体质量。%This study was aimed to observe the effect of electro-acupuncture (EA) treatment on Zhong-Xiao (ZX, T2MD) with obesity. A total of 203 patients with ZX accompanied with obesity accepted EA treatment. Before and after 3-month treatment, observations were made on patients' fasting blood glucose (FBS), fasting insulin (FINS), in-sulin sensitivity index (ISI), insulin resistance index (Homa-IR), insulin secretion index (Homa-β), degree of obesity (A), body mass (Kg), body mass index (BMI) and body fat percentage (F%) changes. The results showed that com-pared with pretreatment, the posttreatment FINS, Homa-IR, FBS had a significant decrease among 203 patients (P<0.01); the ISI and Homa-β had a significant increase (P < 0.01). There was a significant statistical difference on islet β-cell function before and after treatment. The A, body mass, BMI, and F% were significantly decreased (P<0.01). It was concluded that EA can significantly correct ZX with obesity patients' glucose consumption, protect the islet β-cell function, and reduce the body mass of patients.

  19. Phytophthora fruit rot-resistant watermelon germplasm lines: USVL489-PFR, USVL782-PFR, USVL203-PFR, and USVL020-PFR (United States)

    USVL489-PFR, USVL782-PFR, USVL203-PFR, and USVL020-PFR are watermelon (Citrullus lanatus var. lanatus (Thunb.) Matsum. & Nakai) germplasm lines that exhibit high levels of resistance to Phytophthora fruit rot caused by the plant pathogen Phytophthora capsici. Resistance in these germplasm lines is ...

  20. 30 CFR 203.41 - If I have a qualified deep well or a qualified phase 1 ultra-deep well, what royalty relief would... (United States)


    ... of water and production must begin on this well before May 3, 2009. If drilling of the second well... Leases Not Subject to Deep Water Royalty Relief § 203.41 If I have a qualified deep well or a qualified... royalties paid on production from qualified wells on a lease that is located in water entirely deeper...

  1. 30 CFR 203.34 - To which production may an RSV earned by qualified phase 2 and phase 3 ultra-deep wells on my... (United States)


    ... Leases Not Subject to Deep Water Royalty Relief § 203.34 To which production may an RSV earned by..., on a lease that is located entirely or partly in water less than 200 meters deep; or (2) May 18, 2007, on a lease that is located entirely in water more than 200 meters deep....

  2. 30 CFR 203.33 - To which production do I apply the RSV earned by qualified phase 2 and phase 3 ultra-deep wells... (United States)


    ... RELIEF OR REDUCTION IN ROYALTY RATES OCS Oil, Gas, and Sulfur General Royalty Relief for Drilling Ultra-Deep Wells on Leases Not Subject to Deep Water Royalty Relief § 203.33 To which production do I apply... the unitized portion of lease A (drilled after the ultra-deep well on the non-unitized portion of...

  3. 30 CFR 203.30 - Which leases are eligible for royalty relief as a result of drilling a phase 2 or phase 3 ultra... (United States)


    ... Subject to Deep Water Royalty Relief § 203.30 Which leases are eligible for royalty relief as a result of... located in the GOM wholly west of 87 degrees, 30 minutes West longitude in water depths entirely less than... entirely less than 400 meters of water, it must either: (1) Have been issued before November 28, 1995,...

  4. 30 CFR 203.32 - What other requirements or restrictions apply to royalty relief for a qualified phase 2 or phase... (United States)


    ... REDUCTION IN ROYALTY RATES OCS Oil, Gas, and Sulfur General Royalty Relief for Drilling Ultra-Deep Wells on Leases Not Subject to Deep Water Royalty Relief § 203.32 What other requirements or restrictions apply to... qualified ultra-deep well is a directional well (either an original well or a sidetrack) drilled across...

  5. 30 CFR 203.43 - To which production do I apply the RSV earned from qualified deep wells or qualified phase 1... (United States)


    ... in water between 200 and 400 meters deep, you begin drilling an original deep well with a perforated... Gas Wells on Leases Not Subject to Deep Water Royalty Relief § 203.43 To which production do I apply... or qualified phase 1 ultra-deep well on a lease that is located entirely or partly in water less...

  6. 30 CFR 203.40 - Which leases are eligible for royalty relief as a result of drilling a deep well or a phase 1... (United States)


    ... drilling either: (1) Before March 26, 2003, on a lease that is located partly or entirely in water less... Leases Not Subject to Deep Water Royalty Relief § 203.40 Which leases are eligible for royalty relief as... longitude in water depths entirely less than 400 meters deep. (b) The lease has not produced gas or oil...

  7. Factors Affecting Examination Attrition: Does Academic Support Help? A Survey of ACN203S (Cost Accounting and Control) Students at Unisa (United States)

    Tladi, Lerato Sonia


    This study sought to determine the attributing and contributing factors to examination absence as well as whether the academic and social support available to students had a role to play in discouraging or reducing absence from examinations using results from a quantitative survey of ACN203S (Cost Accounting and Control) students who were admitted…

  8. Maintenance of the stemness in CD44+ HCT-15 and HCT-116 human colon cancer cells requires miR-203 suppression

    Directory of Open Access Journals (Sweden)

    Sy-Yeuan Ju


    Taken together, CD44 is a critical molecule for modulating stemness in CSCs. More importantly, we show for the first time that the downregulation of miR-203 by HA/CD44 signaling is the main reason for stemness-maintenance in colon cancer cells.

  9. Peripheral basophil reactivity, CD203c expression by Cryj1 stimulation, is useful for diagnosing seasonal allergic rhinitis by Japanese cedar pollen (United States)

    Imoto, Yoshimasa; Takabayashi, Tetsuji; Sakashita, Masafumi; Tokunaga, Takahiro; Ninomiya, Takahiro; Ito, Yumi; Narita, Norihiko; Yamada, Takechiyo; Fujieda, Shigeharu


    Measuring specific IgE can yield direct, accurate, and objective data. Nevertheless, clinical symptoms of allergy are often inconsistent with these data. Recently, the expression of CD203c, a surface marker of basophils, has been reported as capable of distinguishing allergic patients. This study compared specific IgE in serum and skin tests against antigen to assess CD203c as a biomarker correlated with allergic rhinitis (AR). We asked 3,453 subjects whether they experienced any AR related symptom. All subjects were assessed for six specific IgEs for common aeroallergens. Skin tests were also conducted for six aeroallergens. We observed the reactivity of peripheral basophil by measuring the levels of CD203c by Cryj1 stimulation using flow cytometry. Of the 3,453 participants, 1,987 (57.5%) possessed Japanese cedar pollen (JCP) specific IgE in their serum. Among those 1,987 JCP specific IgE positive participants, 552 (27.8%) had not experienced any allergic symptom during the JCP season. The levels of CD203c in the peripheral basophil by Cryj1 stimulation were significantly higher in SAR-JCP subjects than in non-SAR-JCP subjects (Cryj1 0.5 ng/ml: 2.25 ± 0.90% vs. 60.2 ± 27.4%, p < 0.01, Cryj1 50 ng/ml: 1.89 ± 0.90% vs. 68.0 ± 21.2%, p < 0.01). Our results indicate that the levels of CD203c in peripheral basophils by Cryj1 stimulation is a more objective and reliable marker that better reflects the allergic reaction by SAR-JCP in vivo than measuring specific IgE in serum or skin tests. PMID:26417444

  10. 203例房颤患者中医辨证相关因素分析%Analysis on Relative Factors of Syndrome Differentiation in 203 Patients with Auricular Fibrillation

    Institute of Scientific and Technical Information of China (English)



    目的:探求心房颤动中医分型与年龄、性别及相关疾病的关系.方法:选择203例房颤患者,按中医辨证分为瘀阻心脉、痰浊闭阻、水饮凌心、心血不足、阴虚火旺、心阳不振6型,比较不同性别、年龄以及有冠心病病史、风湿性心脏病病史、高血压病病史患者各中医证型的构成情况.结果:房颤病人以老年人居多,证型以瘀阻心脉、痰浊闭阻居多.有冠心病病史的房颤患者多为瘀阻心脉、痰浊闭阻型;有高血压性心脏病的患者辨证多为瘀阻心脉、阴虚火旺;风心病引起的房颤辨证多为水饮凌心、心血不足.结论:房颤患者的中医证型与其年龄及相关病史有关,临床辨证需考虑相关因素.%Objective: To find out the relationships between TCM pattern and aging, gender and associated diseases. Method: All 203 patients were divided into six groups according to TCM syndrome differentiation, which included: blood stasis obstructing the heart, phlegm turbidity obstruction, water intimidating the heart, heart blood deficiency, Yin deficiency and fire hyperactivity, devitalization of heart Yang. The syndromes of patients with the history of coronary heart disease, rheumatic heart disease and hypertension as well as their gender and ages were analyzed. Result: Most of the patients with auricular fibrillation are the elderly and their syndromes mostly are blood stasis obstructing the heart and phlegm turbidity obstruction; the patients with the history of coronary heart disease are also of blood stasis obstructing the heart and phlegm turbidity obstruction; the patients with the history of hypertensive heart disease are differentiated as blood stasis obstructing the heart and Yin deficiency and fire hyperactivity; auricular fibrillation induced by rheumatic heart disease is mostly differentiated as water intimidating the heart and heart blood deficiency. Conclusion: TCM syndrome of auricular fibrillation is associated to

  11. 45-day safety screen results and final report for Tank 241-C-203, Auger samples 95 AUG-020 and 95-AUG-021

    International Nuclear Information System (INIS)

    This document serves as the 45-day report deliverable for the tank C-203 auger samples collected on April 5, 1995 (samples 95-AUG-20 and 95-AUG-021). As no secondary analyses were required and no other analyses have been requested, this document also serves as the final report for C-203 auger sampling. Each sample was received, extruded, and analyzed by the 222-S Laboratories in accordance with the Tank Characterization Plan (TCP) referenced below. Included in this report are the primary safety screening results (DSC, TGA, and alpha) and density results. The worklists and raw data are included in this report. Photographs of the auger samples were taken during extrusion and, although not included in this report, are available

  12. IER 203 CED-2 Report: LLNL Final Design for BERP Ball With a Composite Reflector of Thin Polyethylene Backed by Nickel

    Energy Technology Data Exchange (ETDEWEB)

    Percher, C. M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Heinrichs, D. P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Kim, S. K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)


    This report documents the results of final design (CED-2) for IER 203, BERP Ball Composite Reflection, and focuses on critical configurations with a 4.5 kg α-phase plutonium sphere reflected by a combination of thin high density polyethylene (HDPE) backed by a thick nickel reflector. The Lawrence Livermore National Laboratory’s (LLNL’s) Nuclear Criticality Safety Division, in support of fissile material operations, calculated surprisingly reactive configurations when a fissile core was surrounded by a thin, moderating reflector backed by a thick metal reflector. These composite reflector configurations were much more reactive than either of the single reflector materials separately. The calculated findings have resulted in a stricter-than-anticipated criticality control set, impacting programmatic work. IER 203 was requested in response to these seemingly anomalous calculations to see if the composite reflection effect could be shown experimentally.

  13. Alcohol consumption and the risk of cancer in Brazil: A study involving 203,506 cancer patients. (United States)

    de Menezes, Raquel Ferreira; Bergmann, Anke; de Aguiar, Suzana Sales; Thuler, Luiz Claudio Santos


    This study aims to analyze the association between alcohol consumption and the risk of developing the most common types of cancer in the Brazilian population. It is a case-control study in which the most common types of cancer were considered as cases and non-melanoma skin cancers as controls. Data were routinely obtained by hospital-based cancer registrars. Individuals between 18 and 100 years old, diagnosed between January 1, 2000 and December 31, 2009, with information regarding alcohol consumption, were included. The odds ratio (OR) for each type of cancer was calculated, adjusting for confounding variables. The etiologic fraction (EF) was calculated in cases with statistically significant results. The study included 203,506 individuals (110,550 women and 92,956 men), with an average age of 59 years. A statistically significant association was found between alcohol consumption and increased risk of cancers of the respiratory and digestive systems, prostate, and female breast. The association between alcohol consumption and cancers of the urinary tract, male genital organs, and other neoplasias was not statistically significant. Consumption of alcoholic beverages increased the risk of developing cancer of the nasal cavity, pyriform sinus, oral cavity, oropharynx, nasopharynx, larynx, hypopharynx, lung, esophagus, stomach, liver, pancreas, breast, prostate, colon and rectum, and anus and anal canal. PMID:26298519

  14. Acute avulsion fractures of the pelvis in adolescent competitive athletes: prevalence, location and sports distribution of 203 cases collected

    International Nuclear Information System (INIS)

    Objective. To describe the prevalence, location and sports distribution of pelvic avulsion fractures in adolescent competitive athletes. Design and patients. One thousand two hundred and thirty-eight radiographs of the pelvis taken for focal traumatic symptoms in athletes with an age range of 11-35 years over a period of 22 years were reviewed. Results. One hundred and ninety-eight adolescent athletes were affected by 203 avulsion fractures of the pelvic apophyses (five cases presented multiple locations). The localisation was the ischial tuberosity (IT) in 109 cases, anterior inferior iliac spine (AIIS) in 45 cases, anterior superior iliac spine (ASIS) in 39 cases, superior corner of pubic symphysis (SCPS) in 7 cases and iliac crest (IC) in 3 cases. Soccer (74 cases) and gymnastics (55 cases) were the sports with the highest number of avulsion fractures documented. Conclusions. Apophyseal avulsion fractures of the pelvis in adolescent competitive athletes are most common in soccer and gymnastics. The lesions are usually the consequence of sudden and forceful muscle-tendon contractions during sport activities. Plain radiographs, are determinant for the diagnosis. (orig.)

  15. Acute avulsion fractures of the pelvis in adolescent competitive athletes: prevalence, location and sports distribution of 203 cases collected

    Energy Technology Data Exchange (ETDEWEB)

    Rossi, F.; Dragoni, S. [Sports Science Inst., Rome (Italy)


    Objective. To describe the prevalence, location and sports distribution of pelvic avulsion fractures in adolescent competitive athletes. Design and patients. One thousand two hundred and thirty-eight radiographs of the pelvis taken for focal traumatic symptoms in athletes with an age range of 11-35 years over a period of 22 years were reviewed. Results. One hundred and ninety-eight adolescent athletes were affected by 203 avulsion fractures of the pelvic apophyses (five cases presented multiple locations). The localisation was the ischial tuberosity (IT) in 109 cases, anterior inferior iliac spine (AIIS) in 45 cases, anterior superior iliac spine (ASIS) in 39 cases, superior corner of pubic symphysis (SCPS) in 7 cases and iliac crest (IC) in 3 cases. Soccer (74 cases) and gymnastics (55 cases) were the sports with the highest number of avulsion fractures documented. Conclusions. Apophyseal avulsion fractures of the pelvis in adolescent competitive athletes are most common in soccer and gymnastics. The lesions are usually the consequence of sudden and forceful muscle-tendon contractions during sport activities. Plain radiographs, are determinant for the diagnosis. (orig.)

  16. Primary charge separation between P* and BA: Electron-transfer pathways in native and mutant GM203L bacterial reaction centers

    International Nuclear Information System (INIS)

    Coherent components in the dynamics of decay of stimulated emission from the primary electron donor excited state P*, and of population of the product charge-separated states P+BA- and P+HA-, were studied in GM203L mutant reaction centers (RCs) of Rhodobacter (Rb.) sphaeroides by measuring oscillations in the kinetics of absorbance changes at 940nm (P* stimulated emission region), 1020nm (BA- absorption region) and 760nm (HA bleaching region). Absorbance changes were induced by excitation of P (870nm) with 18fs pulses at 90K. In the GM203L mutant, replacement of Gly M203 by Leu results in exclusion of the crystallographically defined water molecule (HOH55) located close to the oxygen of the 131-keto carbonyl group of BA and to His M202, which provides the axial ligand to the Mg of the PB bacteriochlorophyll. The results of femtosecond measurements were compared with those obtained with Rb. sphaeroides R-26 RCs containing an intact water HOH55. The main consequences of the GM203L mutation were found to be as follows: (i) a low-frequency oscillation at 32cm-1, which is characteristic of the HOH55-containing RCs, disappears from the kinetics of absorbance changes at 1020 and 760nm in the mutant RC; (ii) electron transfer from P* to BA in the wild type RC was characterized by two time constants of 1.1ps (80%) and 4.3ps (20%), but in the GM203L mutant was characterized by a single time constant of 4.3ps, demonstrating a slowing of primary charge separation. The previously postulated rotation of water HOH55 with a fundamental frequency of 32cm-1, triggered by electron transfer from P* to BA, was confirmed by observation of an isotopic shift of the 32cm-1 oscillation in the kinetics of P+BA- population in deuterated, pheophytin-modified RCs of Rb. sphaeroides R-26, by a factor of 1.6. These data are discussed in terms of the influence of water HOH55 on the energetics of the P*->P+BA- reaction, and protein dynamic events that occur on the time scale of this reaction

  17. Primary charge separation between P* and B{sub A}: Electron-transfer pathways in native and mutant GM203L bacterial reaction centers

    Energy Technology Data Exchange (ETDEWEB)

    Yakovlev, Andrey G. [Department of Photobiophysics, Belozersky Institute of Chemical and Physical Biology, Moscow State University, Moscow 119899 (Russian Federation); Jones, Michael R. [Department of Biochemistry, School of Medical Sciences, University of Bristol, University Walk, Bristol BS8 1TD (United Kingdom)], E-mail:; Potter, Jane A. [Department of Biochemistry, School of Medical Sciences, University of Bristol, University Walk, Bristol BS8 1TD (United Kingdom); Fyfe, Paul K. [Department of Biochemistry, School of Medical Sciences, University of Bristol, University Walk, Bristol BS8 1TD (United Kingdom); Vasilieva, Lyudmila G. [Institute of Basic Biological Problems, Russian Academy of Sciences, Pushchino, Moscow Region 142290 (Russian Federation); Shkuropatov, Anatoli Ya. [Institute of Basic Biological Problems, Russian Academy of Sciences, Pushchino, Moscow Region 142290 (Russian Federation); Shuvalov, Vladimir A. [Department of Photobiophysics, Belozersky Institute of Chemical and Physical Biology, Moscow State University, Moscow 119899 (Russian Federation); Institute of Basic Biological Problems, Russian Academy of Sciences, Pushchino, Moscow Region 142290 (Russian Federation)], E-mail:


    Coherent components in the dynamics of decay of stimulated emission from the primary electron donor excited state P*, and of population of the product charge-separated states P{sup +}B{sub A}{sup -} and P{sup +}H{sub A}{sup -}, were studied in GM203L mutant reaction centers (RCs) of Rhodobacter (Rb.) sphaeroides by measuring oscillations in the kinetics of absorbance changes at 940nm (P* stimulated emission region), 1020nm (B{sub A}{sup -} absorption region) and 760nm (H{sub A} bleaching region). Absorbance changes were induced by excitation of P (870nm) with 18fs pulses at 90K. In the GM203L mutant, replacement of Gly M203 by Leu results in exclusion of the crystallographically defined water molecule (HOH55) located close to the oxygen of the 13{sup 1}-keto carbonyl group of B{sub A} and to His M202, which provides the axial ligand to the Mg of the P{sub B} bacteriochlorophyll. The results of femtosecond measurements were compared with those obtained with Rb. sphaeroides R-26 RCs containing an intact water HOH55. The main consequences of the GM203L mutation were found to be as follows: (i) a low-frequency oscillation at 32cm{sup -1}, which is characteristic of the HOH55-containing RCs, disappears from the kinetics of absorbance changes at 1020 and 760nm in the mutant RC; (ii) electron transfer from P* to B{sub A} in the wild type RC was characterized by two time constants of 1.1ps (80%) and 4.3ps (20%), but in the GM203L mutant was characterized by a single time constant of 4.3ps, demonstrating a slowing of primary charge separation. The previously postulated rotation of water HOH55 with a fundamental frequency of 32cm{sup -1}, triggered by electron transfer from P* to B{sub A}, was confirmed by observation of an isotopic shift of the 32cm{sup -1} oscillation in the kinetics of P{sup +}B{sub A}{sup -} population in deuterated, pheophytin-modified RCs of Rb. sphaeroides R-26, by a factor of 1.6. These data are discussed in terms of the influence of water HOH55 on

  18. Downregulation of miRNA-30c and miR-203a is associated with hepatitis C virus core protein-induced epithelial–mesenchymal transition in normal hepatocytes and hepatocellular carcinoma cells

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Dongjing [Hepatobiliary and Enteric Surgery Research Center, Xiangya Hospital, Central South University, Changsha 410008 (China); Wu, Jilin, E-mail: [Hepatobiliary and Enteric Surgery Research Center, Xiangya Hospital, Central South University, Changsha 410008 (China); Liu, Meizhou [Department of Medical Service, Shenzhen Second People' s Hospital, Shenzhen, Guangdong 518035 (China); Yin, Hui [Staff' s Hospital, Central South University, Changsha, Hunan 410078 (China); He, Jiantai [Hepatobiliary and Enteric Surgery Research Center, Xiangya Hospital, Central South University, Changsha 410008 (China); Zhang, Bo, E-mail: [Department of Ultrasonography, Xiangya Hospital, Central South University, Changsha, Hunan 410008 (China)


    Hepatitis C virus (HCV) Core protein has been demonstrated to induce epithelial–mesenchymal transition (EMT) and is associated with cancer progression of hepatocellular carcinoma (HCC). However, how the Core protein regulates EMT is still unclear. In this study, HCV Core protein was overexpressed by an adenovirus. The protein levels of EMT markers were measured by Western blot. The xenograft animal model was established by inoculation of HepG2 cells. Results showed that ectopic expression of HCV core protein induced EMT in L02 hepatocytes and HepG2 tumor cells by upregulating vimentin, Sanl1, and Snal2 expression and downregulating E-cadherin expression. Moreover, Core protein downregulated miR-30c and miR-203a levels in L02 and HepG2 cells, but artificial expression of miR-30c and miR-203a reversed Core protein-induced EMT. Further analysis showed that ectopic expression of HCV core protein stimulated cell proliferation, inhibited apoptosis, and increased cell migration, whereas artificial expression of miR-30c and miR-203a significantly reversed the role of Core protein in these cell functions in L02 and HepG2 cells. In the HepG2 xenograft tumor models, artificial expression of miR-30c and miR-203a inhibited EMT and tumor growth. Moreover, L02 cells overexpressing Core protein can form tumors in nude mice. In HCC patients, HCV infection significantly shortened patients' survival time, and loss of miR-30c and miR-203 expression correlated with poor survival. In conclusion, HCV core protein downregulates miR-30c and miR-203a expression, which results in activation of EMT in normal hepatocytes and HCC tumor cells. The Core protein-activated-EMT is involved in the carcinogenesis and progression of HCC. Loss of miR-30c and miR-203a expression is a marker for the poor prognosis of HCC. - Highlights: • HCV core protein downregulates miR-30c and miR-203a expression. • Downregulation of miR-30c and miR-203a activates EMT. • Activated-EMT is involved in the

  19. Downregulation of miRNA-30c and miR-203a is associated with hepatitis C virus core protein-induced epithelial–mesenchymal transition in normal hepatocytes and hepatocellular carcinoma cells

    International Nuclear Information System (INIS)

    Hepatitis C virus (HCV) Core protein has been demonstrated to induce epithelial–mesenchymal transition (EMT) and is associated with cancer progression of hepatocellular carcinoma (HCC). However, how the Core protein regulates EMT is still unclear. In this study, HCV Core protein was overexpressed by an adenovirus. The protein levels of EMT markers were measured by Western blot. The xenograft animal model was established by inoculation of HepG2 cells. Results showed that ectopic expression of HCV core protein induced EMT in L02 hepatocytes and HepG2 tumor cells by upregulating vimentin, Sanl1, and Snal2 expression and downregulating E-cadherin expression. Moreover, Core protein downregulated miR-30c and miR-203a levels in L02 and HepG2 cells, but artificial expression of miR-30c and miR-203a reversed Core protein-induced EMT. Further analysis showed that ectopic expression of HCV core protein stimulated cell proliferation, inhibited apoptosis, and increased cell migration, whereas artificial expression of miR-30c and miR-203a significantly reversed the role of Core protein in these cell functions in L02 and HepG2 cells. In the HepG2 xenograft tumor models, artificial expression of miR-30c and miR-203a inhibited EMT and tumor growth. Moreover, L02 cells overexpressing Core protein can form tumors in nude mice. In HCC patients, HCV infection significantly shortened patients' survival time, and loss of miR-30c and miR-203 expression correlated with poor survival. In conclusion, HCV core protein downregulates miR-30c and miR-203a expression, which results in activation of EMT in normal hepatocytes and HCC tumor cells. The Core protein-activated-EMT is involved in the carcinogenesis and progression of HCC. Loss of miR-30c and miR-203a expression is a marker for the poor prognosis of HCC. - Highlights: • HCV core protein downregulates miR-30c and miR-203a expression. • Downregulation of miR-30c and miR-203a activates EMT. • Activated-EMT is involved in the

  20. Cloning and characterization of a new κ-carrageenase gene from marine bacterium Pseudoalteromonas sp. QY203 (United States)

    Xu, Xiaoyan; Li, Shangyong; Yang, Xuemei; Yu, Wengong; Han, Feng


    κ-carrageenan oligosaccharides exhibit various biological activities. Enzymatic degradation by κ-carrageenase is safe and controllable. Therefore, κ-carrageenases have captured more and more attentions. In this study, a κ-carrageenase encoding gene, cgkX, was cloned from Pseudoalteromonas sp. QY203 with degenerate and inverse PCR. It comprised an ORF of 1194 bp in length, encoding a protein with 397 amino acid residues. CgkX is a new member of glycoside hydrolase family 16. The deduced amino acid sequence shared a high similarity with CgkX of Pseudoalteromonas κ-carrageenase; however, the recombinant CgkX showed different biochemical characteristics. The recombinant enzyme was most active at pH 7.0 and 55°C in the presence of 300 mmol L-1 NaCl. It was stable in a broad range of acidity ranging from pH 3.0 to pH 10.0 when temperature was below 40°C. More than 80% of its activity was maintained after being incubated at pH 3.6-10.0 and 4°C for 24 h. CgkX retained more than 90% of activity after being incubated at 40°C for 1 h. EDTA and SDS (1 mmol L-1) did not inhibit its activity. CgkX hydrolyzed κ-carrageenan into disaccharide and tetrasaccharide as an endo-cleaver. All these characteristics demonstrated that CgkX is applicable to both κ-carrageenan oligosaccharide production and κ-carrageenase structure-function research.

  1. L’impercettibile confine a quasi venticinque anni dalla sentenza n. 203 del 1989 della Corte costituzionale

    Directory of Open Access Journals (Sweden)

    Angela Patrizia Tavani


    Full Text Available Il contributo, sottoposto a valutazione, è destinato alla pubblicazione negli Atti del Convegno di studio organizzato dall’ADEC sul tema “Dimensione pubblica e fattore religioso – Stato attuale e prospettive” (Bari, Aula Magna “Aldo Moro”, 17-18 settembre 2009, in corso di stampaSOMMARIO: 1. La posizione del Presidente della Repubblica Giorgio Napolitano – 2. Laicismo e anticlericalismo – 3. Un’auspicabile prospettiva circa la laicità.ABSTRACT An event that has sparked discussions on neutrality and assumed centrality in the debate on the public dimension of the religious factor is related to the non-participation of Benedict XVI at the inauguration of the academic year at the University of Rome "La Sapienza", scheduled for January 17, 2008. In its judgment no. 203/1989, the Constitutional Court stated that neutrality "does not imply indifference to religion but the state guarantee for the protection of freedom of religion, under the religious and cultural pluralism." The debate on the issue of the University "La Sapienza" has fueled confusion about the meaning of the word to make the invisible boundary between neutrality, laicism and anti-clericalism. Decisive contribution to the construction of some carefully sentinels, among which there are those who have authoritatively explained that neutrality is to be understood: "... not as an attitude of estrangement, indifference or hostility of the state and its elites, with respect to the religious consciousness of the people, under the confessional pluralism, atheism is not excluded, but the protection of the equal freedom of all faiths (... The true neutrality and the true faith are made to compete fairly in the conduct man to the full meaning of the days that are given to live".KEYWORDS: Neutrality, public dimension of the religious factor, laicism, anti-clericalism

  2. Metal transfer to plants grown on a dredged sediment: use of radioactive isotope 203Hg and titanium

    International Nuclear Information System (INIS)

    Improperly disposed of dredged sediments contaminated with metals may induce long-term leaching and an increase of metal concentrations in ground waters and vegetal cover plants. The objective of the study was to quantify the sediment-to-plant transfer of Cu, Pb, Hg and Zn with a particular focus on the pathway of Hg and to determine whether the establishment of vegetal cover modifies the metal availability. A pot experiment with rape (Brassica napus), cabbage (Brassica oleraccea) and red fescue (Festuca rubra) was set up using a sediment first spiked with the radioisotope 203Hg. Zinc concentrations (197-543 mg kg-1 DM) in leaves were higher than Cu concentration (197-543 mg kg-1 DM), Pb concentration (2.3-2.6 mg kg-1 DM) and Hg concentration (0.9-1.7 mg kg-1 DM). Leaves-to-sediment ratios decreased as follows: Zn>Cu>Hg>Pb. According to Ti measurements, metal contamination by dry deposition was less than 1%. Mercury concentration in plant leaves was higher than European and French thresholds. Foliar absorption of volatile Hg was a major pathway for Hg contamination with a root absorption of Hg higher in rape than in cabbage and red fescue. Growth of each species increased Cu solubility. Zinc solubility was increased only in the presence of rape. The highest increase of Cu solubility was observed for red fescue whereas this species largely decreased Zn solubility. Dissolved organic carbon (DOC) measurements suggested that Cu solubilisation could result from organic matter or release of natural plant exudates. Dissolved inorganic carbon (DIC) measures suggested that the high Zn solubility in the presence of rape could originate from a generation of acidity in rape rhizosphere and a subsequent dissolution of calcium carbonates. Consequently, emission of volatile Hg from contaminated dredged sediments and also the potential increase of metal solubility by a vegetal cover of grass when used in phytostabilisation must be taken into account by decision makers

  3. NMR-ON measurement s of 187WFe, 187,183,186ReNi, 186ReFe and 203PbFe

    International Nuclear Information System (INIS)

    The magnetic hyperfine splitting frequencies of 187WFe, 182Re(jπ = 2+)Ni, 186ReNi, 186ReFe, 186ReFe and 203PbFe in a zero external magnetic field have been determined by the NMR-ON method at about 7 mK as 225.56(6), 130.9(1), 98.17(4), 136.6(4), 1007.0(3) and 58.43(3) MHz, respectively. With the known g-factors of g(186Re, 1-) = 1.739(3) and g(203Pb, 5/2-) = 0.27456(20), the following hyperfine fields were deduced: BHF(186ReNi) = -103.05(35) kG; BHF(186ReFe) = -759.7(13) kG; BHF(203PbFe) = +279.18(25) kG. Taking hyperfine anomalies into account, the g-factor of 183Re was deduced as vertical strokeg(183Re, 5/2+)vertical stroke = 1.267(6). With the assumption of Knight shift factor K = 0, the g-factors of 182Re and 187W and the hyperfine field of 187WFe were determined as vertical strokeg(182Re, 2+)vertical stroke = 1.63(5), vertical strokeg(187W, 3/2-)vertical stroke = 0.414(10) and BHF(187WFe) = -714(18) kG. The large hyperfine anomaly was deduced to be 183W Δ 187W = -0.124(22). (orig.)

  4. Post-irradiation examination of the vipac fuel assemblies IFA-104 and IFA-203, irradiated in the Halden boiling water reactor

    International Nuclear Information System (INIS)

    Two seven pin assemblies, IFA-104 and IFA-203, have been irradiated in the Halding Boiling Water Reactor. The Zircaloy clad pins contained vibrationally compacted, sharp edged UO2 particles with smear densities of 84-88% theoretical density and a fuel stack length of about 1520 mm. The IFA-104 pins operated satisfactorily during approximately 240 effective full power days at an average linear heat rating of about 340 W/cm, and a peak rating of about 480 W/cm. Ingress of water via a pressure transducer into one of the IFA-203 pins necessitated the premature termination of the irradiation after approximately 30 effective full power days at an average rating of about 460 W/cm, and a peak rating of about 550 W/cm. One IFA-104 pin and two IFA-203 pins failed early. The primary cause of these failures has been sought in the oxidation reaction of the tantalum tube which protected the W/Re thermocouples with the surrounding UO2 or with moisture in the fuel at temperatures in excess of approximately 1700degC. The fuel centre temperature and the internal gas pressure measurements during the beginning of lifetime and the results of the post-irradiation chemical and microscopic analysis on fuel pin cross-sections have been correlated with corresponding data calculated on a Gapcon-Thermal computer programme written for pellet fuel pins. Fairly good agreement could be achieved between the measured data on the vipac pins and the calculated data of a pellet pin. During the corrosion of the Zircaloy-2 cladding of the IFA-104 pins which were autoclaved in 400degC steam prior to the irradiation, relatively large amounts of H2 entered the cladding from the D2O coolant side. With 0.66 mole% H2O in the D2O the calculated hydrogen uptake preference ratio was 33

  5. Identification of genes and pathways involved in the synthesis of Mead acid (20:3n-9), an indicator of essential fatty acid deficiency. (United States)

    Ichi, Ikuyo; Kono, Nozomu; Arita, Yuka; Haga, Shizuka; Arisawa, Kotoko; Yamano, Misato; Nagase, Mana; Fujiwara, Yoko; Arai, Hiroyuki


    In mammals, 5,8,11-eicosatrienoic acid (Mead acid, 20:3n-9) is synthesized from oleic acid during a state of essential fatty acid deficiency (EFAD). Mead acid is thought to be produced by the same enzymes that synthesize arachidonic acid and eicosapentaenoic acid, but the genes and the pathways involved in the conversion of oleic acid to Mead acid have not been fully elucidated. The levels of polyunsaturated fatty acids in cultured cells are generally very low compared to those in mammalian tissues. In this study, we found that cultured cells, such as NIH3T3 and Hepa1-6 cells, have significant levels of Mead acid, indicating that cells in culture are in an EFAD state under normal culture conditions. We then examined the effect of siRNA-mediated knockdown of fatty acid desaturases and elongases on the level of Mead acid, and found that knockdown of Elovl5, Fads1, or Fads2 decreased the level of Mead acid. This and the measured levels of possible intermediate products for the synthesis of Mead acid such as 18:2n-9, 20:1n-9 and 20:2n-9 in the knocked down cells indicate two pathways for the synthesis of Mead acid: pathway 1) 18:1n-9→(Fads2)→18:2n-9→(Elovl5)→20:2n-9→(Fads1)→20:3n-9 and pathway 2) 18:1n-9→(Elovl5)→20:1n-9→(Fads2)→20:2n-9→(Fads1)→20:3n-9. PMID:24184513

  6. Intraoperative frozen section evaluation of ureteral and urethral margins: studies of 203 consecutive radical cystoprostatectomy for men with bladder urothelial carcinoma. (United States)

    Zhou, Haijun; Ro, Jae Y; Truong, Luan D; Ayala, Alberto G; Shen, Steven S


    Intraoperative frozen section (FS) evaluation of ureteral and urethral margins is frequently requested during radical cystoprostatectomy in patients with bladder urothelial carcinoma. However, it is still controversial whether intraoperative FSs of ureteral and urethral margins are necessary in all patients with cystoprostatectomy or a risk-based assessment with limited to the high risk patients is the best approach. A total of 203 radical cystoprostatectomy specimens with FS evaluation on margin status from men treated for bladder urothelial carcinoma from 2003 to 2010 in our institution were reviewed. Clinicopathologic features studied include: patients' age, pathologic tumor stage, presence of carcinoma in- situ (CIS), and intraoperative FS diagnosis. All 203 patients had intraoperative FS evaluation of ureter, and of these, 37 patients had additional urethra FS evaluation. Of the 203 ureteral FS cases, 17 (8.4%) had positive margin for CIS (16 cases) or CIS with invasive urothelial carcinoma (1 case). All 17 patients with positive ureteral margin on FS had concomitant CIS in the bladder (15.5%; 17 of 110 patients). In contrast, none of the patients without concomitant CIS (n=93) had positive ureteral margins on FS. Among 37 patients who also had FS evaluation on urethral resection margin, 3 patients (8.1%) had positive margins for CIS and all three of them had concomitant CIS in the bladder. Positive ureteral/urethral margin was not associated with patients' age or tumor stage, but was significantly associated with the presence of CIS in the bladder (p<0.001). Our study demonstrates that presence of concomitant CIS in bladder cancer was often associated with positive ureteral or urethral margin for CIS or invasive carcinoma; therefore, intraoperative FS evaluation may be indicated to these patients with concomitant bladder CIS. In contrast, in patients with no associated concomitant CIS in the bladder, FS of ureteral/urethral margins may not be necessary unless

  7. Powder metallurgy influences on the magnetic properties of Gd5.09Ge2.03Si1.88 alloy

    International Nuclear Information System (INIS)

    Magnetic refrigeration is an innovative technology owing to its high-efficiency, low-energy consumption, and environmental friendliness. However, the manufacturing process of the magnetocaloric materials is an obstacle to the effective application of those materials on refrigeration systems. In this work, we present a magnetic characterization of the Gd5.09Ge2.03Si1.88.alloy, analyzing the as-cast bulk and the sintered tablets after some heat treatments. The study of powder metallurgy parameters such as grain size, compacting pressure and sintering process has showed results comparable to the as-cast alloy, which presents ΔST=-18 /kg K

  8. Investigation of the angular distribution modulated by time-dependent magnetic fields of γ-radiation from optically pumped radioactive 203Hg nuclei

    International Nuclear Information System (INIS)

    The present work investigates the anisotropy of the γ-radiation of optically orientated radioactive 203Hg atomic nuclei. Through the simultaneous action of direct and alternating magnetic fields on the optically pumped spin system, a time-dependent (dynamic) orientation structure is created which is expressed by a time-modulated, anisotropic γ-radiation. By measuring the anisotropy and the time modulations of the intensity of the γ-radiation using various outlined measuring methods, the dynamic orientation structure is examined in detail. (orig./LH)

  9. 201-Tl production studies by 203-Tl(p,3n)201-Pb and 202-Hg(p,2n) nuclear reactions

    Energy Technology Data Exchange (ETDEWEB)

    Birattari, C.; Bonardi, M.; Salomone, A. (Milan Univ. (Italy). Ist. di Fisica)

    Thallium 201 has been produced in the Milan university AVF cyclotron by a /sup 203/Tl(p,3n)/sup 201/Pb and /sup 202/Hg(p,2n) nuclear reactions. /sup 201/Tl//sup 201/Pb were separated radiochemically by the preparation of thallium as thallous iodide after complexation of the lead with EDTA. /sup 202/Hg and /sup 201/Tl were separated by washing the target and holder, to which the radiothallium adheres with 3HCl and adding NaOH. Quality control is by radiochromatography.

  10. Metal transfer to plants grown on a dredged sediment: use of radioactive isotope {sup 203}Hg and titanium

    Energy Technology Data Exchange (ETDEWEB)

    Caille, Nathalie [ENSAIA-INRA/INPL, 2 avenue de la Foret de Haye, F-54505 Vandoeuvre-les-Nancy (France); CNRSSP, 930 boulevard Lahure, F-59505 Douai (France); Laboratoire des Interactions Microorganismes-Mineraux-Matiere organique dans les sols, CNRS, 17 rue Notre-Dame des Pauvres, F-54505 Vandoeuvre-les-Nancy (France); Vauleon, Clotilde [CNRSSP, 930 boulevard Lahure, F-59505 Douai (France); Leyval, Corinne [Laboratoire des Interactions Microorganismes-Mineraux-Matiere organique dans les sols, CNRS, 17 rue Notre-Dame des Pauvres, F-54505 Vandoeuvre-les-Nancy (France); Morel, Jean-Louis [ENSAIA-INRA/INPL, 2 avenue de la Foret de Haye, F-54505 Vandoeuvre-les-Nancy (France)]. E-mail:


    Improperly disposed of dredged sediments contaminated with metals may induce long-term leaching and an increase of metal concentrations in ground waters and vegetal cover plants. The objective of the study was to quantify the sediment-to-plant transfer of Cu, Pb, Hg and Zn with a particular focus on the pathway of Hg and to determine whether the establishment of vegetal cover modifies the metal availability. A pot experiment with rape (Brassica napus), cabbage (Brassica oleraccea) and red fescue (Festuca rubra) was set up using a sediment first spiked with the radioisotope {sup 203}Hg. Zinc concentrations (197-543 mg kg{sup -1} DM) in leaves were higher than Cu concentration (197-543 mg kg{sup -1} DM), Pb concentration (2.3-2.6 mg kg{sup -1} DM) and Hg concentration (0.9-1.7 mg kg{sup -1} DM). Leaves-to-sediment ratios decreased as follows: Zn>Cu>Hg>Pb. According to Ti measurements, metal contamination by dry deposition was less than 1%. Mercury concentration in plant leaves was higher than European and French thresholds. Foliar absorption of volatile Hg was a major pathway for Hg contamination with a root absorption of Hg higher in rape than in cabbage and red fescue. Growth of each species increased Cu solubility. Zinc solubility was increased only in the presence of rape. The highest increase of Cu solubility was observed for red fescue whereas this species largely decreased Zn solubility. Dissolved organic carbon (DOC) measurements suggested that Cu solubilisation could result from organic matter or release of natural plant exudates. Dissolved inorganic carbon (DIC) measures suggested that the high Zn solubility in the presence of rape could originate from a generation of acidity in rape rhizosphere and a subsequent dissolution of calcium carbonates. Consequently, emission of volatile Hg from contaminated dredged sediments and also the potential increase of metal solubility by a vegetal cover of grass when used in phytostabilisation must be taken into account

  11. Cosmetology 103, 203, 303. (United States)

    Manitoba Dept. of Education, Winnipeg.

    As part of the high school vocational industrial program in Manitoba, this course has been designed to provide students with the foundation for a career in cosmetology. The program introduces and provides opportunities for student skill development in the techniques of hairdressing, hair cutting, facial preparation, and skin care. The program,…

  12. Modulation of miR-203 and its regulators as a function of time during the development of 7, 12 dimethylbenz [a] anthracene induced mouse skin tumors in presence or absence of the antitumor agents

    International Nuclear Information System (INIS)

    We investigated the chemopreventive effects of naturally occurring compounds like butyric acid (BA), nicotinamide (NA) and calcium glucarate (CAG) individually or in combination in 7, 12-dimethylbenz [a] anthracene (DMBA) treated mouse skin at 4 and 16 weeks, the time before and after the tumor development. DMBA application did not show any skin tumors at 4 weeks but well defined tumors appeared at 16 weeks. BA, NA or CAG prevented the tumor development significantly but the protection was highly enhanced when all these compounds were given together. In order to see the molecular changes progressing with tumors, we showed the downregulation of tumor suppressor miR-203 at 16 weeks and upregulation of histone deacetylases (HDAC), DNA methyltransferase, promoter methylation of miR-203 at 4 or 16 weeks. Regulators of micro RNA biogenesis such as DICER1 and Ago2 were also deregulated by DMBA. Proto-oncogene c-myc and BMI1 were upregulated and tumor suppressor gene p16 was downregulated by DMBA as a function of time. Effects of BA, NA or CAG were more pronounced after 16 weeks as compared to 4 weeks in preventing the tumor development and altered gene expression. Concomitant administration of BA, NA and CAG tried to prevent these alterations more effectively than that of individual compound possibly by regulating miR-203 status through epigenetic or biogenetic modulations before and after the tumor development. Study provides a rationale for chemoprevention by combination of different compounds targeting miR-203. - Highlights: • DMBA modulates miR-203 and its regulator before and after the onset of tumors. • Suppression of miR-203 and p16 could be the result of gene promoter methylation. • BA, NA or CAG prevents the effects of DMBA. • Combination of BA, NA or CAG is more effective in preventing the DMBA modulations

  13. Modulation of miR-203 and its regulators as a function of time during the development of 7, 12 dimethylbenz [a] anthracene induced mouse skin tumors in presence or absence of the antitumor agents

    Energy Technology Data Exchange (ETDEWEB)

    Tiwari, Prakash; Gupta, Krishna P., E-mail:


    We investigated the chemopreventive effects of naturally occurring compounds like butyric acid (BA), nicotinamide (NA) and calcium glucarate (CAG) individually or in combination in 7, 12-dimethylbenz [a] anthracene (DMBA) treated mouse skin at 4 and 16 weeks, the time before and after the tumor development. DMBA application did not show any skin tumors at 4 weeks but well defined tumors appeared at 16 weeks. BA, NA or CAG prevented the tumor development significantly but the protection was highly enhanced when all these compounds were given together. In order to see the molecular changes progressing with tumors, we showed the downregulation of tumor suppressor miR-203 at 16 weeks and upregulation of histone deacetylases (HDAC), DNA methyltransferase, promoter methylation of miR-203 at 4 or 16 weeks. Regulators of micro RNA biogenesis such as DICER1 and Ago2 were also deregulated by DMBA. Proto-oncogene c-myc and BMI1 were upregulated and tumor suppressor gene p16 was downregulated by DMBA as a function of time. Effects of BA, NA or CAG were more pronounced after 16 weeks as compared to 4 weeks in preventing the tumor development and altered gene expression. Concomitant administration of BA, NA and CAG tried to prevent these alterations more effectively than that of individual compound possibly by regulating miR-203 status through epigenetic or biogenetic modulations before and after the tumor development. Study provides a rationale for chemoprevention by combination of different compounds targeting miR-203. - Highlights: • DMBA modulates miR-203 and its regulator before and after the onset of tumors. • Suppression of miR-203 and p16 could be the result of gene promoter methylation. • BA, NA or CAG prevents the effects of DMBA. • Combination of BA, NA or CAG is more effective in preventing the DMBA modulations.

  14. Acetylcholinesterase Reactivators (HI-6, Obidoxime, Trimedoxime, K027, K075, K127, K203, K282: Structural Evaluation of Human Serum Albumin Binding and Absorption Kinetics

    Directory of Open Access Journals (Sweden)

    Filip Zemek


    Full Text Available Acetylcholinesterase (AChE reactivators (oximes are compounds predominantly targeting the active site of the enzyme. Toxic effects of organophosphates nerve agents (OPNAs are primarily related to their covalent binding to AChE and butyrylcholinesterase (BChE, critical detoxification enzymes in the blood and in the central nervous system (CNS. After exposure to OPNAs, accumulation of acetylcholine (ACh overstimulates receptors and blocks neuromuscular junction transmission resulting in CNS toxicity. Current efforts at treatments for OPNA exposure are focused on non-quaternary reactivators, monoisonitrosoacetone oximes (MINA, and diacylmonoxime reactivators (DAM. However, so far only quaternary oximes have been approved for use in cases of OPNA intoxication. Five acetylcholinesterase reactivator candidates (K027, K075, K127, K203, K282 are presented here, together with pharmacokinetic data (plasma concentration, human serum albumin binding potency. Pharmacokinetic curves based on intramuscular application of the tested compounds are given, with binding information and an evaluation of structural relationships. Human Serum Albumin (HSA binding studies have not yet been performed on any acetylcholinesterase reactivators, and correlations between structure, concentration curves and binding are vital for further development. HSA bindings of the tested compounds were 1% (HI-6, 7% (obidoxime, 6% (trimedoxime, and 5%, 10%, 4%, 15%, and 12% for K027, K075, K127, K203, and K282, respectively.

  15. Modulation of miR-203 and its regulators as a function of time during the development of 7, 12 dimethylbenz [a] anthracene induced mouse skin tumors in presence or absence of the antitumor agents. (United States)

    Tiwari, Prakash; Gupta, Krishna P


    We investigated the chemopreventive effects of naturally occurring compounds like butyric acid (BA), nicotinamide (NA) and calcium glucarate (CAG) individually or in combination in 7, 12-dimethylbenz [a] anthracene (DMBA) treated mouse skin at 4 and 16 weeks, the time before and after the tumor development. DMBA application did not show any skin tumors at 4 weeks but well defined tumors appeared at 16 weeks. BA, NA or CAG prevented the tumor development significantly but the protection was highly enhanced when all these compounds were given together. In order to see the molecular changes progressing with tumors, we showed the downregulation of tumor suppressor miR-203 at 16 weeks and upregulation of histone deacetylases (HDAC), DNA methyltransferase, promoter methylation of miR-203 at 4 or 16 weeks. Regulators of micro RNA biogenesis such as DICER1 and Ago2 were also deregulated by DMBA. Proto-oncogene c-myc and BMI1 were upregulated and tumor suppressor gene p16 was downregulated by DMBA as a function of time. Effects of BA, NA or CAG were more pronounced after 16 weeks as compared to 4 weeks in preventing the tumor development and altered gene expression. Concomitant administration of BA, NA and CAG tried to prevent these alterations more effectively than that of individual compound possibly by regulating miR-203 status through epigenetic or biogenetic modulations before and after the tumor development. Study provides a rationale for chemoprevention by combination of different compounds targeting miR-203. PMID:24792773

  16. Konica Minolta bizhub C203 the Brand-new Intelligent Color Digital MFP Goes on the Market Brilliantly%柯尼卡美能达全新智能多功能彩色数码复合机bizhub C203精彩上市

    Institute of Scientific and Technical Information of China (English)



    @@ 2008年9月17日,全球彩色商务领导厂商柯尼卡美能达办公系统(中国)有限公司推出功能与设计兼备,迎合高效商务工作组和大中型企业印务需求的彩色多功能数码复合机bizhub C203,其黑白、彩色输出同速,均为20页每分钟.

  17. Folding model analysis of 58Ni + 64Ni elastic and inelastic scattering at Elab=203.8 and 219.2 MeV

    International Nuclear Information System (INIS)

    Angular distributions of elastic scattering of 58Ni by 64Ni and inelastic scattering leading to the first 2+ state in 58Ni or in 64Ni were measured at Elab=203.8 and 219.2 MeV. The data were analyzed in the frame of the folding model. A renormalization N of the folding potential consistently lower than unity (N∼0.65) is needed to reproduce the elastic scattering data. Coupled-channel calculations including the main inelastic channels explain partly this discrepancy. They reproduce the elastic and inelastic scattering data with a renormalization of N∼0.8 at both energies. Interference between Coulomb and nuclear excitation is shown to play an important role in the repulsive character of the polarization potential. (author) 38 refs.; 6 figs.; 1 tab

  18. BIOMASS, SPECIES IDENTIFICATION, SPECIES IDENTIFICATION - LIFE STAGE, TAXONOMIC CODE and species abundance tows data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX201, HX203 and others as part of the NEP project from 1997-10-14 to 2004-10-08 (NODC Accession 0113956) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113956 includes tows and biological data collected aboard the ALPHA HELIX and WECOMA during cruises HX201, HX203, HX205, HX208, HX211, HX215, HX217,...

  19. NITRATE + NITRITE CONTENT (CONCENTRATION), PHOSPHATE, NITRITE, SILICATE and other profile and discrete sample data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX203, HX205 and others as part of the NEP project from 1998-03-08 to 2004-07-05 (NODC Accession 0115260) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115260 includes profile, discrete sample and chemical data collected aboard the ALPHA HELIX and WECOMA during cruises HX203, HX205, HX208, HX211,...

  20. BIOMASS, SPECIES IDENTIFICATION, TAXONOMIC CODE, SPECIES IDENTIFICATION - LIFE STAGE and species abundance tows data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX201, HX203 and others as part of the NEP project from 1997-10-10 to 2004-10-07 (NODC Accession 0113896) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113896 includes tows and biological data collected aboard the ALPHA HELIX and WECOMA during cruises HX201, HX203, HX205, HX208, HX211, HX215, HX217,...

  1. SALINITY, WATER TEMPERATURE, FLUORESCENCE, PHOTOSYNTHETIC ACTIVE RADIATION (PAR) and other profile data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX201, HX203 and others as part of the NEP project from 1997-10-10 to 2004-12-09 (NODC Accession 0113922) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113922 includes profile, biological and physical data collected aboard the ALPHA HELIX and WECOMA during cruises HX201, HX203, HX205, HX208, HX211,...

  2. Factors Associated with Advanced Inferior Vena Cava Filter Removals: A Single-Center Retrospective Study of 203 Patients Over 7 Years

    International Nuclear Information System (INIS)

    PurposeTo identify factors associated with advanced inferior vena cava filter (IVCF) retrieval to raise awareness on technical considerations, retrieval efficiency, and patient safety.Materials and MethodsA single-center retrospective review was performed of 203 consecutive retrievable IVC filters placed between 2007 and 2014. Attempted retrievals were classified as advanced if the routine “snare and sheath” technique was initially unsuccessful after multiple attempts, or an alternate endovascular maneuver or access site was utilized. Patient and filter characteristics were recorded.Results203 attempted retrievals were reviewed (48.7 % male, 51.2 % female, mean age 52.7 years, mean dwell time 109 days). Advanced retrievals were observed in 20 patients (9.8 %) (15 females, 5 males). Fluoroscopy time (p ≤ 0.01, 34.3 ± 21.1 and 5.3 ± 4.5 min for advanced retrievals and routine retrievals respectively, same below), gender (p = 0.031), and retrieval tilt angle (p ≤ 0.01, 5.7 ± 5.10° vs. 11.9 ± 11.03°) were associated with advanced retrievals. Females were 3.16 times more likely to have an advanced retrieval performed than males with a significantly higher tilt angle in those with advanced retrieval. History of cancer (p = 0.502), dwell time (p = 0.916), retrieval caval diameter (p = 0.053), placement caval diameter (p = 0.365), filter type (p = 0.710), strut perforation (p = 0.506), placement tilt angle (p = 0.311), and age (p = 0.558) were not found significantly associated with advanced retrievals.ConclusionsWomen are at increased risk for advanced filter retrieval secondary to a significant change in filter tilt over time compared to men, independent of filter type or competing demographic or filter risks, likely placing them at increased risk for higher procedural fluoroscopy times

  3. Factors Associated with Advanced Inferior Vena Cava Filter Removals: A Single-Center Retrospective Study of 203 Patients Over 7 Years

    Energy Technology Data Exchange (ETDEWEB)

    Dowell, Joshua D., E-mail:; Wagner, Daniel, E-mail:; Elliott, Eric, E-mail: [The Ohio State University Wexner Medical Center, Department of Radiology, Division of Interventional Radiology (United States); Yildiz, Vedat O., E-mail:; Pan, Xueliang, E-mail: [The Ohio State University Wexner Medical Center, Center for Biostatistics (United States)


    PurposeTo identify factors associated with advanced inferior vena cava filter (IVCF) retrieval to raise awareness on technical considerations, retrieval efficiency, and patient safety.Materials and MethodsA single-center retrospective review was performed of 203 consecutive retrievable IVC filters placed between 2007 and 2014. Attempted retrievals were classified as advanced if the routine “snare and sheath” technique was initially unsuccessful after multiple attempts, or an alternate endovascular maneuver or access site was utilized. Patient and filter characteristics were recorded.Results203 attempted retrievals were reviewed (48.7 % male, 51.2 % female, mean age 52.7 years, mean dwell time 109 days). Advanced retrievals were observed in 20 patients (9.8 %) (15 females, 5 males). Fluoroscopy time (p ≤ 0.01, 34.3 ± 21.1 and 5.3 ± 4.5 min for advanced retrievals and routine retrievals respectively, same below), gender (p = 0.031), and retrieval tilt angle (p ≤ 0.01, 5.7 ± 5.10° vs. 11.9 ± 11.03°) were associated with advanced retrievals. Females were 3.16 times more likely to have an advanced retrieval performed than males with a significantly higher tilt angle in those with advanced retrieval. History of cancer (p = 0.502), dwell time (p = 0.916), retrieval caval diameter (p = 0.053), placement caval diameter (p = 0.365), filter type (p = 0.710), strut perforation (p = 0.506), placement tilt angle (p = 0.311), and age (p = 0.558) were not found significantly associated with advanced retrievals.ConclusionsWomen are at increased risk for advanced filter retrieval secondary to a significant change in filter tilt over time compared to men, independent of filter type or competing demographic or filter risks, likely placing them at increased risk for higher procedural fluoroscopy times.

  4. Clinical utility of multiplex ligation-dependent probe amplification technique in identification of aetiology of unexplained mental retardation: A study in 203 Indian patients

    Directory of Open Access Journals (Sweden)

    Vijay R Boggula


    Full Text Available Background & objectives: Developmental delay (DD/mental retardation also described as intellectual disability (ID, is seen in 1-3 per cent of general population. Diagnosis continues to be a challenge at clinical level. With the advancement of new molecular cytogenetic techniques such as cytogenetic microarray (CMA, multiplex ligation-dependent probe amplification (MLPA techniques, many microdeletion/microduplication syndromes with DD/ID are now delineated. MLPA technique can probe 40-50 genomic regions in a single reaction and is being used for evaluation of cases with DD/ID. In this study we evaluated the clinical utility of MLPA techniques with different probe sets to identify the aetiology of unexplained mental retardation in patients with ID/DD. Methods: A total of 203 randomly selected DD/ID cases with/without malformations were studied. MLPA probe sets for subtelomeric regions (P070/P036 and common microdeletions/microduplications (P245-A2 and X-chromosome (P106 were used. Positive cases with MLPA technique were confirmed using either fluorescence in situ hybridization (FISH or follow up confirmatory MLPA probe sets. Results: The overall detection rate was found to be 9.3 per cent (19 out of 203. The detection rates were 6.9 and 7.4 per cent for common microdeletion/microduplication and subtelomeric probe sets, respectively. No abnormality was detected with probe set for X-linked ID. The subtelomeric abnormalities detected included deletions of 1p36.33, 4p, 5p, 9p, 9q, 13q telomeric regions and duplication of 9pter. The deletions/duplications detected in non telomeric regions include regions for Prader Willi/Angelman regions, Williams syndrome, Smith Magenis syndrome and Velocardiofacial syndrome. Interpretation & conclusions: Our results show that the use of P245-A2 and P070/P036-E1 probes gives good diagnostic yield. Though MLPA cannot probe the whole genome like cytogenetic microarray, due to its ease and relative low cost it is an

  5. The assessment and control of the implementation of Articles 3 and 7 of EC Directive 80/779/EEC (sulphur dioxide and suspended particulates) and EC Directive 85/203/EEC (nitrogen dioxide) in Luxembourg


    Sluyter RJCF (ed); LLO


    De implementatie in de Luxemburgse wetgeving van de EG richtlijnen 80/799 (zwaveldioxide en zwevende deeltjes) en 85/203 (stikstofdioxide) is beschreven in dit rapport. De nadruk hierbij is gelegd op de monitoring van zwaveldioxide, zwevende deeltjes en stikstofdioxide in overeenstemming met de richtlijnen en de controle van de luchtkwaliteit. Informatie over emissies en concentraties van voornoemde stoffen wordt gegeven. Het beleid van Luxemburg inzake de vermindering van luchtverontreinigin...

  6. TSP-203超前地质预报在隧道斜井涌水探测中的应用%On the Application of the TSP-203 Advanced Geological Forecasting to the Detection of Water Inflow in Inclined Shafts for a Tunnel

    Institute of Scientific and Technical Information of China (English)




  7. Ablation of (GeS2)0.3(Sb2S3)0.7 glass with an ultra-violet nano-second laser

    International Nuclear Information System (INIS)

    Highlights: • The interaction of (GeS2)0.3(Sb2S3)0.7 bulk glass and film with UV nanosecond laser. • Ablation process, topography of crater and structure of the material were studied. • Ablation threshold fluencies changed with the spot diameter and number of pulses. • The photo-thermal expansion of the material occurred for low laser fluency. • Laser direct writing process applicable for fabrication of passive optical elements. - Abstract: The results of an experimental study of the laser ablation of bulk and thin films of a GeSbS chalcogenide glass using UV nanosecond pulses are reported. The response of the samples to illumination conditions was studied through the use of atomic force spectroscopy, digital holographic microscopy, Raman scattering and scanning electron microscopy. The multi-pulse ablation thresholds were determined for both the bulk and thin film samples for varying number of pulses and illuminated spot diameter. The possible application of direct laser writing into the bulk and thin films of this material is presented

  8. Estrategias de enseñanza para el curso EIF-203 Estructuras discretas para informática a través del uso de las redes sociales Facebook y Twitter

    Directory of Open Access Journals (Sweden)

    Enrique Vílchez Quesada


    Full Text Available Recibido 29 de octubre de 2013 • Corregido 2 de marzo de 2014 • Aceptado 2 de abril de 2014. Este artículo corresponde a un trabajo científico derivado del proyecto de investigación en docencia adscrito a la Escuela de Informática de la Universidad Nacional de Costa Rica (UNA, titulado: Facebook como herramienta de enseñanza y aprendizaje para el curso EIF-203 Estructuras discretas para informática a través del uso de cuadernos interactivos. El objetivo general del proyecto consistió en analizar técnica y pedagógicamente la red social Facebook como un entorno de enseñanza y aprendizaje. En este documento se presenta una serie de estrategias de enseñanza creadas para complementar la docencia en el contexto del curso EIF-203, utilizando como plataforma educativa las redes sociales Facebook y Twitter. Las estrategias compartidas constituyen una intensa búsqueda de nuevas metodologías para mejorar los procesos de enseñanza e, idealmente, los procesos de aprendizaje en la materia EIF-203, integrada dentro del plan de estudios de la carrera Ingeniería en Sistemas de Información de la UNA. Estas fueron implementadas en un grupo de 31 estudiantes de la Sede Interuniversitaria de Alajuela, durante el I semestre 2013. Lo anterior permitió evaluar las estrategias de enseñanza desarrolladas utilizando una metodología de carácter cuantitativo. El instrumento empleado (un cuestionario se validó mediante una prueba de fiabilidad “Alfa de Cronbach” recurriendo a una muestra de 65 participantes. Los resultados obtenidos forman parte del análisis expuesto en el presente trabajo.

  9. Evaluation of a Wet Chemistry Method for Isolation of Cyclotron Produced [211At]Astatine

    Directory of Open Access Journals (Sweden)

    Shigeki Watanabe


    Full Text Available A “wet chemistry” approach for isolation of 211At from an irradiated bismuth target is described. The approach involves five steps: (1 dissolution of bismuth target in conc. HNO3; (2 removal of the HNO3 by distillation; (3 dissolution of residue in 8 M HCl; (4 extraction of 211At from 8 M HCl into DIPE; and (5 extraction of 211At from DIPE into NaOH. Results from 55 “optimized” 211At isolation runs gave recovery yields of approximately 78% after decay and attenuation corrections. An attenuation-corrected average of 26 ± 3 mCi in the target provided isolated (actual yields of 16 ± 3 mCi of 211At. A sixth step, used for purification of 211At from trace metals, was evaluated in seven runs. In those runs, isolated 211At was distilled under reductive conditions to provide an average 71 ± 8% recovery. RadioHPLC analyses of the isolated 211At solutions, both initial and after distillation, were obtained to examine the 211At species present. The primary species of 211At present was astatide, but astatate and unidentified species were also observed. Studies to determine the effect of bismuth attenuation on 211At were conducted to estimate an attenuation factor (~1.33 for adjustment of 211At readings in the bismuth target.

  10. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott


    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  11. Astatination of nanoparticles containing silver as possible carriers of 211At

    Czech Academy of Sciences Publication Activity Database

    Lebeda, Ondřej; Kučka, Jan; Hrubý, Martin; Koňák, Čestmír; Kozempel, Ján


    Roč. 64, - (2006), s. 201-206. ISSN 0969-8043 R&D Projects: GA AV ČR KJB4048302; GA AV ČR KJB4050408 Institutional research plan: CEZ:AV0Z1048901 Keywords : nanoparticles * 211AT * Atalpha particle therapy Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.924, year: 2006

  12. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)


    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  13. Estrategias de enseñanza para el curso EIF-203 Estructuras discretas para informática a través del uso de las redes sociales Facebook y Twitter


    Enrique Vílchez Quesada


    Recibido 29 de octubre de 2013 • Corregido 2 de marzo de 2014 • Aceptado 2 de abril de 2014. Este artículo corresponde a un trabajo científico derivado del proyecto de investigación en docencia adscrito a la Escuela de Informática de la Universidad Nacional de Costa Rica (UNA), titulado: Facebook como herramienta de enseñanza y aprendizaje para el curso EIF-203 Estructuras discretas para informática a través del uso de cuadernos interactivos. El objetivo general del proyecto consistió en ana...

  14. Study and construction of a {beta}-spectrometer of uniform axial magnetic field fitted with a {beta}-{gamma} coincidence selector. Study of the {beta} spectra of {sup 32}P, {sup 203}Hg, {sup 198}Au. Measurement of the conversion coefficients of {sup 203}Ti and of {sup 198}Hg; Etude et realisation d'un spectrometre-{beta} a champ magnetique axial uniforme, muni d'un selecteur de coincidence {beta}-{gamma}. Etude des spectres {beta} du {sup 32}p, {sup 203}Hg, {sup 198}Au. Mesure des coefficients de conversion du {sup 203}Ti et du {sup 198}Hg

    Energy Technology Data Exchange (ETDEWEB)

    Parsignault, D. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires


    In the first part is given the principle of the beta spectrometer with uniform axial field using systematically the idea of caustics. The apparatus is described and its properties compared to those deduced from trajectory calculations. The {beta}-ray and {gamma}-ray detectors and the device for selecting coincidences with a 2 {tau} resolution of 5 nanoseconds are also presented. In the second part, the spectrometer is used for studying reference elements and the most accurate results are confirmed. The {beta} spectrum of {sup 60}Co has a statistical form with an accuracy of 1 per cent; the maximum energy E{sub 0} is 316.5 {+-} 1.5 keV. That of the 7/2 + {yields} 11/2 transition for {sup 137}Cs has a unique form, once forbidden. E{sub 0}= 522 {+-} 3 keV. Conversion coefficients {alpha}{sub k} = 96 {+-} 1 X 10{sup -3} {alpha}L + M + N = 20.9 {+-} 0.5 X 10{sup -3}. The two {beta} spectra of {sup 59}Fe, separated by coincidence with the gamma, have the statistical form E{sub 0} = 462 {+-} 2 keV (55.1 + 0,3 per cent) and E{sub 1} = 275 {+-} 4 keV (44.9 {+-} 0.3 per cent). It is then verified whether the l selection rule is apparent in the shape of the phosphorus 32 beta spectrum. It is found in fact that it is not of statistical shape and its shape coefficient is determined. For a theoretical interpretation it is necessary to have better approximations than those generally used and this interpretation will not be unique. This work has also made it possible to show that the source contains a small proportion of {sup 33}P. The study of the {sup 203}Hg {beta} spectrum followed by the 279 keV gamma spectrum is designed to determine the conversion coefficients. The interior spectrum of gold 198 is not of statistical shape either. The form coefficient is determined together with the conversion coefficients which are in slight disagreement with those calculated by Rose or Sliv. An interpretation of the spectrum is put forward which proposes an imperfect compensation for the

  15. Millimeter- and submillimeter-wave surveys of Orion A emission lines in the ranges 200.7-202.3, 203.7-205.3, and 330-360 GHz

    International Nuclear Information System (INIS)

    A continuous spectral line survey of the Orion A position from 330.5 to 360.1 GHz was carried out. This survey covers nearly the entire 870 micron atmospheric window accessible from ground-based observations. Approximately 160 distinct spectral features composed of about 180 lines were detected, 29 of which could not be readily identified. In addition, Orion A from 200.7 to 202.3 GHz and from 203.7 to 205.3 GHz and 42 distinct new spectral lines were detected, including four that are unidentified at present. These data sets are the first thorough survey results in these spectral regions. The new interstellar lines in the survey bands are tabulated and displayed graphically. Moreover, the data are being made available to the Astronomical Data Center at the Goddard Space Flight Center for distribution by request to the astronomical community. 14 refs

  16. Study and construction of a β-spectrometer of uniform axial magnetic field fitted with a β-γ coincidence selector. Study of the β spectra of 32P, 203Hg, 198Au. Measurement of the conversion coefficients of 203Ti and of 198Hg

    International Nuclear Information System (INIS)

    In the first part is given the principle of the beta spectrometer with uniform axial field using systematically the idea of caustics. The apparatus is described and its properties compared to those deduced from trajectory calculations. The β-ray and γ-ray detectors and the device for selecting coincidences with a 2 τ resolution of 5 nanoseconds are also presented. In the second part, the spectrometer is used for studying reference elements and the most accurate results are confirmed. The β spectrum of 60Co has a statistical form with an accuracy of 1 per cent; the maximum energy E0 is 316.5 ± 1.5 keV. That of the 7/2 + → 11/2 transition for 137Cs has a unique form, once forbidden. E0= 522 ± 3 keV. Conversion coefficients αk = 96 ± 1 X 10-3 αL + M + N = 20.9 ± 0.5 X 10-3. The two β spectra of 59Fe, separated by coincidence with the gamma, have the statistical form E0 = 462 ± 2 keV (55.1 + 0,3 per cent) and E1 = 275 ± 4 keV (44.9 ± 0.3 per cent). It is then verified whether the l selection rule is apparent in the shape of the phosphorus 32 beta spectrum. It is found in fact that it is not of statistical shape and its shape coefficient is determined. For a theoretical interpretation it is necessary to have better approximations than those generally used and this interpretation will not be unique. This work has also made it possible to show that the source contains a small proportion of 33P. The study of the 203Hg β spectrum followed by the 279 keV gamma spectrum is designed to determine the conversion coefficients. The interior spectrum of gold 198 is not of statistical shape either. The form coefficient is determined together with the conversion coefficients which are in slight disagreement with those calculated by Rose or Sliv. An interpretation of the spectrum is put forward which proposes an imperfect compensation for the various elements of the matrix. (author)

  17. Mead acid (20:3n-9) and n-3 polyunsaturated fatty acids are not associated with risk of posterior longitudinal ligament ossification: results of a case-control study. (United States)

    Hamazaki, Kei; Kawaguchi, Yoshiharu; Nakano, Masato; Yasuda, Taketoshi; Seki, Shoji; Hori, Takeshi; Hamazaki, Tomohito; Kimura, Tomoatsu


    Ossification of the posterior longitudinal ligament (OPLL) involves the replacement of ligamentous tissue with ectopic bone. Although genetics and heritability appear to be involved in the development of OPLL, its pathogenesis remains to be elucidated. Given previous findings that 5,8,11-eicosatrienoic acid [20:3n-9, Mead acid (MA)] has depressive effects on osteoblastic activity and anti-angiogenic effects, and that n-3 polyunsaturated fatty acids (PUFAs) have a preventive effect on heterotopic ossification, we hypothesized that both fatty acids would be involved in OPLL development. To examine the biological significance of these and other fatty acids in OPLL, we conducted this case-control study involving 106 patients with cervical OPLL and 109 age matched controls. Fatty acid composition was determined from plasma samples by gas chromatography. Associations between fatty acid levels and incident OPLL were evaluated by logistic regression. Contrary to our expectations, we found no significant differences between patients and controls in the levels of MA or n-3 PUFAs (e.g., eicosapentaenoic acid and docosahexaenoic acid). Logistic regression analysis did not reveal any associations with OPLL risk for MA or n-3 PUFAs. In conclusion, no potential role was found for MA or n-3 PUFAs in ectopic bone formation in the spinal canal. PMID:25669698

  18. Acute stressor exposure modifies plasma exosome-associated heat shock protein 72 (Hsp72 and microRNA (miR-142-5p and miR-203.

    Directory of Open Access Journals (Sweden)

    Lida A Beninson

    Full Text Available Exosomes, biologically active nanoparticles (40-100 nm released by hematopoietic and non-hematopoietic cells, contain a variety of proteins and small, non-coding RNA known as microRNA (miRNA. Exposure to various pathogens and disease states modifies the composition and function of exosomes, but there are no studies examining in vivo exosomal changes evoked by the acute stress response. The present study reveals that exposing male Fisher 344 rats to an acute stressor modulates the protein and miRNA profile of circulating plasma exosomes, specifically increasing surface heat shock protein 72 (Hsp72 and decreasing miR-142-5p and -203. The selected miRNAs and Hsp72 are associated with immunomodulatory functions and are likely a critical component of stress-evoked modulation of immunity. Further, we demonstrate that some of these stress-induced modifications in plasma exosomes are mediated by sympathetic nervous system (SNS activation of alpha-1 adrenergic receptors (ADRs, since drug-mediated blockade of the receptors significantly attenuates the stress-induced modifications of exosomal Hsp72 and miR-142-5p. Together, these findings demonstrate that activation of the acute stress response modifies the proteomic and miRNA profile of exosomes released into the circulation.

  19. Subsite-based alterations in miR-21, miR-125b, and miR-203 in squamous cell carcinoma of the oral cavity and correlation to important target proteins

    Directory of Open Access Journals (Sweden)

    Linda Boldrup


    Full Text Available Background: MicroRNAs (miRNAs are small noncoding RNA molecules with an essential role in regulation of gene expression. miRNA expression profiles differ between tumor and normal control tissue in many types of cancers and miRNA profiling is seen as a promising field for finding new diagnostic and prognostic tools. Materials and Methods: In this study, we have analyzed expression of three miRNAs, miR-21, miR-125b, and miR-203, and their potential target proteins p53 and p63, known to be deregulated in squamous cell carcinoma of the head and neck (SCCHN, in two distinct and one mixed subsite in squamous cell carcinoma in the oral cavity. Results: We demonstrate that levels of miRNA differ between tumors of different subsites with tongue tumors showing significant deregulation of all three miRNAs, whereas gingival tumors only showed significant downregulation of miR-125b and the mixed group of tumors in tongue/floor of the mouth showed significant deregulation of miR-21 and miR-125b. In the whole group of oral squamous cell carcinoma (SCC, a significant negative correlation was seen between miR-125b and p53 as well as a significant correlation between TP53 mutation status and miR-125b. Conclusion: The present data once again emphasize the need to take subsite into consideration when analyzing oral SCC and clearly show that data from in vitro studies cannot be transferred directly to the in vivo situation.

  20. 940nm QCW diode laser bars with 70% efficiency at 1 kW output power at 203K: analysis of remaining limits and path to higher efficiency and power at 200K and 300K (United States)

    Frevert, C.; Bugge, F.; Knigge, S.; Ginolas, A.; Erbert, G.; Crump, P.


    Both high-energy-class laser facilities and commercial high-energy pulsed laser sources require reliable optical pumps with the highest pulse power and electro-optical efficiency. Although commercial quasi-continuous wave (QCW) diode laser bars reach output powers of 300…500 W further improvements are urgently sought to lower the cost per Watt, improve system performance and reduce overall system complexity. Diode laser bars operating at temperatures of around 200 K show significant advances in performance, and are particularly attractive in systems that use cryogenically cooled solid state lasers. We present the latest results on 940 nm, passively cooled, 4 mm long QCW diode bars which operate under pulse conditions of 1.2 ms, 10 Hz at an output power of 1 kW with efficiency of 70% at 203 K: a two-fold increase in power compared to 300 K, without compromising efficiency. We discuss how custom low-temperature design of the vertical layers can mitigate the limiting factors such as series resistance while sustaining high power levels. We then focus on the remaining obstacles to higher efficiency and power, and use a detailed study of multiple vertical structures to demonstrate that the properties of the active region are a major performance limit. Specifically, one key limit to series resistance is transport in the layers around the active region and the differential internal efficiency is closely correlated to the threshold current. Tailoring the barriers around the active region and reducing transparency current density thus promise bars with increased performance at temperatures of 200 K as well as 300 K.

  1. Effect of proton irradiation induced defects on intergranular and intragranular pinning in polycrystalline textured Bi2Sr2CaCu2O8+δ and Bi1.84Pb0.34Sr1.91Ca2.03Cu3.06O10+δ superconductors

    International Nuclear Information System (INIS)

    Proton irradiated polycrystalline textured Bi2Sr2CaCu2O8+δ (Bi-2212) and Bi1.84Pb0.34Sr1.91 Ca2.03Cu3.06 O10+δ(Bi-2223) samples have been studied with respect to pinning and its correlation with irradiation induced defects characterised by Positron annihilation spectroscopy. Intergranular and intragranular pinning behaviours have been analysed through minor and major hysteresis loops respectively in DC magnetization at different fields. The sharp fall in the critical current density (Jco) at high dose of Bi-2223 as compared to Bi-2212 has been observed. (author)

  2. 33 CFR 203.32 - Policy. (United States)


    ... Emergency Management Agency (FEMA) has been requested to make an emergency or disaster declaration; a.... All Corps activities will be coordinated with the State Emergency Management Agency or equivalent... Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE...

  3. 21 CFR 131.203 - Lowfat yogurt. (United States)


    ..., expressed as lactic acid. The food may be homogenized and shall be pasteurized or ultra-pasteurized prior to... specified in paragraph (c) of this section with a characterizing bacterial culture that contains the lactic acid-producing bacteria, Lactobacillus bulgaricus and Streptococcus thermophilus. One or more of...

  4. 23 CFR 620.203 - Procedures. (United States)


    ... HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS ENGINEERING... constructed to serve as connections for interchange of traffic between the Federal-aid project and local roads... facility or the traffic thereon; (4) That the lands to be relinquished are not suitable for retention...

  5. 10 CFR 600.203 - Applicability. (United States)


    ... OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS FINANCIAL ASSISTANCE RULES Uniform Administrative...)(B). (4) Entitlement grants under the following programs of The National School Lunch Act: (i) School... The Child Nutrition Act of 1966: (i) Special Milk (section 3 of the Act), and (ii) School...

  6. 48 CFR 16.203-2 - Application. (United States)


    ... covered separately in the contract. Price adjustments based on established prices should normally be restricted to industry-wide contingencies. Price adjustments based on labor and material costs should be... clause. (b) In contracts that do not require submission of certified cost or pricing data,...

  7. 42 CFR 37.203 - Autopsy specifications. (United States)


    ... Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES MEDICAL CARE AND...) Shall include: (i) Gross and microscopic examination of the lungs, pulmonary pleura, and... under this subparagraph shall be in the metric system); (iii) Circumference of each cardiac valve...

  8. 47 CFR 20.3 - Definitions. (United States)


    ... requires the use of special location-determining hardware and/or software in a portable or mobile phone. Handset-based location technology may also employ additional location-determining hardware and/or software... of providing the location of wireless 911 callers that employs hardware and/or software in the...

  9. 14 CFR 120.203 - General. (United States)


    ... set forth in 49 CFR part 40. The provisions of 49 CFR part 40 that address alcohol testing are made... establish programs designed to help prevent accidents and injuries resulting from the misuse of alcohol by... AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS DRUG AND ALCOHOL TESTING...

  10. 33 CFR 203.46 - Restrictions. (United States)


    ... EMERGENCY EMPLOYMENT OF ARMY AND OTHER RESOURCES, NATURAL DISASTER PROCEDURES Rehabilitation Assistance for Flood Control Works Damaged by Flood or Coastal Storm: The Corps Rehabilitation and Inspection Program..., recreation, fish and wildlife enhancement, land reclamation, habitat restoration, drainage, bank...

  11. 48 CFR 31.203 - Indirect costs. (United States)


    ... fiscal year used for financial reporting purposes in accordance with generally accepted accounting... coverage, the contractor shall follow the criteria and guidance in 48 CFR 9904.406 for selecting the cost... contract or other work, indirect costs are those remaining to be allocated to intermediate or two or...

  12. 31 CFR 203.2 - Definitions. (United States)


    ... located for purposes of Regulation D (12 CFR 204.3(b)(2)), even if the financial institution is not... instructions. ACH debit entry means a debit transaction originated by the Treasury Financial Agent (TFA), at.... Treasury Financial Agent (TFA) means a financial institution designated as an agent of Treasury...

  13. 40 CFR 211.203 - Definitions. (United States)


    ... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS PRODUCT NOISE... acoustic enclosures which fit over the ears and which are held in place by a spring-like headband to which... interchangeably with -the terms, “hearing protector” and -“device.” (n) Impulsive Noise. An acoustic...

  14. 24 CFR 203.672 - Residential areas. (United States)


    ... used by persons active in the real estate industry in the affected area. (b) HUD shall establish such... constitutes a local economic market for the purchase and sale of residential real estate. In...

  15. QTL Information Table: 203 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available ss2 Physiological trait Source activity seed setting Mixture C)Interval RIL Zhenshan 97 Minghui ... ment interaction for rice panicle characteristics. Yi ... Chuan Xue Bao 28, 439-446. ...

  16. 48 CFR 2937.203 - Policy. (United States)


    ... 836) to prepare a written justification for such services. Written justification must be submitted to... action planned, the justification in paragraph (a) of this section must include the following: (1) A...(s) of official(s) who will be assigned as project officer(s) to work with the contractor, and...

  17. 5 CFR 430.203 - Definitions. (United States)


    ... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERFORMANCE MANAGEMENT... particular level of performance. A performance standard may include, but is not limited to, quality, quantity... responsibility of such importance that unacceptable performance on the element would result in a...

  18. 47 CFR 13.203 - Examination elements. (United States)


    ... specialized theory and practice applicable to the proper installation, servicing and maintenance of ship radar... routing and accounting, etc. (5) Element 7: GMDSS radio operating practices. Questions concerning GMDSS... practice with which every maritime radio operator should be familiar. Questions concerning provisions...

  19. 21 CFR 333.203 - Definitions. (United States)


    ... lives upon the skin or in the hair or nails. (d) Fungus. Any of a large division of plants, including..., inner thighs and sometimes extends to the groin and the pubic area; the condition most frequently...

  20. 21 CFR 203.22 - Exclusions. (United States)


    ... purchase or other acquisition of a drug for its own use by a hospital or other health care entity that is a... the act and this part applicable to a wholesale distributor or retail pharmacy. (i) The sale, purchase... pharmacy....

  1. 49 CFR 180.203 - Definitions. (United States)


    ... (e.g. chemical stress corrosion). Condemn means a determination that a cylinder is unserviceable for... nickel cylinder has reached 343 °C (650 °F) or higher. Permanent expansion means a permanent increase...

  2. 48 CFR 16.203-1 - Description. (United States)


    ... experiences during contract performance. (3) Adjustments based on cost indexes of labor or material. These... performance or delivery incentives (see 16.402-2 and 16.402-3) when the award fee or incentive is based solely... types: (1) Adjustments based on established prices. These price adjustments are based on increases...

  3. 5 CFR 2640.203 - Miscellaneous exemptions. (United States)


    ... by the board's recommendations because all SES awards are derived from the same limited pool of funds... an action against Alpha for failing to make required payments to its employee pension fund, even though the agency action will cause Alpha to disband its frequent flier program. (f) Mutual...

  4. 49 CFR 228.203 - Program components. (United States)


    ... accuracy of the data for a specific employee but nevertheless errs in pre-populating a data field. (E) The... station; (4) Released location, either yard or station; (5) Operating territory (i.e., division or service...— (1) Calculate the total time on duty for each employee, using data entered by the employee...

  5. 21 CFR 203.3 - Definitions. (United States)


    ... FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL... that will be used for routine office procedures. (n) FDA means the U.S. Food and Drug Administration... acutely ill or injured persons; provision of minimal emergency supplies of drugs to nearby nursing...

  6. The study of inter and intragranular pinning behavior of oxygen irradiated textured polycrystalline Bi2Sr2CaCu2O8+δ and Bi1.84Pb0.34Sr1.91Ca2.03Cu3.06O10+δ superconductors

    International Nuclear Information System (INIS)

    Inter and intragranular pinning potentials of 116 MeV oxygen ion irradiated textured polycrystalline Bi2Sr2CaCu2O8+δ (Bi-2212) and Bi1.84Pb0.34Sr1.91Ca2.03Cu3.06O10+δ (Bi-2223) have been studied from dc magnetization at low (50 Oe) and high (10,000 Oe) fields respectively. There is an increase in intergranular pinning potential (U0) in Bi-2223 in contrast to anomalous decreases in Bi-2212 with increasing dislocation density. Intragranular pinning potential is governed by the concentration of vacancy type defects rather than its size as observed in proton irradiation. Pinning has been explained in the light of statistical dilute pinning model

  7. A Search for Lepton-Flavor-Violating Decays of the 125 GeV Higgs Boson with Hadronically Decaying Tau Leptons in the 20.3 fb$^{-1}$, $\\sqrt{s} = 8$ TeV Dataset Collected in 2012 by the ATLAS Detector at the Large Hadron Collider

    CERN Document Server


    This dissertation presents a search for lepton-flavor-violating (LFV) decays of the 125 GeV Higgs boson in final states of $\\mu\\tau_{\\mathrm{had}}$ and $e\\tau_{\\mathrm{had}}$ in the full dataset collected by the ATLAS detector in 2012. The search is based on data samples of proton--proton collisions at $\\sqrt{s} = 8$ TeV, corresponding to an integrated luminosity of 20.3 fb$^{-1}$. The topology of LFV events is exploited through an optimized selection of objects and events, with signal and control regions defined by event kinematics. A binned likelihood fit searching for the presence of LFV Higgs decays is performed using the reconstructed Higgs boson mass as the discriminating variable. No such decays are observed. The expected (observed) upper limits at $95\\%$ confidence on the branching ratios for the muon and electron final states are found to be $\\mathrm{Br}(H \\rightarrow \\mu\\tau) = 1.24\\%~(1.85\\%)$ and $\\mathrm{Br}(H \\rightarrow e\\tau) = 2.07\\%~(1.81\\%)$.

  8. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.


    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  9. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE,CERN


    Rothe, Sebastian


    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spec...

  10. Inactivation of human osteosarcoma cells in vitro by {sup 211}At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, R.H. [Univ. of Oslo (Norway)]|[Institute for Cancer Research, Oslo (Norway); Bruland, O.S. [Institute for Cancer Research, Oslo (Norway); Hoff, P.; Alstad, J. [Univ. of Oslo (Norway); Lindmo, T. [Institute for Cancer Research, Oslo (Norway); Rofstad, E.K. [Norwegian Institute of Technology, Trondheim (Norway)


    The potential usefulness of {alpha}-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) {sup 211}At-TP-3 of different specific activities, (b) {sup 211}At-labeled bovine serum albumin (BSA), (c) free {sup 211}At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, {sup 211}At-BSA or free {sup 211}At. The D{sub o}`s were lower for free {sup 211}At than for {sup 211}At-BSA. The survival curves for {sup 211}At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to {sup 211}At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to {sup 211}At-TP-3 treatment was the antigen expression. Cell inactivation after {sup 211}At-TP-3 treatment increased substantially with increasing specific activity of the {sup 211}At-TP-3. At high specific activities, the cytotoxic effect of {sup 211}At-TP-3 was significantly higher than that of {sup 211}At-BSA. In conclusion, {sup 211}At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs.

  11. The study of inter and intragranular pinning behavior of oxygen irradiated textured polycrystalline Bi{sub 2}Sr{sub 2}CaCu{sub 2}O{sub 8+{delta}} and Bi{sub 1.84}Pb{sub 0.34}Sr{sub 1.91}Ca{sub 2.03}Cu{sub 3.06}O{sub 10+{delta}} superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Sen, Pintu; Bandyopadhyay, S.K.; Nambissan, P.M.G.; Ganguly, R.; Barat, P.; Mukherjee, P


    Inter and intragranular pinning potentials of 116 MeV oxygen ion irradiated textured polycrystalline Bi{sub 2}Sr{sub 2}CaCu{sub 2}O{sub 8+{delta}} (Bi-2212) and Bi{sub 1.84}Pb{sub 0.34}Sr{sub 1.91}Ca{sub 2.03}Cu{sub 3.06}O{sub 10+{delta}} (Bi-2223) have been studied from dc magnetization at low (50 Oe) and high (10,000 Oe) fields respectively. There is an increase in intergranular pinning potential (U{sub 0}) in Bi-2223 in contrast to anomalous decreases in Bi-2212 with increasing dislocation density. Intragranular pinning potential is governed by the concentration of vacancy type defects rather than its size as observed in proton irradiation. Pinning has been explained in the light of statistical dilute pinning model.

  12. Neurocognition and Function of Social Life Investigation among HIV/AIDS Subjects Infected by Plasma Donation%203例农村有偿献血感染人类免疫缺陷病毒者的神经认知及社会生活功能

    Institute of Scientific and Technical Information of China (English)

    石川; Igor GRANGT; Robert K.HEATON; 于欣; 梁英; 陈玉芳; 吴尊友; JIN Hua; Ofilio VIGIL; Lucette A.CYSIQUE; Donald R.FRANKLIN Jr


    目的:调查通过献血途径感染人类免疫缺陷病毒(Human immunodeficiency virus,HIV)的203例患者的神经认知状况和社会生活功能.方法:横断面研究,采用神经心理成套测验和日常生活能力量表对安徽阜阳203例通过献血途径感染HIV的患者进行调查,选取198例年龄、性别和受教育年限相匹配的HIV阴性献血者为对照.神经心理成套测验包括执行功能、词语流畅、学习、记忆、精细运动、信息处理速度和工作记忆7个认知领域.以总体缺陷分≥0.5分作为认知损害的划界分.结果:HIV阳性受试总体认知功能[(45.7±5.9) vs.(49.4±6.0),P<0.01]和7个认知领域都较HIV阴性受试差.在精细运动功能方面HIV与丙型肝炎病毒(Heptitis C virus,HCV)感染存在交互作用(F=5.28,P<0.05).临床无症状期的HIV感染者和获得性免疫缺陷综合征(Acquired Immune Deficiency Syndrome,AIDS)患者认知损害率分别为29.2%和43.0%.HIV阳性受试的日常生活能力下降得分高于HIV阴性受试[(0.49±1.32 vs.(0.14±0.75),P<0.01],工作月数、个人和家庭月收入少于HIV阴性受试(P<0.01).认知损害组患者最低CD4细胞计数低于非认知损害组[(214.3±144.0) vs.(274.8±161.1),P=0.010],日常生活能力下降更明显[(0.75±1.58)vs.(0.34±1.13,) P<0.01].总体认知功能和日常生活能力下降相关(r=-0.22,P<0.01).结论:HIV感染者7个神经认知领域均有损害,合并丙型肝炎病毒感染可加重精细运动功能损害,随着疾病进展认知损害率提高;HIV感染者日常生活能力下降、职业功能和经济收入更差.最低CD4细胞计数对神经认知功能受损有一定预测作用;神经认知功能对日常生活能力下降造成一定影响,进而影响个人和家庭的经济收入.%Objective:To investigate the neurocognition and function of social life among human immunodeficiency virus (HIV) positive subjects infected by plasma donation.Methods:Totally 203 HIV positive

  13. 24 CFR 599.203 - Basic application submission requirements. (United States)


    ... HOUSING AND URBAN DEVELOPMENT COMMUNITY FACILITIES RENEWAL COMMUNITIES Procedures for Nomination of... notice of, and an opportunity to participate in, the application development process. Notice...

  14. 40 CFR 240.203-2 - Recommended procedures: Design. (United States)


    ..., easy to maintain, and consistent with the land use of the area. (d) Employee convenience facilities and... operating unit malfunctions. (j) Sampling capability should be designed into the facility so that each process stream can be sampled, and the utilities required to do so should be close at hand. The...

  15. 49 CFR 219.203 - Responsibilities of railroads and employees. (United States)


    ... duty tour. An employee who has been transported to receive medical care is not released from duty for... testing does not excuse such refusal by the employee timely to provide the required specimens. (c)...

  16. 18 CFR 281.203 - Definitions and cross references. (United States)


    ... in 7 CFR part 2900, et seq. (3) Essential agricultural user means a person who uses natural gas for... such as space heating, air conditioning, hot water heating, cooking, clothes drying, and other residential uses and includes apartment buildings and other multi-unit buildings. (9) Small...

  17. 48 CFR 36.203 - Government estimate of construction costs. (United States)


    ... simplified acquisition threshold. The contracting officer may require an estimate when the cost of required... the associated cost breakdown figures in the Government estimate, but only to the extent deemed... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Government estimate...

  18. Probing fusion-fission dynamics in Bi203 (United States)

    Mukul, Ish; Nath, S.; Golda, K. S.; Jhingan, A.; Gehlot, J.; Prasad, E.; Kalkal, Sunil; Naik, M. B.; Banerjee, Tathagata; Varughese, T.; Sugathan, P.; Madhavan, N.; Pal, Santanu


    Background: Complete fusion between two massive nuclei after capture inside the potential barrier is inhibited by competing fission-like processes. The target-projectile composite system may reseparate after capture without proceeding towards formation of the compound nucleus (CN), which is equilibrated in all degrees of freedom. The nature of these non-CN fission (NCNF) processes and factors that affect them are not completely known yet. Purpose: The nuclear mass regions from where NCNF processes begin to manifest themselves are not clearly demarcated. This work aims to study the onset of NCNF, if any, in the mass region ˜200 . Methods: Fission fragment (FF) mass and angular distribution (MAD) and pre-scission and post-scission neutron multiplicities were measured for the reaction +W184F19 at a laboratory energy (Elab) range of 84-125 MeV. The measurements were carried out using two multiwire proportional counters (MWPC) to detect the FFs in coincidence and four neutron detectors to measure neutron time of flight (TOF). Statistical model (SM) calculation was performed. Results: No significant mass-angle correlation was observed in the MAD plots. Extracted mass ratio distributions were single-peaked and of Gaussian shape. Measured pre-scission neutron multiplicity values indicated dissipative nature of CN decay for this reaction. Conclusions: No clear signatures of NCNF were observed in the studied reaction, indicating that the target-projectile composite system predominantly proceeds towards formation of the CN after capture.

  19. 22 CFR 203.6 - IPVO conditions of registration. (United States)


    ... scientific activities, church, synagogue, mosque or other similar entity organized primarily for religious... USAID and the organization is contrary to the national defense, national security, or foreign...

  20. 48 CFR 34.203 - Solicitation provisions and contract clause. (United States)


    ... IBR, in solicitations for contracts that require the contractor to use an Earned Value Management System (EVMS) and for which the Government requires an Integrated Baseline Review (IBR) prior to award... at 52.234-3, Notice of Earned Value Management System - Post Award IBR, in solicitations...

  1. 40 CFR 92.203 - Application for certification. (United States)


    ... operational parameters (e.g., engine coolant temperature); (iii) Each auxiliary emission control device (AECD..., are the most effective means possible of preventing adjustment of parameters to settings outside the... accordance with § 92.9(a); (12) The intended deterioration factors for the engine family, in accordance...

  2. 29 CFR 541.203 - Administrative exemption examples. (United States)


    ... liability and total value of a claim; negotiating settlements; and making recommendations regarding... reject all applicants who do not meet minimum standards for the particular job or for employment by the... training or experience. They have some leeway in the performance of their work but only within...

  3. 24 CFR 203.604 - Contact with the mortgagor. (United States)


    ... Contact with the mortgagor. (a) (b) The mortgagee must have a face-to-face interview with the mortgagor... interview, the mortgagee must have a face-to-face meeting with the mortgagor, or make a reasonable attempt... face-to-face meeting is not required if: (1) The mortgagor does not reside in the mortgaged...

  4. 31 CFR 203.21 - Collateral security requirements. (United States)


    ... valued, are set forth in 31 CFR part 380. (e) Assignment of securities. By pledging acceptable securities... that are TT&L depositaries have collateral security requirements, as follows: (a) Investor and retainer depositaries—(1) PATAX and EFTPS tax payments. Investor and retainer depositaries must pledge...

  5. 5 CFR 950.203 - Public accountability standards. (United States)


    ... organization is directed by an active and responsible governing body whose members have no material conflict of... fundraising practices prohibit the sale or lease of its CFC contributor lists. (7) Certify that its...

  6. 49 CFR 1580.203 - Reporting significant security concerns. (United States)


    ... TRANSPORTATION SECURITY Passenger Rail Including Passenger Railroad Carriers, Rail Transit Systems, Tourist... system of transportation, each carrier operating or providing intercity passenger train service or... railroad carrier hosting an operation described in paragraph (a)(1) of this section. (3) Each...

  7. 22 CFR 203.7 - IPVO initial documentation requirements. (United States)


    ... country in which it is domiciled; (3) Bylaws or other documents establishing the applicant's corporate... Form 200-1, PVO Classification Form. (b) In addition, each applicant must submit such other...

  8. 27 CFR 9.203 - Saddle Rock-Malibu. (United States)


    ... Conejo land grant, section 3, T1S/R19W; then (3) Proceed straight east-southeast along the El Conejo land... mile along the El Conejo land grant boundary line to its second intersection with the...

  9. 24 CFR 203.333 - Reinstatement of defaulted mortgage. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Reinstatement of defaulted mortgage... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Default Under Mortgage §...

  10. Preface: phys. stat. sol. (a) 203/12 (United States)

    Jackman, Richard B.; Nesládek, Milo; Haenen, Ken


    The 30 papers gathered in this issue of physica status solidi (a) give a thorough overview over different topics that were presented during the 11th edition of the International Workshop on Surface and Bulk Defects in CVD Diamond Films (SBDD), which took place from 22 to 24 February 2006, at the Hasselt University in Diepenbeek-Hasselt, Belgium. Since its start more than 10 years ago, the SBDD Workshop has grown into a well-established, yearly early bird meeting place, addressing new emerging science related to the progress in the CVD diamond field. The 10 invited lectures, 29 contributed oral presentations and 26 posters were presented in several sessions during an intense two and a half day long meeting.The number of participants reached 115 this year with participants coming from fifteen countries: Austria, Belgium, Czech Republic, France, Germany, Israel, Italy, Japan, Mexico, Poland, Russia, Singapore, Slovak Republic, Sweden, UK, and USA. The mixture of young and established scientists, including a great proportion of students, made this meeting a hot spot of lively discussions on a wide range of scientific subjects, not only during the meeting itself, but also at several occasions throughout many social events offered by the hospitality of the city of Hasselt.It stands for itself that the workshop would not have been possible without the support of many people and institutions. For financial aid we are especially indebted to the Scientific Research Community Surface Modification of Materials of the F.W.O.-Vlaanderen (Belgium), whose incessant support plays an important role in keeping this meeting going. We also thank the Hasselt University for offering the lecture hall and infrastructure facilities and Seki Technotron Corp. for sponsoring the poster reception and their presence with a table top exhibit. Finally we highly appreciate the active approach of the editorial staff of physica status solidi in this conference and would like to thank most notably Stefan Hildebrandt, Ron Schulz-Rheinländer, Christoph Lellig, and Julia Hübner, for their excellent and patient work, bringing the number of successfully published proceedings of SBDD in pss (a) up to 8 already!To finish, we would all like to invite you to the 12th edition of the SBDD series, newly renamed as Hasselt Diamond Workshop, to be held at its established location of Diepenbeek-Hasselt. We look forward meeting you again at SBDD XII in 2007:Hasselt Diamond Workshop - SBDD XII28 February-2 March 2007Hasselt University, Diepenbeek-Hasselt, Belgium, Paris, Hasselt, August 2006

  11. 48 CFR 15.203 - Requests for proposals. (United States)


    ... information regarding cost comparisons between Government and contractor performance. (c) Electronic commerce... RFP shall specify the electronic commerce method(s) that offerors may use (see subpart 4.5). (d... and suitability of electronic commerce methods; and (iv) Adequacy of administrative procedures...

  12. 31 CFR 203.15 - Tax deposits using FTD coupons. (United States)


    ...) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE PAYMENT OF FEDERAL TAXES AND THE... absorbs for its own account any float and other costs involved. (b) Place a stamp impression on the...

  13. Dicty_cDB: VHI203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s producing significant alignments: (bits) Value AF325215_2( AF325215 |pid:none) Lymphocytic choriomeningitis...5090 |pid:none) Schistosoma japonicum SJCHGC03255 ... 36 2.8 EU480452_2( EU480452 |pid:none) Lymphocytic choriomeningitis...325214_2( AF325214 |pid:none) Lymphocytic choriomeningitis virus... 35 8.2 BX2941

  14. 24 CFR 203.49 - Eligibility of adjustable rate mortgages. (United States)


    ... insured pursuant to this section and 24 CFR part 234 in any fiscal year may not exceed 30 percent of the... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER... most recent figure available before the date of mortgage loan origination. The current index...

  15. 21 CFR 203.34 - Policies and procedures; administrative systems. (United States)


    ... annual physical inventory and preparation of the reconciliation report; (3) Implementing a sample... reconciliation of requests and receipts; (b) Distributing drug samples by means other than mail or common...

  16. 17 CFR 242.203 - Borrowing and delivery requirements. (United States)


    ... (CONTINUED) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES...) If a broker or dealer knows or has reasonable grounds to believe that the sale of an equity security was or will be effected pursuant to an order marked “long,” such broker or dealer shall not lend...

  17. Editorial: phys. stat. sol. (a) 203/1 (United States)

    Stutzmann, Martin


    Dear Colleagues and Friends,on behalf of the Publishers, the Editorial Office, and the Editors of physica status solidi we wish you all the best for the coming year 2006! It is our sincere hope that your personal and professional experience with our journal has been a positive one and that you will continue to choose physica status solidi for the publication of your scientific findings in solid state physics also in the future.In doing so, you will be in increasingly good company! As a matter of fact, 2005 has been a year of exceptional growth in the number of manuscripts submitted to physica status solidi. Thus, the number of Original Papers which have reached our Editorial Office in Berlin has increased by as much as 30% compared to the long term average over the last ten years. For the Rapid Research Letter section, the corresponding increase has been even more impressive: more than +100% just in the last two years. We view this development as a confirmation of our longstanding efforts to ensure a timely publication service of high scientific quality. One relevant indicator for the high scientific standards expected from articles which are submitted for publication in physica status solidi is the average acceptance rate, which currently is less than 40%. This rate has continuously decreased from a value of about 60% ten years ago and bears witness to our efforts to strive for quality rather than quantity.Also, physica status solidi has been able to continue its long tradition as a truly international journal, despite of the strong competition in an established field such as solid state physics. In 2005, submitted papers have originated almost equally from the Americas, Europe, and Asia, with a clearly growing contribution from China, India, and Japan. We are actively working together with our international Editorial Boards and the Regional Editors to maintain a reasonable balance among papers from different parts of the world. The increasing international visibility of physica status solidi is impressively documented by the ever rising numbers of article downloads via the internet: on the average, each of the 2000 articles published annually in physica status solidi is presently accessed about 100 times via the www.Finally, let me mention some other recent developments, which are not so directly visible from the outside. Thus, a new all electronic publishing system has become operative in our Berlin Editorial Office in 2005, which allows a more efficient and timely handling of manuscripts from submission to publication ( and is particularly valuable for the editing of conference proceedings ( In addition, the functionality of the journal within the Wiley InterScience website has been enhanced by new features such as Citation Tracking. Together with the ongoing digitization of all physica status solidi issues since the 1960s, which is expected to be complete in 2006, this makes the physica status solidi homepage at Wiley InterScience a very valuable tool for literature search in solid state physics, past and present. Try it out at!All of us from physica status solidi would like to convey to you our very best wishes for good health and success in the coming year 2006!

  18. 14 CFR 1203.203 - Degree of protection. (United States)


    ...; disruption of foreign relations vitally affecting the national security; the compromise of vital national... intelligence operations; and the disclosure of scientific or technological developments vital to national... of serious damage include disruption of foreign relations significantly affecting the...

  19. Dicty_cDB: SHC203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A sequence. 56 0.001 1 CV682907 |CV682907.1 service43_H06_sjs2-16-2B11-T3 SJS Schistosoma japonicum cDNA, mR...NA sequence. 56 0.001 1 CV682854 |CV682854.1 service30_G09_sjs2-14-10C09-T3 SJS Schistosoma japonicum cDNA,

  20. Dicty_cDB: CFF203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LQHPFL TKACPIKDFKEILPALYMSNTLSNML*nk*ink*ink Frame B: nnnnnkkmnqikvqyqhhqhyhhn*nqqilk*qmmiqv*mhqmqc*hqi...ittirinkf*ndk**ykfkctkcnvntk*yfryilfnnls r*kekn*ff*nicitrsfi*iprrv**sigktfk*k*skrtf*kfrfrskrrfr*cllck e*essfcir*tngcpkenanq...20-6776760 strain AX4, complete sequence. 36 0.079 14 AL135918 |AL135918.6 Human DNA sequence from clone RP1...ey sequence. 34 0.21 3 AF515706 |AF515706.1 Schistosoma mansoni Fes-like tyrosine kinase protein mRNA, compl...ii strain WM276 ... 176 2e-42 AE017344_570( AE017344 |pid:none) Cryptococcus neoforman