WorldWideScience

Sample records for astatine 203

  1. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  2. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others

    2015-10-15

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  3. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Science.gov (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.

    2015-10-01

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  4. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-09-15

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  6. Discovery of the astatine, radon, francium, and radium isotopes

    Science.gov (United States)

    Fry, C.; Thoennessen, M.

    2013-09-01

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  7. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration

    2011-11-30

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  8. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Science.gov (United States)

    Uusitalo, J.; Jakobsson, U.

    2011-11-01

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  9. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  10. Measurement of the first ionization potential of astatine by laser ionization spectroscopy.

    Science.gov (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  11. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  12. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  13. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  14. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  15. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  16. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  17. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  18. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study

    Science.gov (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi

    2018-01-01

    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).

  19. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  20. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  1. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  2. 9 CFR 203.8-203.9 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false 203.8-203.9 Section 203.8-203.9 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE STATEMENTS OF GENERAL POLICY UNDER THE PACKERS AND STOCKYARDS...

  3. Main: HSRENTHSR203J [PLACE

    Lifescience Database Archive (English)

    Full Text Available ment) in tobacco (N.t.) responsible for the marked induction of the HSR203J gene during the HR (hypersensiti...HSRENTHSR203J S000466 24-April-2005 (last modified) kehi HSRE(HSR203 responsive ele

  4. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  5. 40 CFR 240.203 - General design.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false General design. 240.203 Section 240.203 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR... design. ...

  6. 48 CFR 203.104 - Procurement integrity.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Procurement integrity. 203..., DEPARTMENT OF DEFENSE GENERAL IMPROPER BUSINESS PRACTICES AND PERSONAL CONFLICTS OF INTEREST Safeguards 203.104 Procurement integrity. ...

  7. 24 CFR 203.203 - Issuance and nature of insured 10-year protection plans.

    Science.gov (United States)

    2010-04-01

    ...-year protection plans. (a) Plans may be issued: (1) By a builder, warranty company, insurance company... guarantees the builder's performance and the State's continuing financial backing throughout the Plan's... through § 203.202, § 203.204 through § 203.206, and § 203.209 to be acceptable to HUD. HUD will evaluate...

  8. 14 CFR 67.203 - Eye.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Eye. 67.203 Section 67.203 Aeronautics and... AND CERTIFICATION Second-Class Airman Medical Certificate § 67.203 Eye. Eye standards for a second-class airman medical certificate are: (a) Distant visual acuity of 20/20 or better in each eye...

  9. 32 CFR 203.10 - Eligible activities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Eligible activities. 203.10 Section 203.10... ACTIVITIES § 203.10 Eligible activities. (a) TAPP procurements should be pursued by the RAB or TRC only to... environmental restoration activities at the installation and is likely to contribute to community acceptance of...

  10. 32 CFR 203.11 - Ineligible activities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Ineligible activities. 203.11 Section 203.11... ACTIVITIES § 203.11 Ineligible activities. The following activities are ineligible for assistance under the...) Political activity and lobbying as defined by OMB Circular A-122. (c) Other activities inconsistent with the...

  11. 24 CFR 203.32 - Mortgage lien.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage lien. 203.32 Section 203... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Eligibility Requirements and Underwriting Procedures Eligible Mortgagors § 203...

  12. 49 CFR 37.203 - Lift maintenance.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Lift maintenance. 37.203 Section 37.203... DISABILITIES (ADA) Over-the-Road Buses (OTRBs) § 37.203 Lift maintenance. (a) The entity shall establish a system of regular and frequent maintenance checks of lifts sufficient to determine if they are operative...

  13. 24 CFR 904.203 - Planning.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Planning. 904.203 Section 904.203... HOUSING HOMEOWNERSHIP OPPORTUNITIES Homeownership Counseling and Training § 904.203 Planning. (a) The... beyond the contract period. (c) In planning a homeownership counseling and training program, whether self...

  14. 48 CFR 5416.203-3 - Limitations.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Limitations. 5416.203-3 Section 5416.203-3 Federal Acquisition Regulations System DEFENSE LOGISTICS AGENCY, DEPARTMENT OF DEFENSE TYPES OF CONTRACTS Fixed Price Contracts 5416.203-3 Limitations. (S-90) A fixed price contract with...

  15. 21 CFR 203.35 - Standing requests.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Standing requests. 203.35 Section 203.35 Food and... PRESCRIPTION DRUG MARKETING Samples § 203.35 Standing requests. Manufacturers or authorized distributors of record shall not distribute drug samples on the basis of open-ended or standing requests, but shall...

  16. 9 CFR 203.3 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false 203.3 Section 203.3 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE STATEMENTS OF GENERAL POLICY UNDER THE PACKERS AND STOCKYARDS ACT § 203.3 ...

  17. 9 CFR 203.11 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false 203.11 Section 203.11 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE STATEMENTS OF GENERAL POLICY UNDER THE PACKERS AND STOCKYARDS ACT § 203.11 ...

  18. 9 CFR 203.1 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false 203.1 Section 203.1 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE STATEMENTS OF GENERAL POLICY UNDER THE PACKERS AND STOCKYARDS ACT § 203.1 ...

  19. 9 CFR 203.13 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false 203.13 Section 203.13 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE STATEMENTS OF GENERAL POLICY UNDER THE PACKERS AND STOCKYARDS ACT § 203.13 ...

  20. 9 CFR 203.6 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false 203.6 Section 203.6 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE STATEMENTS OF GENERAL POLICY UNDER THE PACKERS AND STOCKYARDS ACT § 203.6 ...

  1. 29 CFR 1614.203 - Rehabilitation Act.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 4 2010-07-01 2010-07-01 false Rehabilitation Act. 1614.203 Section 1614.203 Labor... EMPLOYMENT OPPORTUNITY Provisions Applicable to Particular Complaints § 1614.203 Rehabilitation Act. (a... Rehabilitation Act of 1973, as amended (29 U.S.C. 791), has been violated in a complaint alleging nonaffirmative...

  2. 14 CFR 417.203 - Compliance.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Compliance. 417.203 Section 417.203... TRANSPORTATION LICENSING LAUNCH SAFETY Flight Safety Analysis § 417.203 Compliance. (a) General. A launch... need for further demonstration of compliance to the FAA, if: (1) A launch operator has contracted with...

  3. 1 CFR 20.3 - Organization.

    Science.gov (United States)

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Organization. 20.3 Section 20.3 General... DOCUMENTS HANDLING OF THE UNITED STATES GOVERNMENT MANUAL STATEMENTS § 20.3 Organization. (a) Information about lines of authority and organization may be reflected in a chart if the chart clearly delineates...

  4. 24 CFR 203.7 - Commitment process.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Commitment process. 203.7 Section 203.7 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued... Insurance, and Commitments § 203.7 Commitment process. For single family mortgage programs that are not...

  5. 48 CFR 203.1004 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... OF DEFENSE GENERAL IMPROPER BUSINESS PRACTICES AND PERSONAL CONFLICTS OF INTEREST Contractor Code of Business Ethics and Conduct 203.1004 Contract clauses. (a) Use the clause at 252.203-7003 in solicitations and contracts that include the FAR clause 52.203-13, Contractor Code of Business Ethics and Conduct...

  6. 7 CFR 1260.203 - Confidential treatment.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Confidential treatment. 1260.203 Section 1260.203 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... Promotion and Research Order Reports, Books and Records § 1260.203 Confidential treatment. All information...

  7. 48 CFR 2131.203 - Indirect costs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Indirect costs. 2131.203 Section 2131.203 Federal Acquisition Regulations System OFFICE OF PERSONNEL MANAGEMENT, FEDERAL EMPLOYEES... FAR 31.203 apply to the allocation of indirect costs. ...

  8. 42 CFR 51c.203 - Project elements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Project elements. 51c.203 Section 51c.203 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR COMMUNITY HEALTH SERVICES Grants for Planning and Developing Community Health Centers § 51c.203 Project elements. A project...

  9. 42 CFR 56.203 - Project elements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Project elements. 56.203 Section 56.203 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR MIGRANT HEALTH SERVICES Grants for Planning and Developing Migrant Health Centers § 56.203 Project elements. A project for...

  10. 14 CFR 25.203 - Stall characteristics.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Stall characteristics. 25.203 Section 25.203 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY AIRPLANES Flight Stalls § 25.203 Stall characteristics. (a) It must...

  11. 46 CFR 109.203 - Sanitation.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Sanitation. 109.203 Section 109.203 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS OPERATIONS Tests, Drills, and Inspections § 109.203 Sanitation. (a) The master or person in charge shall insure that the accommodation...

  12. 40 CFR 243.203 - Collection frequency.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Collection frequency. 243.203 Section 243.203 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES... and Recommended Procedures § 243.203 Collection frequency. ...

  13. 32 CFR 203.8 - Evaluation criteria.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Evaluation criteria. 203.8 Section 203.8...) MISCELLANEOUS TECHNICAL ASSISTANCE FOR PUBLIC PARTICIPATION (TAPP) IN DEFENSE ENVIRONMENTAL RESTORATION ACTIVITIES § 203.8 Evaluation criteria. The Department of Defense will begin the TAPP procurement process...

  14. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.

    2017-04-01

    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  15. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination.

    Science.gov (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick

    2007-01-01

    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  16. Quadrupole moment of 203Fr

    Science.gov (United States)

    Wilkins, S. G.; Lynch, K. M.; Billowes, J.; Binnersley, C. L.; Bissell, M. L.; Cocolios, T. E.; Goodacre, T. Day; de Groote, R. P.; Farooq-Smith, G. J.; Flanagan, K. T.; Franchoo, S.; Ruiz, R. F. Garcia; Gins, W.; Heylen, H.; Koszorús, Á.; Neyens, G.; Stroke, H. H.; Vernon, A. R.; Wendt, K. D. A.; Yang, X. F.

    2017-09-01

    The spectroscopic electric quadrupole moment of the neutron-deficient francium isotope 203Fr was measured by using high-resolution collinear resonance ionization spectroscopy (CRIS) at the CERN Isotope Separation On-Line Device (ISOLDE) facility. A remeasurement of the 207Fr quadrupole moment was also performed, resulting in a departure from the established literature value. A sudden increase in magnitude of the 203Fr quadrupole moment, with respect to the general trend in the region, points to an onset of static deformation at N =116 in the 87Fr isotopic chain. Calculation of the static and total deformation parameters show that the increase in static deformation only cannot account for the observed departure of its relative charge radius from the 82Pb chain.

  17. 24 CFR 203.355 - Acquisition of property.

    Science.gov (United States)

    2010-04-01

    ... mortgage under § 203.43(c); (6) Complete an assumption under § 203.512; (7) File a partial claim under... is later. (i) Modification under § 203.616, refinance under § 203.43(c), or assumption under § 203.512. Provided that the mortgagee has established the mortgagor's eligibility within the time frame...

  18. 33 CFR 203.13 - Available assistance.

    Science.gov (United States)

    2010-07-01

    ... DEFENSE EMERGENCY EMPLOYMENT OF ARMY AND OTHER RESOURCES, NATURAL DISASTER PROCEDURES Introduction § 203... consumption. Subpart E addresses drought assistance. (f) Advance Measures. Advance Measures assistance may be...

  19. 48 CFR 203.170 - Business practices.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE GENERAL IMPROPER BUSINESS PRACTICES AND PERSONAL CONFLICTS OF INTEREST Safeguards 203..., contract negotiation, and contract award, departments and agencies shall adhere to the following best...

  20. 48 CFR 42.203 - Contract administration services directory.

    Science.gov (United States)

    2010-10-01

    ... services directory. 42.203 Section 42.203 Federal Acquisition Regulations System FEDERAL ACQUISITION....203 Contract administration services directory. The Defense Contract Management Agency (DCMA) maintains the Federal Directory of Contract Administration Services Components. The directory lists the...

  1. 40 CFR 6.203 - Public participation.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Public participation. 6.203 Section 6... Environmental Review Procedures § 6.203 Public participation. (a) General requirements. (1) The procedures in... and 1506.6 and applicable EPA public participation regulations (e.g., 40 CFR Part 25). (3) EPA NEPA...

  2. 33 CFR 203.62 - Drought assistance.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Drought assistance. 203.62... Supplies: Contaminated Water Sources and Drought Assistance § 203.62 Drought assistance. (a) Authority. The... political subdivisions, within areas determined to be drought-distressed. (b) General policy. (1) It is a...

  3. 7 CFR 1726.203 - Multiparty negotiation.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Multiparty negotiation. 1726.203 Section 1726.203... negotiation. Multiparty negotiation may only be used where permitted under subpart F of this part or where... negotiation: (a) Selection of qualified bidders. The borrower (acting through its engineer, if applicable...

  4. 32 CFR 700.203 - Composition.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Composition. 700.203 Section 700.203 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY UNITED STATES NAVY REGULATIONS AND... Composition. (a) The Department of the Navy is separately organized under the Secretary of the Navy. It...

  5. 28 CFR 36.203 - Integrated settings.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Integrated settings. 36.203 Section 36... PUBLIC ACCOMMODATIONS AND IN COMMERCIAL FACILITIES General Requirements § 36.203 Integrated settings. (a... accommodations to an individual with a disability in the most integrated setting appropriate to the needs of the...

  6. 34 CFR 682.203 - Responsible parties.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false Responsible parties. 682.203 Section 682.203 Education... parties. (a) Delegation of functions. A school, lender, or guaranty agency may contract or otherwise delegate the performance of its functions under the Act and this part to a servicing agency or other party...

  7. 5 CFR 470.203 - Eligible parties.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Eligible parties. 470.203 Section 470.203 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERSONNEL MANAGEMENT RESEARCH... Eligible parties. Research may be conducted by the Office of Personnel Management, or under contract or...

  8. 24 CFR 203.616 - Mortgage modification.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage modification. 203.616... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Servicing Responsibilities Mortgagee Action and Forbearance § 203.616...

  9. 24 CFR 203.17 - Mortgage provisions.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage provisions. 203.17 Section... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Eligibility Requirements and Underwriting Procedures Eligible Mortgages § 203...

  10. 24 CFR 203.342 - Mortgage modification.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage modification. 203.342... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Continuation of Insurance § 203.342...

  11. 48 CFR 50.203 - General.

    Science.gov (United States)

    2010-10-01

    ... management protections for sellers of QATTs and others in the supply and distribution chain. (b) The SAFETY... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false General. 50.203 Section 50.203 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT MANAGEMENT...

  12. 41 CFR 50-203.5 - Intervention.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Intervention. 50-203.5...-Healey Public Contracts Act § 50-203.5 Intervention. Any employer, employee, labor or trade organization... the grounds of the proposed intervention. The Chief administrative law judge, or the administrative...

  13. 41 CFR 50-203.11 - Review.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Review. 50-203.11 Section...-Healey Public Contracts Act § 50-203.11 Review. (a) Within twenty (20) days after service of the decision... administrative law judge an original and four copies of a petition for review of the decision. The petition shall...

  14. 24 CFR 203.672 - Residential areas.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Residential areas. 203.672 Section... FAMILY MORTGAGE INSURANCE Servicing Responsibilities Occupied Conveyance § 203.672 Residential areas. (a) For the purposes of occupied conveyance considerations, a residential area is any area which...

  15. 7 CFR 765.203 - Protective advances.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Protective advances. 765.203 Section 765.203 Agriculture Regulations of the Department of Agriculture (Continued) FARM SERVICE AGENCY, DEPARTMENT OF... Protective advances. When necessary to protect the Agency's security interest, costs incurred for the...

  16. 24 CFR 203.258 - Substitute mortgagors.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Substitute mortgagors. 203.258... § 203.258 Substitute mortgagors. (a) Selling mortgagor. Except as provided in paragraph (d) of this..., only if it obtains the Commissioner's approval of a substitute mortgagor, as provided by this section...

  17. 12 CFR 268.203 - Rehabilitation Act.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Rehabilitation Act. 268.203 Section 268.203... Rehabilitation Act. (a) Model employer. The Board shall be a model employer of individuals with disabilities. The... Rehabilitation Act of 1973, as amended (29 U.S.C. 791), has been violated in a complaint alleging nonaffirmative...

  18. 37 CFR 203.3 - Organization.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Organization. 203.3 Section... PROCEDURES FREEDOM OF INFORMATION ACT: POLICIES AND PROCEDURES Organization § 203.3 Organization. (a) In... legislative and policy matters. (e) The Office has no field organization. (f) The Office is located in The...

  19. 32 CFR 203.19 - Appeals process.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Appeals process. 203.19 Section 203.19 National....19 Appeals process. DoD Components will establish an appeals process to settle potential disputes... process. The Department of Defense recognizes that the RAB/TRC may disagree with the findings of the...

  20. 40 CFR 86.203-94 - Abbreviations.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Abbreviations. 86.203-94 Section 86.203-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...

  1. 27 CFR 24.203 - Honey wine.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Honey wine. 24.203 Section... THE TREASURY LIQUORS WINE Production of Agricultural Wine § 24.203 Honey wine. (a) Subject to paragraph (b) of this section, a winemaker, in the production of wine from honey, may add the following: (1...

  2. 24 CFR 203.443 - Insurance premium.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance premium. 203.443 Section... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Rehabilitation Loans § 203.443 Insurance...

  3. 31 CFR 203.1 - Scope.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Scope. 203.1 Section 203.1 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE PAYMENT OF FEDERAL TAXES AND THE TREASURY TAX AND LOAN PROGRAM...

  4. 31 CFR 203.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Definitions. 203.2 Section 203.2 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE... bank, savings bank, savings association, credit union, or similar institution. Fiscal agent means the...

  5. 31 CFR 203.17 - Collector depositaries.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Collector depositaries. 203.17 Section 203.17 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE PAYMENT OF FEDERAL TAXES AND THE TREASURY...

  6. 5 CFR 9701.203 - Waivers.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Waivers. 9701.203 Section 9701.203 Administrative Personnel DEPARTMENT OF HOMELAND SECURITY HUMAN RESOURCES MANAGEMENT SYSTEM (DEPARTMENT OF HOMELAND SECURITY-OFFICE OF PERSONNEL MANAGEMENT) DEPARTMENT OF HOMELAND SECURITY HUMAN RESOURCES...

  7. 48 CFR 1631.203 - Indirect costs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Indirect costs. 1631.203 Section 1631.203 Federal Acquisition Regulations System OFFICE OF PERSONNEL MANAGEMENT FEDERAL EMPLOYEES HEALTH BENEFITS ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT COST PRINCIPLES AND PROCEDURES Contracts With Commercial...

  8. 48 CFR 5416.203-1 - Description.

    Science.gov (United States)

    2010-10-01

    ... Section 5416.203-1 Federal Acquisition Regulations System DEFENSE LOGISTICS AGENCY, DEPARTMENT OF DEFENSE TYPES OF CONTRACTS Fixed Price Contracts 5416.203-1 Description. (a)(S-90) Adjustments based on established prices. Established prices may reflect industry-wide and/or geographically based market price...

  9. 30 CFR 203.49 - May I substitute the deep gas drilling provisions in § 203.0 and §§ 203.40 through 203.47 for the...

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false May I substitute the deep gas drilling provisions in § 203.0 and §§ 203.40 through 203.47 for the deep gas royalty relief provided in my lease... substitute the deep gas drilling provisions in § 203.0 and §§ 203.40 through 203.47 for the deep gas royalty...

  10. 48 CFR 203.1003 - Requirements.

    Science.gov (United States)

    2010-10-01

    ... OF DEFENSE GENERAL IMPROPER BUSINESS PRACTICES AND PERSONAL CONFLICTS OF INTEREST Contractor Code of Business Ethics and Conduct 203.1003 Requirements. (b) Notification of possible contractor violation. Upon...

  11. Dicty_cDB: CHS203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHS203 (Link to dictyBase) - - - Contig-U11332-1 - (Link to Or...iginal site) - - CHS203Z 727 - - - - Show CHS203 Library CH (Link to library) Clone ID CHS203 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11332-1 Original site URL http://dictycdb.b...LSYDILSLLDS HLWLKKPLTISPQFLTMIGPELDPTLPNNPFKEFFNKLGTSSHDSGDNIDFKIPSFFEDN SRRHWGVETELSTGSCPICTLSLAENPESSFLGST...SYDILSLLDS HLWLKKPLTISPQFLTMIGPELDPTLPNNPFKEFFNKLGTSSHDSGDNIDFKIPSFFEDN SRRHWGVETELSTGSCPICTLSLAENPESSFLGSTP

  12. 48 CFR 1815.203-72 - Risk management.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Risk management. 1815.203-72 Section 1815.203-72 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND SPACE... Proposals and Information 1815.203-72 Risk management. In all RFPs and RFOs for supplies or services for...

  13. 30 CFR 203.53 - What relief will MMS grant?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What relief will MMS grant? 203.53 Section 203...-Life Leases § 203.53 What relief will MMS grant? (a) If we approve your application and you meet certain conditions, we will reduce the pre-application effective royalty rate by one-half on production up...

  14. 7 CFR 3565.203 - Restrictions on rents.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Restrictions on rents. 3565.203 Section 3565.203... AGRICULTURE GUARANTEED RURAL RENTAL HOUSING PROGRAM Loan Requirements § 3565.203 Restrictions on rents. The rent for any individual housing unit, including any tenant-paid utilities, must not exceed an amount...

  15. 24 CFR 203.44 - Eligibility of advances.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Eligibility of advances. 203.44 Section 203.44 Housing and Urban Development Regulations Relating to Housing and Urban Development... § 203.44 Eligibility of advances. Mortgagees may not make open-end advances under section 225 of the...

  16. 22 CFR 203.10 - Termination of registration.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Termination of registration. 203.10 Section 203.10 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT REGISTRATION OF PRIVATE VOLUNTARY ORGANIZATIONS (PVOs) § 203.10 Termination of registration. (a) Reasons. USAID may terminate registration for any...

  17. 22 CFR 203.9 - Denial of registration.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Denial of registration. 203.9 Section 203.9 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT REGISTRATION OF PRIVATE VOLUNTARY ORGANIZATIONS (PVOs) § 203.9 Denial of registration. (a) Notification of denial of registration. Denial of...

  18. 48 CFR 570.203-1 - Market survey.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Market survey. 570.203-1 Section 570.203-1 Federal Acquisition Regulations System GENERAL SERVICES ADMINISTRATION SPECIAL... 570.203-1 Market survey. Conduct a market survey to identify potential sources. Use information...

  19. 21 CFR 203.70 - Application for a reward.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Application for a reward. 203.70 Section 203.70...: GENERAL PRESCRIPTION DRUG MARKETING Rewards § 203.70 Application for a reward. (a) Reward for providing... not more than $125,000. (b) Procedure for making application for a reward for providing information...

  20. 12 CFR 203.4 - Compilation of loan data.

    Science.gov (United States)

    2010-01-01

    ... may but need not be collected for loans purchased by the financial institution. (c) Optional data. A... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Compilation of loan data. 203.4 Section 203.4... DISCLOSURE (REGULATION C) § 203.4 Compilation of loan data. (a) Data format and itemization. A financial...

  1. 48 CFR 1837.203 - Policy. (NASA supplements paragraph (c))

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Policy. (NASA supplements paragraph (c)) 1837.203 Section 1837.203 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND... Services 1837.203 Policy. (NASA supplements paragraph (c)) (c) Advisory and assistance services of...

  2. 46 CFR 308.203 - Amount insured under interim binder.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Amount insured under interim binder. 308.203 Section 308.203 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION EMERGENCY OPERATIONS WAR RISK INSURANCE War Risk Protection and Indemnity Insurance § 308.203 Amount insured under interim binder. The...

  3. 48 CFR 916.203-4 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 916.203-4 Section 916.203-4 Federal Acquisition Regulations System DEPARTMENT OF ENERGY CONTRACTING METHODS AND CONTRACT TYPES TYPES OF CONTRACTS Fixed-Price Contracts 916.203-4 Contract clauses. (d)(2) The...

  4. 48 CFR 1416.203-4 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 1416.203-4 Section 1416.203-4 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR CONTRACTING METHODS AND CONTRACT TYPES TYPES OF CONTRACTS Fixed-Price Contracts 1416.203-4 Contract clauses. An...

  5. 24 CFR 203.18a - Solar energy system.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Solar energy system. 203.18a... § 203.18a Solar energy system. (a) The dollar limitation provided in § 203.18(a) may be increased by up... to the installation of a solar energy system. (b) Solar energy system is defined as any addition...

  6. 20 CFR 203.6 - Age, citizenship, and other factors.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Age, citizenship, and other factors. 203.6 Section 203.6 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT EMPLOYEES UNDER THE ACT § 203.6 Age, citizenship, and other factors. The age, citizenship, or residence of...

  7. 48 CFR 9.203 - QPL's, QML's, and QBL's.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false QPL's, QML's, and QBL's. 9.203 Section 9.203 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION ACQUISITION PLANNING CONTRACTOR QUALIFICATIONS Qualifications Requirements 9.203 QPL's, QML's, and QBL's. (a...

  8. 21 CFR 333.203 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... USE TOPICAL ANTIMICROBIAL DRUG PRODUCTS FOR OVER-THE-COUNTER HUMAN USE Topical Antifungal Drug Products § 333.203 Definitions. As used in this subpart: (a) Antifungal. A drug which inhibits the growth... dermatophytes, yeasts, and molds, characterized by a simple cell structure and the absence of chlorophyll. (e...

  9. 48 CFR 11.203 - Customer satisfaction.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Customer satisfaction. 11... PLANNING DESCRIBING AGENCY NEEDS Using and Maintaining Requirements Documents 11.203 Customer satisfaction. Acquisition organizations shall communicate with customers to determine how well the requirements document...

  10. 50 CFR 216.203 - Prohibitions.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Construction and Operation of Offshore Oil and Gas Facilities in the U.S. Beaufort Sea § 216.203 Prohibitions. Notwithstanding takings contemplated in § 216.200 and...

  11. 42 CFR 59.203 - Eligibility.

    Science.gov (United States)

    2010-10-01

    ... planning or other health services delivery personnel in the skills, knowledge, and attitudes necessary for... PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR FAMILY PLANNING SERVICES Grants for Family Planning Service Training § 59.203 Eligibility. (a) Eligible applicants. Any public or...

  12. The Political Spectacle of Arizona's Proposition 203

    Science.gov (United States)

    Wright, Wayne E.

    2005-01-01

    Arizona's Proposition 203 places restrictions on bilingual and English-as-a-second-language programs and essentiality mandates English-only education for English language learners (ELLs). This article provides an analysis of this initiative and the wide variations in its interpretation and implementation. Data sources include official policy and…

  13. 5 CFR 2606.203 - Granting access.

    Science.gov (United States)

    2010-01-01

    ....203 Administrative Personnel OFFICE OF GOVERNMENT ETHICS ORGANIZATION AND PROCEDURES PRIVACY ACT RULES... official having operational control over the record, have their identity verified by visual observation. If... identity by a comparison of signatures in situations where the data in the record is not so sensitive that...

  14. 5 CFR 351.203 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Provisions § 351.203 Definitions. In this part: Competing employee means an employee in tenure group I, II, or III. Current rating of record is the rating of record for the most recently completed appraisal... it is performed. Furlough under this part means the placement of an employee in a temporary nonduty...

  15. 5 CFR 430.203 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Performance Appraisal for General Schedule, Prevailing Rate, and Certain Other Employees § 430.203 Definitions... plans, and other means of expressing expected performance. Appraisal means the process under which performance is reviewed and evaluated. Appraisal period means the established period of time for which...

  16. 31 CFR 560.203 - Evasions; attempts.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Evasions; attempts. 560.203 Section... Evasions; attempts. Any transaction by any United States person or within the United States that evades or avoids, or has the purpose of evading or avoiding, or attempts to violate, any of the prohibitions...

  17. 21 CFR 203.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... PRESCRIPTION DRUG MARKETING General Provisions § 203.3 Definitions. (a) The act means the Federal Food, Drug..., data, audio, pictorial, or other information representation in digital form that is created, modified... same marketing or service area, or nearby licensed practitioners, of drugs for use in the treatment of...

  18. 5 CFR 550.203 - Advances in pay.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Advances in pay. 550.203 Section 550.203...) Advances in Pay § 550.203 Advances in pay. (a) The head of an agency may provide for the advance payment of... appointed to a position in the agency. (b) The maximum amount of pay that may be advanced to an employee...

  19. 20 CFR 633.203 - Review of funding request.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Review of funding request. 633.203 Section 633.203 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR MIGRANT AND... respect to financial management, audit and program outcomes. ...

  20. 29 CFR 541.203 - Administrative exemption examples.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Administrative exemption examples. 541.203 Section 541.203 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS... productivity improvements) generally meets the duties requirements for the administrative exemption, even if...

  1. 24 CFR 100.203 - Reasonable modifications of existing premises.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Reasonable modifications of existing premises. 100.203 Section 100.203 Housing and Urban Development Regulations Relating to Housing and Urban Development OFFICE OF ASSISTANT SECRETARY FOR EQUAL OPPORTUNITY, DEPARTMENT OF HOUSING AND...

  2. 24 CFR 203.600 - Mortgage collection action.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage collection action. 203.600... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Servicing Responsibilities Mortgagee Action and Forbearance § 203.600...

  3. 24 CFR 203.316 - Termination by prepayment of mortgage.

    Science.gov (United States)

    2010-04-01

    ... mortgage. 203.316 Section 203.316 Housing and Urban Development Regulations Relating to Housing and Urban... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Termination of Insurance Contract...

  4. 24 CFR 203.500 - Mortgage servicing generally.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage servicing generally. 203... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Servicing Responsibilities General Requirements § 203.500...

  5. 24 CFR 203.49 - Eligibility of adjustable rate mortgages.

    Science.gov (United States)

    2010-04-01

    ... mortgages. 203.49 Section 203.49 Housing and Urban Development Regulations Relating to Housing and Urban... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Eligibility Requirements and Underwriting Procedures Eligible...

  6. 24 CFR 203.43 - Eligibility of miscellaneous type mortgages.

    Science.gov (United States)

    2010-04-01

    ... mortgages. 203.43 Section 203.43 Housing and Urban Development Regulations Relating to Housing and Urban... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Eligibility Requirements and Underwriting Procedures Eligible...

  7. 24 CFR 203.47 - Eligibility of growing equity mortgages.

    Science.gov (United States)

    2010-04-01

    ... mortgages. 203.47 Section 203.47 Housing and Urban Development Regulations Relating to Housing and Urban... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Eligibility Requirements and Underwriting Procedures Eligible...

  8. 24 CFR 203.350 - Assignment of mortgage.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Assignment of mortgage. 203.350... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Assignment of Mortgage § 203.350...

  9. 24 CFR 203.45 - Eligibility of graduated payment mortgages.

    Science.gov (United States)

    2010-04-01

    ... mortgages. 203.45 Section 203.45 Housing and Urban Development Regulations Relating to Housing and Urban... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Eligibility Requirements and Underwriting Procedures Eligible...

  10. 48 CFR 352.203-70 - Anti-lobbying.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Anti-lobbying. 352.203-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 352.203-70 Anti-lobbying. As prescribed in 303.808-70, the Contracting Officer shall insert the following clause: Anti-Lobbying (January...

  11. 18 CFR 281.203 - Definitions and cross references.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Definitions and cross references. 281.203 Section 281.203 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY... of supply shortage natural gas deliveries will be curtailed based at least in part upon factors which...

  12. 49 CFR 1540.203 - Security threat assessment.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Security threat assessment. 1540.203 Section 1540.203 Transportation Other Regulations Relating to Transportation (Continued) TRANSPORTATION SECURITY ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY CIVIL AVIATION SECURITY: GENERAL RULES...

  13. 24 CFR 203.27 - Charges, fees or discounts.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Charges, fees or discounts. 203.27... § 203.27 Charges, fees or discounts. (a) The mortgagee may collect from the mortgagor the following charges, fees or discounts: (1) (2) A charge to compensate the mortgagee for expenses incurred in...

  14. 24 CFR 203.5 - Direct Endorsement process.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Direct Endorsement process. 203.5... SINGLE FAMILY MORTGAGE INSURANCE Eligibility Requirements and Underwriting Procedures Direct Endorsement, Lender Insurance, and Commitments § 203.5 Direct Endorsement process. (a) General. Under the Direct...

  15. 31 CFR 203.12 - EFTPS interest assessments.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false EFTPS interest assessments. 203.12 Section 203.12 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL... paragraph does not apply to any interest assessment in which there is an indication of fraud, the...

  16. 48 CFR 26.203 - Transition of work.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Transition of work. 26.203... PROGRAMS OTHER SOCIOECONOMIC PROGRAMS Disaster or Emergency Assistance Activities 26.203 Transition of work... emergency response work to local firms (e.g., unnecessarily broad scopes of work or long periods of...

  17. 48 CFR 1326.203 - Transition of work.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Transition of work. 1326.203 Section 1326.203 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE SOCIOECONOMIC... work. The designee authorized to determine that transitioning response, relief, and/or reconstruction...

  18. 24 CFR 203.434 - Declaration of trust.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Declaration of trust. 203.434... Mortgage § 203.434 Declaration of trust. A sale of a beneficial interest in a group of insured mortgages... interest in a specific mortgage shall be made only pursuant to a declaration of trust, which has been...

  19. 40 CFR 203.5 - Suitable substitute decision.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Suitable substitute decision. 203.5... PROGRAMS LOW-NOISE-EMISSION PRODUCTS § 203.5 Suitable substitute decision. (a) If the Administrator... decide whether such product is a suitable substitute for any class or model or product being purchased by...

  20. 44 CFR 206.203 - Federal grant assistance.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Federal grant assistance. 206.203 Section 206.203 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY...) Improved projects. If a subgrantee desires to make improvements, but still restore the predisaster function...

  1. 49 CFR 238.203 - Static end strength.

    Science.gov (United States)

    2010-10-01

    ... describe the likely performance of the static end strength of the equipment and the likely performance of the equipment in derailment and collision scenarios pertinent to the equipment's static end strength... 49 Transportation 4 2010-10-01 2010-10-01 false Static end strength. 238.203 Section 238.203...

  2. 24 CFR 203.50 - Eligibility of rehabilitation loans.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Eligibility of rehabilitation loans... Properties § 203.50 Eligibility of rehabilitation loans. A rehabilitation loan which meets the requirements... 203(k) of the National Housing Act. (a) For the purpose of this section: (1) The term rehabilitation...

  3. 49 CFR 384.203 - Driving while under the influence.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Driving while under the influence. 384.203 Section... § 384.203 Driving while under the influence. (a) The State must have in effect and enforce through... apply its criminal or other sanctions for driving under the influence to a person found to have operated...

  4. 24 CFR 203.20 - Agreed interest rate.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Agreed interest rate. 203.20... § 203.20 Agreed interest rate. (a) The mortgage shall bear interest at the rate agreed upon by the mortgagee and the mortgagor. (b) Interest shall be payable in monthly installments on the principal amount...

  5. 46 CFR 16.203 - Employer, MRO, and SAP responsibilities.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Employer, MRO, and SAP responsibilities. 16.203 Section... CHEMICAL TESTING Required Chemical Testing § 16.203 Employer, MRO, and SAP responsibilities. (a) Employers...) Substance Abuse Professional (SAP). Individuals performing SAP functions must meet the training requirements...

  6. 20 CFR 801.203 - Disqualification of Board Members.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Disqualification of Board Members. 801.203... OF THE BOARD Members of the Board § 801.203 Disqualification of Board Members. (a) During the period in which the Chairman or the other members serve on the Board, they shall be subject to the...

  7. 31 CFR 203.14 - Scope of the subpart.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Scope of the subpart. 203.14 Section 203.14 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE PAYMENT OF FEDERAL TAXES AND THE TREASURY...

  8. 31 CFR 203.13 - Appeal and dispute resolution.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Appeal and dispute resolution. 203.13 Section 203.13 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL... Fiscal agent identified in the procedural instructions, no later than 90 calendar days after the date the...

  9. 31 CFR 203.9 - Scope of the subpart.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Scope of the subpart. 203.9 Section 203.9 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE PAYMENT OF FEDERAL TAXES AND THE TREASURY TAX AND...

  10. 31 CFR 203.16 - Retainer and investor depositaries.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Retainer and investor depositaries. 203.16 Section 203.16 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE PAYMENT OF FEDERAL TAXES AND THE...

  11. 31 CFR 203.15 - Tax deposits using FTD coupons.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Tax deposits using FTD coupons. 203.15 Section 203.15 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE PAYMENT OF FEDERAL TAXES AND THE...

  12. 31 CFR 203.10 - Electronic payment methods.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Electronic payment methods. 203.10 Section 203.10 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE PAYMENT OF FEDERAL TAXES AND THE TREASURY...

  13. 31 CFR 203.3 - TT&L depositaries.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false TT&L depositaries. 203.3 Section 203.3 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE PAYMENT OF FEDERAL TAXES AND THE TREASURY TAX AND...

  14. 25 CFR 161.203 - Are range management plans required?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Are range management plans required? 161.203 Section 161... LANDS GRAZING PERMITS General Provisions § 161.203 Are range management plans required? Yes. BIA will... range restoration activities for the Navajo Partitioned Lands. (b) Develop range management plans with...

  15. 5 CFR 950.203 - Public accountability standards.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Public accountability standards. 950.203... PRIVATE VOLUNTARY ORGANIZATIONS Eligibility Provisions § 950.203 Public accountability standards. (a) To... comply with the requirements of public accountability, and the charitable organization may be ruled...

  16. 10 CFR 63.203 - Implementation of Subpart K.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Implementation of Subpart K. 63.203 Section 63.203 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN A GEOLOGIC... Implementation of Subpart K. DOE must demonstrate that normal operations at the Yucca Mountain site will and do...

  17. XM203 40mm Grenade Launcher Attachment Development

    Science.gov (United States)

    The Army Concept Team in Vietnam evaluated the XM203 40mm Grenade Launcher Attachment Development to determine its suitability for tactical use by US...Army units in RVN. The XM203 was designed to provide the rifle squad’s grenadier with a weapon incorporating an M16 rifle and a grenade launcher.

  18. 41 CFR 109-38.203 - Agency identification.

    Science.gov (United States)

    2010-07-01

    ... Administrative Services, Logistics Management Division, Headquarters, using DOE Form 4250.2, “Requisition for... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Agency identification. 109-38.203 Section 109-38.203 Public Contracts and Property Management Federal Property Management...

  19. Draft genome sequence of the Coccolithovirus Emiliania huxleyi virus 203.

    Science.gov (United States)

    Nissimov, Jozef I; Worthy, Charlotte A; Rooks, Paul; Napier, Johnathan A; Kimmance, Susan A; Henn, Matthew R; Ogata, Hiroyuki; Allen, Michael J

    2011-12-01

    The Coccolithoviridae are a recently discovered group of viruses that infect the marine coccolithophorid Emiliania huxleyi. Emiliania huxleyi virus 203 (EhV-203) has a 160- to 180-nm-diameter icosahedral structure and a genome of approximately 400 kbp, consisting of 464 coding sequences (CDSs). Here we describe the genomic features of EhV-203 together with a draft genome sequence and its annotation, highlighting the homology and heterogeneity of this genome in comparison with the EhV-86 reference genome.

  20. Draft Genome Sequence of the Coccolithovirus Emiliania huxleyi Virus 203

    OpenAIRE

    Nissimov, Jozef I.; Worthy, Charlotte A.; Rooks, Paul; Napier, Johnathan A.; Kimmance, Susan A.; Henn, Matthew R.; Ogata, Hiroyuki; Allen, Michael J.

    2011-01-01

    The Coccolithoviridae are a recently discovered group of viruses that infect the marine coccolithophorid Emiliania huxleyi. Emiliania huxleyi virus 203 (EhV-203) has a 160- to 180-nm-diameter icosahedral structure and a genome of approximately 400 kbp, consisting of 464 coding sequences (CDSs). Here we describe the genomic features of EhV-203 together with a draft genome sequence and its annotation, highlighting the homology and heterogeneity of this genome in comparison with the EhV-86 refer...

  1. 24 CFR 203.3 - Approval of mortgagees for Direct Endorsement.

    Science.gov (United States)

    2010-04-01

    ... Endorsement. 203.3 Section 203.3 Housing and Urban Development Regulations Relating to Housing and Urban... Endorsement, Lender Insurance, and Commitments § 203.3 Approval of mortgagees for Direct Endorsement. (a) Direct Endorsement approval. To be approved for the Direct Endorsement program set forth in § 203.5, a...

  2. 5 CFR 319.203 - Establishment of positions.

    Science.gov (United States)

    2010-01-01

    ... Section 319.203 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS EMPLOYMENT IN SENIOR-LEVEL AND SCIENTIFIC AND PROFESSIONAL POSITIONS Position Allocations and Establishment..., consistent with published position classification standards and guides and accepted classification principles...

  3. 40 CFR 94.203 - Application for certification.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) CONTROL OF EMISSIONS FROM MARINE COMPRESSION-IGNITION ENGINES Certification Provisions § 94.203... engine (e.g., used to propel planing vessels, use to propel vessels with variable-pitch propellers...

  4. Quantitation of lead-210 (210Pb) using lead-203 (203Pb) as a "Massless" yield tracer.

    Science.gov (United States)

    May, D; Nelson, A N; Schultz, M K

    2017-05-01

    Determination of Pb-210 (210Pb) in aqueous solution is a common radioanalytical challenge in environmental science. Widely used methods for undertaking these analyses (e.g., ASTM D7535) rely on the use of stable lead (Pb) as a yield tracer that takes into account losses of 210Pb that inevitably occur during elemental/radiochemical separations of the procedures. Although effective, these methods introduce technical challenges that can be difficult to track and potentially introduce uncertainty that can be difficult to quantify. Examples of these challenges include interference from endogenous stable Pb in complex sample matrices; contamination of stable Pb carrier with 210Pb; and high detection limits due to counting efficiency limitations. We hypothesized that many of these challenges could be avoided by the use of the electron-capture, gamma-emitting isotope, 203Pb as a chemical yield tracer in the analysis of 210Pb. A series of experiments were performed to evaluate the efficacy of 203Pb as a tracer. Four different matrices were analyzed, including a complex matrix (hydraulic-fracturing produced fluids); and samples comprising less complicated matrices (i.e., river water, deionized water, and tap water). Separation techniques and counting methodologies were also compared and optimized. Due to a relatively short-half life (52 h), 203Pb tracer is effectively massless for the purposes of chemical separations, allowing for reduced chromatography column resin bed volumes. Because 203Pb is a gamma emitter (279 keV; 81% intensity), recovery can be determined non-destructively in a variety of matrices, including liquid scintillation cocktail. The use of liquid scintillation as a counting methodology allowed for determination of 210Pb activities via 210Pb or 210Po; and recoveries of greater than 90% are routinely achievable using this approach. The improved method for the analysis of 210Pb in aqueous matrices allows for the analysis of complex matrices, at reduced cost

  5. Purification of cyclotron-produced {sup 203}Pb for labeling Herceptin

    Energy Technology Data Exchange (ETDEWEB)

    Garmestani, Kayhan [Radioimmune and Inorganic Chemistry Section, Radiation Oncology Branch, NCI, Bethesda, MD 20892-1002 (United States); Milenic, Diane E. [Radioimmune and Inorganic Chemistry Section, Radiation Oncology Branch, NCI, Bethesda, MD 20892-1002 (United States); Brady, Erik D. [Radioimmune and Inorganic Chemistry Section, Radiation Oncology Branch, NCI, Bethesda, MD 20892-1002 (United States); Plascjak, Paul S. [PET Department, Clinical Center, NIH, Bethesda, MD 20892-1002 (United States); Brechbiel, Martin W. [Radioimmune and Inorganic Chemistry Section, Radiation Oncology Branch, NCI, Bethesda, MD 20892-1002 (United States)]. E-mail: martinwb@mail.nih.gov

    2005-04-01

    A simple and rapid procedure was developed for the purification of cyclotron-produced {sup 203}Pb via the {sup 203}Tl(d,2n) {sup 203}Pb reaction. A Pb(II) selective ion-exchange resin, with commercial name Pb Resin from Eichrom Technologies, Inc., was used to purify {sup 203}Pb from the cyclotron-irradiated Tl target with excellent recovery of the enriched Tl target material. The purified {sup 203}Pb was used to radiolabel the monoclonal antibody Herceptin. The in vitro and in vivo properties of the {sup 203}Pb radioimmunoconjugate were evaluated.

  6. 75 FR 75693 - Rehabilitation Mortgage Insurance Underwriting Program Section 203(k); Notice of Proposed...

    Science.gov (United States)

    2010-12-06

    ... URBAN DEVELOPMENT Rehabilitation Mortgage Insurance Underwriting Program Section 203(k); Notice of... INFORMATION CONTACT: Arlene Nunes, Deputy Director, Home Mortgage Insurance Division, Office of Single Family... information: Title of Proposal: Rehabilitation Mortgage Insurance Underwriting Program Section 203(k). OMB...

  7. 21 CFR 82.203 - FD&C Green No. 3.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false FD&C Green No. 3. 82.203 Section 82.203 Food and... PROVISIONALLY LISTED COLORS AND SPECIFICATIONS Foods, Drugs, and Cosmetics § 82.203 FD&C Green No. 3. The color additive FD&C Green No. 3 shall conform in identity and specifications to the requirements of § 74.203(a)(1...

  8. 24 CFR 203.436 - Claim procedure-graduated payment mortgages.

    Science.gov (United States)

    2010-04-01

    ... mortgages. 203.436 Section 203.436 Housing and Urban Development Regulations Relating to Housing and Urban... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Graduated Payment Mortgages § 203...

  9. 13 CFR 106.203 - What provisions must be set forth in a Cosponsorship Agreement?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What provisions must be set forth in a Cosponsorship Agreement? 106.203 Section 106.203 Business Credit and Assistance SMALL BUSINESS... § 106.203 What provisions must be set forth in a Cosponsorship Agreement? While SBA may require...

  10. 18 CFR 382.203 - Annual charges under the Interstate Commerce Act.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Annual charges under the Interstate Commerce Act. 382.203 Section 382.203 Conservation of Power and Water Resources FEDERAL... § 382.203 Annual charges under the Interstate Commerce Act. (a) The adjusted costs of administration of...

  11. 7 CFR 160.203 - Fees for inspection and certification of other naval stores material.

    Science.gov (United States)

    2010-01-01

    ... stores material. 160.203 Section 160.203 Agriculture Regulations of the Department of Agriculture... AGRICULTURE (CONTINUED) NAVAL STORES REGULATIONS AND STANDARDS FOR NAVAL STORES Specific Fees Payable for Services Rendered § 160.203 Fees for inspection and certification of other naval stores material. Whenever...

  12. 48 CFR 627.203 - Patent indemnification of Government by contractor.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Patent indemnification of Government by contractor. 627.203 Section 627.203 Federal Acquisition Regulations System DEPARTMENT OF STATE GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Patents 627.203 Patent indemnification of...

  13. 77 FR 25781 - Twenty-First Meeting: RTCA Special Committee 203, Unmanned Aircraft Systems

    Science.gov (United States)

    2012-05-01

    ...: Meeting Notice of RTCA Special Committee 203, Unmanned Aircraft Systems. SUMMARY: The FAA is issuing this notice to advise the public of the twenty-first meeting of RTCA Special Committee 203, Unmanned Aircraft... Federal Aviation Administration Twenty-First Meeting: RTCA Special Committee 203, Unmanned Aircraft...

  14. 77 FR 50207 - Twenty-Second Meeting: RTCA Special Committee 203, Unmanned Aircraft Systems

    Science.gov (United States)

    2012-08-20

    ...: Meeting notice of RTCA Special Committee 203, Unmanned Aircraft Systems. SUMMARY: The FAA is issuing this notice to advise the public of the twenty-second meeting of RTCA Special Committee 203, Unmanned Aircraft... Federal Aviation Administration Twenty-Second Meeting: RTCA Special Committee 203, Unmanned Aircraft...

  15. 78 FR 6400 - Twenty Third Meeting: RTCA Special Committee 203, Unmanned Aircraft Systems

    Science.gov (United States)

    2013-01-30

    ...: Meeting Notice of RTCA Special Committee 203, Unmanned Aircraft Systems. SUMMARY: The FAA is issuing this notice to advise the public of the twenty third meeting of RTCA Special Committee 203, Unmanned Aircraft... Federal Aviation Administration Twenty Third Meeting: RTCA Special Committee 203, Unmanned Aircraft...

  16. 77 FR 3029 - Twentieth Meeting: RTCA Special Committee 203, Unmanned Aircraft Systems

    Science.gov (United States)

    2012-01-20

    ... Federal Aviation Administration Twentieth Meeting: RTCA Special Committee 203, Unmanned Aircraft Systems... RTCA Special Committee 203, Unmanned Aircraft Systems. SUMMARY: The FAA is issuing this notice to advise the public of the twentieth meeting of RTCA Special Committee 203, Unmanned Aircraft Systems...

  17. 14 CFR 1252.203 - Special benefits for children and the elderly.

    Science.gov (United States)

    2010-01-01

    ... elderly. 1252.203 Section 1252.203 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION... Determining Age Discrimination § 1252.203 Special benefits for children and the elderly. If a recipient operating a program or activity provides special benefits to the elderly or to children, such use of age...

  18. 20 CFR 703.203 - Application for security deposit determination; information to be submitted; other requirements.

    Science.gov (United States)

    2010-04-01

    ... determination; information to be submitted; other requirements. 703.203 Section 703.203 Employees' Benefits... AND RELATED STATUTES INSURANCE REGULATIONS Insurance Carrier Security Deposit Requirements § 703.203 Application for security deposit determination; information to be submitted; other requirements. (a) Each...

  19. 5 CFR 720.203 - Responsibilities of the Office of Personnel Management.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Responsibilities of the Office of Personnel Management. 720.203 Section 720.203 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) AFFIRMATIVE EMPLOYMENT PROGRAMS Federal Equal Opportunity Recruitment Program § 720.203 Responsibilities...

  20. 5 CFR 451.203 - Responsibilities of the Office of Personnel Management.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Responsibilities of the Office of Personnel Management. 451.203 Section 451.203 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS AWARDS Presidential Awards § 451.203 Responsibilities of the Office of Personnel Management. (a) The Office of Personnel...

  1. 5 CFR 582.203 - Information minimally required to accompany legal process.

    Science.gov (United States)

    2010-01-01

    ... accompany legal process. 582.203 Section 582.203 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS COMMERCIAL GARNISHMENT OF FEDERAL EMPLOYEES' PAY Service of Legal Process § 582.203 Information minimally required to accompany legal process. (a) Sufficient identifying...

  2. 5 CFR 581.203 - Information minimally required to accompany legal process.

    Science.gov (United States)

    2010-01-01

    ... accompany legal process. 581.203 Section 581.203 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROCESSING GARNISHMENT ORDERS FOR CHILD SUPPORT AND/OR ALIMONY Service of Process § 581.203 Information minimally required to accompany legal process. (a) Sufficient identifying...

  3. 21 CFR 203.32 - Drug sample storage and handling requirements.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drug sample storage and handling requirements. 203.32 Section 203.32 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL PRESCRIPTION DRUG MARKETING Samples § 203.32 Drug sample storage and...

  4. 31 CFR 800.203 - Committee; Chairperson of the Committee; Staff Chairperson.

    Science.gov (United States)

    2010-07-01

    ... PERTAINING TO MERGERS, ACQUISITIONS, AND TAKEOVERS BY FOREIGN PERSONS Definitions § 800.203 Committee... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Committee; Chairperson of the Committee; Staff Chairperson. 800.203 Section 800.203 Money and Finance: Treasury Regulations Relating to...

  5. 48 CFR 52.203-13 - Contractor Code of Business Ethics and Conduct.

    Science.gov (United States)

    2010-10-01

    ... Business Ethics and Conduct. 52.203-13 Section 52.203-13 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.203-13 Contractor Code of Business Ethics and Conduct. As prescribed in 3.1004(a), insert the following clause: Contractor Code of Business Ethics and Conduct (APR 2010) (a) Definitions...

  6. 24 CFR 203.466 - Definition of delinquency and requirement for notice of delinquency to HUD.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definition of delinquency and requirement for notice of delinquency to HUD. 203.466 Section 203.466 Housing and Urban Development... and Obligations Rehabilitation Loans § 203.466 Definition of delinquency and requirement for notice of...

  7. 24 CFR 203.330 - Definition of delinquency and requirement for notice of delinquency to HUD.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definition of delinquency and requirement for notice of delinquency to HUD. 203.330 Section 203.330 Housing and Urban Development... and Obligations Default Under Mortgage § 203.330 Definition of delinquency and requirement for notice...

  8. 24 CFR 203.420 - Nature of Mutual Mortgage Insurance Fund.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Nature of Mutual Mortgage Insurance Fund. 203.420 Section 203.420 Housing and Urban Development Regulations Relating to Housing and Urban... and Distributive Shares § 203.420 Nature of Mutual Mortgage Insurance Fund. The Mutual Mortgage...

  9. 48 CFR 18.203 - Emergency declaration or major disaster declaration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Emergency declaration or major disaster declaration. 18.203 Section 18.203 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Emergency Acquisition Flexibilities 18.203 Emergency declaration or...

  10. 24 CFR 203.35 - Disclosure and verification of Social Security and Employer Identification Numbers.

    Science.gov (United States)

    2010-04-01

    ... Social Security and Employer Identification Numbers. 203.35 Section 203.35 Housing and Urban Development... mortgagor must meet the requirements for the disclosure and verification of Social Security and Employer... Requirements and Underwriting Procedures Eligible Mortgagors § 203.35 Disclosure and verification of Social...

  11. 48 CFR 852.203-71 - Display of Department of Veterans Affairs hotline poster.

    Science.gov (United States)

    2010-10-01

    ... Veterans Affairs hotline poster. 852.203-71 Section 852.203-71 Federal Acquisition Regulations System... Provisions and Clauses 852.203-71 Display of Department of Veterans Affairs hotline poster. As prescribed in 803.7001, insert the following clause: Display of Department of Veterans Affairs Hotline Poster (DEC...

  12. 48 CFR 1552.203-71 - Display of EPA Office of Inspector General Hotline poster.

    Science.gov (United States)

    2010-10-01

    ... Inspector General Hotline poster. 1552.203-71 Section 1552.203-71 Federal Acquisition Regulations System... Provisions and Clauses 1552.203-71 Display of EPA Office of Inspector General Hotline poster. As prescribed... all contract options. Display of EPA Office of Inspector General Hotline Poster (AUG 2000) (a) For EPA...

  13. 27 CFR 41.203 - Retention of permit and supporting documents.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Retention of permit and supporting documents. 41.203 Section 41.203 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX..., CIGARETTE PAPERS AND TUBES, AND PROCESSED TOBACCO Tobacco Products Importers § 41.203 Retention of permit...

  14. 17 CFR 275.203A-4 - Investment advisers registered with a State securities commission.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Investment advisers registered with a State securities commission. 275.203A-4 Section 275.203A-4 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.203A-4 Investment advisers registered...

  15. 21 CFR 203.50 - Requirements for wholesale distribution of prescription drugs.

    Science.gov (United States)

    2010-04-01

    .... (b) The drug origin statement is subject to the record retention requirements of § 203.60 and must be... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Requirements for wholesale distribution of prescription drugs. 203.50 Section 203.50 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND...

  16. 48 CFR 252.203-7002 - Requirement to Inform Employees of Whistleblower Rights.

    Science.gov (United States)

    2010-10-01

    ... Employees of Whistleblower Rights. 252.203-7002 Section 252.203-7002 Federal Acquisition Regulations System... Whistleblower Rights. As prescribed in 203.970, use the following clause: Requirement To Inform Employees of Whistleblower Rights (JAN 2009) The Contractor shall inform its employees in writing of employee whistleblower...

  17. 33 CFR 203.47 - Modifications to non-Federal flood control works.

    Science.gov (United States)

    2010-07-01

    ... flood control works. 203.47 Section 203.47 Navigation and Navigable Waters CORPS OF ENGINEERS... DISASTER PROCEDURES Rehabilitation Assistance for Flood Control Works Damaged by Flood or Coastal Storm: The Corps Rehabilitation and Inspection Program § 203.47 Modifications to non-Federal flood control...

  18. 33 CFR 203.48 - Inspection guidelines for non-Federal flood control works.

    Science.gov (United States)

    2010-07-01

    ...-Federal flood control works. 203.48 Section 203.48 Navigation and Navigable Waters CORPS OF ENGINEERS... DISASTER PROCEDURES Rehabilitation Assistance for Flood Control Works Damaged by Flood or Coastal Storm: The Corps Rehabilitation and Inspection Program § 203.48 Inspection guidelines for non-Federal flood...

  19. 24 CFR 203.345 - Postponement of principal payments-mortgagors in military service.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Postponement of principal payments-mortgagors in military service. 203.345 Section 203.345 Housing and Urban Development Regulations Relating to... Forbearance Relief for Military Personnel § 203.345 Postponement of principal payments—mortgagors in military...

  20. 48 CFR 14.203-2 - Dissemination of information concerning invitations for bids.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Dissemination of information concerning invitations for bids. 14.203-2 Section 14.203-2 Federal Acquisition Regulations System... 14.203-2 Dissemination of information concerning invitations for bids. Procedures concerning display...

  1. 47 CFR 54.203 - Designation of eligible telecommunications carriers for unserved areas.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Designation of eligible telecommunications carriers for unserved areas. 54.203 Section 54.203 Telecommunication FEDERAL COMMUNICATIONS COMMISSION... Support § 54.203 Designation of eligible telecommunications carriers for unserved areas. (a) If no common...

  2. 24 CFR 203.43e - Eligibility of mortgages covering houses in federally impacted areas.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Eligibility of mortgages covering houses in federally impacted areas. 203.43e Section 203.43e Housing and Urban Development Regulations... Requirements and Underwriting Procedures Eligible Properties § 203.43e Eligibility of mortgages covering houses...

  3. 48 CFR 1852.203-70 - Display of Inspector General Hotline Posters.

    Science.gov (United States)

    2010-10-01

    ... General Hotline Posters. 1852.203-70 Section 1852.203-70 Federal Acquisition Regulations System NATIONAL... Provisions and Clauses 1852.203-70 Display of Inspector General Hotline Posters. As prescribed in 1803.7001, insert the following clause: Display of Inspector General Hotline Posters (JUN 2001) (a) The Contractor...

  4. 48 CFR 1652.203-70 - Misleading, deceptive, or unfair advertising.

    Science.gov (United States)

    2010-10-01

    ... unfair advertising. 1652.203-70 Section 1652.203-70 Federal Acquisition Regulations System OFFICE OF... CLAUSES Texts of FEHBP Clauses 1652.203-70 Misleading, deceptive, or unfair advertising. As prescribed in... Unfair Advertising (JAN 1991) (a) The Carrier agrees that any advertising material, including that...

  5. 31 CFR 203.18 - Scope of the subpart.

    Science.gov (United States)

    2010-07-01

    ... TAX AND LOAN PROGRAM Investment Program and Collateral Security Requirements for TT&L Depositaries § 203.18 Scope of the subpart. This subpart governs the operation of the investment program, including the rules that TT&L depositaries must follow in crediting and debiting TIP main account balances, SDI...

  6. 5 CFR 2634.203 - Persons excluded by rule.

    Science.gov (United States)

    2010-01-01

    ... FINANCIAL DISCLOSURE, QUALIFIED TRUSTS, AND CERTIFICATES OF DIVESTITURE Persons Required To File Public Financial Disclosure Reports § 2634.203 Persons excluded by rule. (a) In general. Any individual or group of... not affect adversely the integrity of the Government or the public's confidence in the integrity of...

  7. 9 CFR 113.203 - Feline Panleukopenia Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... production. All serials of vaccine shall be prepared from the first through the fifth passage from the Master... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Feline Panleukopenia Vaccine, Killed... REQUIREMENTS Killed Virus Vaccines § 113.203 Feline Panleukopenia Vaccine, Killed Virus. Feline Panleukopenia...

  8. 31 CFR 203.20 - Investment account requirements.

    Science.gov (United States)

    2010-07-01

    ... collector depositaries that accept term investments, investor depositaries, or retainer depositaries. Such... § 203.16(a) for an investor or retainer depositary processing tax deposits through PATAX. (2) EFTPS—(i... day such entries settle. (ii) Fedwire ® value and non-value transactions. The TSC will credit a...

  9. 10 CFR 830.203 - Unreviewed safety question process.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Unreviewed safety question process. 830.203 Section 830... Unreviewed safety question process. (a) The contractor responsible for a hazard category 1, 2, or 3 DOE... a procedure for its USQ process on a schedule that allows DOE approval in a safety evaluation report...

  10. 24 CFR 1003.203 - Special economic development activities.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Special economic development... Eligible Activities § 1003.203 Special economic development activities. A grantee may use ICDBG funds for special economic development activities in addition to other activities authorized in this subpart which...

  11. 24 CFR 570.203 - Special economic development activities.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Special economic development... § 570.203 Special economic development activities. A recipient may use CDBG funds for special economic... part of an economic development project. Guidelines for selecting activities to assist under this...

  12. 24 CFR 203.18 - Maximum mortgage amounts.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Maximum mortgage amounts. 203.18... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Eligibility Requirements and Underwriting Procedures Eligible Mortgages...

  13. 24 CFR 203.18b - Increased mortgage amount.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Increased mortgage amount. 203.18b... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Eligibility Requirements and Underwriting Procedures Eligible Mortgages...

  14. 24 CFR 203.333 - Reinstatement of defaulted mortgage.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Reinstatement of defaulted mortgage... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Default Under Mortgage § 203.333...

  15. 24 CFR 203.255 - Insurance of mortgage.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance of mortgage. 203.255... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Endorsement and Contract of Insurance...

  16. 24 CFR 203.415 - Delivery of certificate of claim.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Delivery of certificate of claim... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Certificate of Claim § 203.415...

  17. Cluster (Cyanobacteria): 1160286:203 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 1160286:203 Tyrocidine synthase 3 (Includes: ATP-dependent asparagine adenylase ; ATP-dependent... glutamine adenylase ; ATP-dependent tyrosine adenylase ; ATP-dependent valine adenylase ; ATP-dependent... ornithine adenylase ; ATP-dependent leucine adenylase) (fragment) 1126:871 ...

  18. 24 CFR 203.366 - Conveyance of marketable title.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Conveyance of marketable title. 203... Conveyance of marketable title. (a) Satisfactory conveyance of title and transfer of possession. The mortgagee shall tender to the Commissioner a satisfactory conveyance of title and transfer of possession of...

  19. 27 CFR 46.203 - Record (book) inventory requirements.

    Science.gov (United States)

    2010-04-01

    ... Cigarette Tubes Held for Sale on April 1, 2009 Inventories § 46.203 Record (book) inventory requirements. (a... the consignor and consignee. For over the counter sales by retail dealers, the consignee name and... the Office of Management and Budget under control number 1513-0129) ...

  20. 24 CFR 203.493 - Declaration of trust.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Declaration of trust. 203.493... Declaration of trust. A sale of a beneficial interest in a group of insured loans, where the interest to be... be made only pursuant to a declaration of trust, which has been approved by the Commissioner prior to...

  1. 48 CFR 49.203 - Adjustment for loss.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Adjustment for loss. 49... Convenience 49.203 Adjustment for loss. (a) In the negotiation or determination of any settlement, the TCO shall not allow profit if it appears that the contractor would have incurred a loss had the entire...

  2. 49 CFR 1580.203 - Reporting significant security concerns.

    Science.gov (United States)

    2010-10-01

    ..., Scenic, Historic and Excursion Operators, and Private Cars § 1580.203 Reporting significant security... transportation. (4) Each operator of private cars, including business/office cars and circus trains, on or connected to the general railroad system of transportation. (5) Each operator of a rail transit system that...

  3. 24 CFR 203.405 - Debenture interest rate.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Debenture interest rate. 203.405... Debenture interest rate. (a) Debentures shall bear interest from the date of issue, payable semiannually on... claim is paid in cash, the debenture interest rate for purposes of calculating such a claim shall be the...

  4. 24 CFR 203.479 - Debenture interest rate.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Debenture interest rate. 203.479... interest rate. (a) Debentures shall bear interest from the date of issue, payable semiannually on the first... applicable rates of interest will be published twice each year as a notice in the Federal Register. (b) For...

  5. 48 CFR 1631.203-70 - Allocation techniques.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Allocation techniques. 1631... PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations 1631.203-70 Allocation techniques. (a... shall consistently apply the methods and techniques established to classify direct and indirect costs...

  6. 5 CFR 2601.203 - Conflict of interest analysis.

    Science.gov (United States)

    2010-01-01

    ... Section 2601.203 Administrative Personnel OFFICE OF GOVERNMENT ETHICS ORGANIZATION AND PROCEDURES IMPLEMENTATION OF OFFICE OF GOVERNMENT ETHICS STATUTORY GIFT ACCEPTANCE AUTHORITY Guidelines for Solicitation and... relevant considerations, including, but not limited to the following: (1) The identity of the donor; (2...

  7. 31 CFR 539.203 - Evasions; attempts; conspiracies.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Evasions; attempts; conspiracies. 539... REGULATIONS Prohibitions § 539.203 Evasions; attempts; conspiracies. Any transaction by any United States... of evading or avoiding, or attempts to violate any of the prohibitions set forth in this part is...

  8. 48 CFR 1631.203-72 - Home office expense.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Home office expense. 1631... PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations 1631.203-72 Home office expense. A carrier's practices for allocating home office expenses to the segments of the carrier will be acceptable...

  9. 27 CFR 9.203 - Saddle Rock-Malibu.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Saddle Rock-Malibu. 9.203... Saddle Rock-Malibu. (a) Name. The name of the viticultural area described in this section is “Saddle Rock-Malibu”. For purposes of part 4 of this chapter, “Saddle Rock-Malibu” is a term of viticultural...

  10. 21 CFR 74.203 - FD&C Green No. 3.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false FD&C Green No. 3. 74.203 Section 74.203 Food and... ADDITIVES SUBJECT TO CERTIFICATION Foods § 74.203 FD&C Green No. 3. (a) Identity. (1) The color additive FD...-sulfophenyl)methylene]-2,5-cyclohexadien-1-ylidene]-3-sulfobenzenemethanaminium hydroxide. Additionally, FD&C...

  11. MicroRNA 203 Modulates Glioma Cell Migration via Robo1/ERK/MMP-9 Signaling.

    Science.gov (United States)

    Dontula, Ranadheer; Dinasarapu, Ashok; Chetty, Chandramu; Pannuru, Padmavathi; Herbert, Engelhard; Ozer, Howard; Lakka, Sajani S

    2013-07-01

    Glioblastoma (GBM) is the most common and malignant primary adult brain cancer. Allelic deletion on chromosome 14q plays an important role in the pathogenesis of GBM, and this site was thought to harbor multiple tumor suppressor genes associated with GBM, a region that also encodes microRNA-203 (miR-203). In this study, we sought to identify the role of miR-203 as a tumor suppressor in the pathogenesis of GBM. We analyzed the miR-203 expression data of GBM patients in 10 normal and 495 tumor tissue samples derived from The Cancer Genome Atlas data set. Quantitative real-time PCR and in situ hybridization in 10 high-grade GBM and 10 low-grade anaplastic astrocytoma tumor samples showed decreased levels of miR-203 expression in anaplastic astrocytoma and GBM tissues and cell lines. Exogenous expression of miR-203 using a plasmid expressing miR-203 precursor (pmiR-203) suppressed glioma cell proliferation, migration, and invasion. We determined that one relevant target of miR-203 was Robo1, given that miR-203 expression decreased mRNA and protein levels as determined by RT-PCR and Western blot analysis. Moreover, cotransfection experiments using a luciferase-based transcription reporter assay have shown direct regulation of Robo1 by miR-203. We also show that Robo1 mediates miR-203 mediated antimigratory functions as up-regulation of Robo1 abrogates miR-203 mediated antimigratory effects. We also show that miR-203 expression suppressed ERK phosphorylation and MMP-9 expression in glioma cells. Furthermore, we demonstrate that miR-203 inhibits migration of the glioma cells by disrupting the Robo1/ERK/MMP-9 signaling axis. Taken together, these studies demonstrate that up-regulation of Robo1 in response to the decrease in miR-203 in glioma cells is responsible for glioma tumor cell migration and invasion.

  12. Glaucoma associated with iridocorneal endothelial syndrome in 203 Indian subjects.

    Science.gov (United States)

    Chandran, Premanand; Rao, Harsha L; Mandal, Anil K; Choudhari, Nikhil S; Garudadri, Chandra S; Senthil, Sirisha

    2017-01-01

    To report the demographic profile, clinical features, and prevalence of glaucoma and its management in patients with Iridocorneal endothelial (ICE) syndrome. Retrospective review of 203 consecutive subjects with ICE syndrome at a tertiary eye care centre between January 1988 and June 2013. ICE syndrome was present in 223 eyes of 203 subjects, 124 (61%) were female and 79 (39%) were male. The median age at presentation was 43 years (1st (Q1) and 3rd (Q3) quartile; 34, 51 years). ICE syndrome was unilateral in 183 (90%) subjects, and bilateral in 20 (10%) subjects. The most common clinical variant was progressive iris atrophy (PIA, 115; 52% eyes), followed by Chandler syndrome (CS, 87; 39% eyes) and Cogan-Reese syndrome (CRS, 21; 9% eyes). Glaucoma was found in 156 eyes (70%) at presentation and the median (Q1, Q3) intraocular pressure in eyes with glaucoma was 24 (16, 38) mm Hg. Seven eyes developed glaucoma during the follow-up period, increasing the percentage of eyes with glaucoma to 73%. Intraocular pressure was managed medically in 81 eyes (50%) and the other 82 eyes (50%) required surgical intervention. Corneal edema was present in 124 eyes (56%) of which, 32 eyes (14%) required keratoplasty. In our study on ICE syndrome in Indian population, the presentation was predominantly uniocular and more common in middle aged women. Progressive iris atrophy was the most common clinical variant. ICE syndrome was associated with glaucoma in over 70% of the eyes and half of the eyes had corneal edema.

  13. 14 CFR 23.203 - Turning flight and accelerated turning stalls.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Turning flight and accelerated turning stalls. 23.203 Section 23.203 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... a 30 degree bank. Reduce speed by steadily and progressively tightening the turn with the elevator...

  14. 76 FR 63602 - Voting Rights Act Amendments of 2006, Determinations Under Section 203

    Science.gov (United States)

    2011-10-13

    ... telephone at (800) 253-3931 or visit the Voting Section Internet site at http://www.justice.gov/crt/about... 110921596-1557-01] Voting Rights Act Amendments of 2006, Determinations Under Section 203 AGENCY: Bureau of... 203 of the Voting Rights Act of 1965, as amended, this notice publishes the Bureau of the Census...

  15. 24 CFR 203.404 - Amount of payment-assigned mortgages.

    Science.gov (United States)

    2010-04-01

    ... mortgages. 203.404 Section 203.404 Housing and Urban Development Regulations Relating to Housing and Urban... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Payment of Insurance Benefits...

  16. 27 CFR 26.203a - Containers in excess of 1 gallon (3.785 liters).

    Science.gov (United States)

    2010-04-01

    ... gallon (3.785 liters). 26.203a Section 26.203a Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO... excess of 1 gallon (3.785 liters). Containers of distilled spirits brought into the United States from the Virgin Islands, having a capacity in excess of 1 gallon (3.785 liters), are required to be marked...

  17. 27 CFR 26.203 - Containers of 1 gallon (3.785 liters) or less.

    Science.gov (United States)

    2010-04-01

    ....785 liters) or less. 26.203 Section 26.203 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO... gallon (3.785 liters) or less. Containers of distilled spirits brought into the United States from the Virgin Islands, having a capacity of not more than 1 gallon (3.785 liters), shall conform to the...

  18. 50 CFR 226.203 - Critical habitat for northern right whales.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Critical habitat for northern right whales. 226.203 Section 226.203 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND... Critical habitat for northern right whales. (a) Great South Channel. The area bounded by 41°40′ N/69°45′ W...

  19. 34 CFR 303.203 - Payments to the Secretary of the Interior.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false Payments to the Secretary of the Interior. 303.203 Section 303.203 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF... Secretary of the Interior. The amount of the payment to the Secretary of the Interior under § 303.180 for...

  20. 78 FR 20168 - Twenty Fourth Meeting: RTCA Special Committee 203, Unmanned Aircraft Systems

    Science.gov (United States)

    2013-04-03

    ...: Meeting Notice of RTCA Special Committee 203, Unmanned Aircraft Systems. SUMMARY: The FAA is issuing this... Document--Operational Functional Requirements and Safety Objectives for Unmanned Aircraft Systems and... Federal Aviation Administration Twenty Fourth Meeting: RTCA Special Committee 203, Unmanned Aircraft...

  1. 75 FR 60495 - Eighteenth Plenary Meeting: RTCA Special Committee 203: Unmanned Aircraft Systems

    Science.gov (United States)

    2010-09-30

    ...: Unmanned Aircraft Systems. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 203: Unmanned Aircraft Systems. DATES: The meeting will be held October 19-21... Special Committee 203: Unmanned Aircraft Systems meeting. The agenda will include: Tuesday, October 19 9 a...

  2. 75 FR 26321 - Seventeenth Plenary Meeting: RTCA Special Committee 203: Unmanned Aircraft Systems

    Science.gov (United States)

    2010-05-11

    ...: Unmanned Aircraft Systems. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 203: Unmanned Aircraft Systems. DATES: The meeting will be held June 8-10, 2010... given for a Special Committee 203: Unmanned Aircraft Systems meeting. The agenda will include: Tuesday...

  3. 48 CFR 218.203 - Incidents of national significance, emergency declaration, or major disaster declaration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Incidents of national significance, emergency declaration, or major disaster declaration. 218.203 Section 218.203 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITION...

  4. 42 CFR 441.203 - Life of the mother would be endangered.

    Science.gov (United States)

    2010-10-01

    ... SERVICES Abortions § 441.203 Life of the mother would be endangered. FFP is available in expenditures for... basis of his professional judgment, the life of the mother would be endangered if the fetus were carried... 42 Public Health 4 2010-10-01 2010-10-01 false Life of the mother would be endangered. 441.203...

  5. 30 CFR 203.83 - What is in an administrative information report?

    Science.gov (United States)

    2010-07-01

    ...? 203.83 Section 203.83 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT RELIEF OR REDUCTION IN ROYALTY RATES OCS Oil, Gas, and Sulfur General Required... of record, the lease operators, and whether any lease is part of a unit; (c) Well number, API number...

  6. 5 CFR 2638.203 - Duties of the designated agency ethics official.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Duties of the designated agency ethics official. 2638.203 Section 2638.203 Administrative Personnel OFFICE OF GOVERNMENT ETHICS GOVERNMENT ETHICS OFFICE OF GOVERNMENT ETHICS AND EXECUTIVE AGENCY ETHICS PROGRAM RESPONSIBILITIES Designated Agency Ethics...

  7. 14 CFR 121.203 - Nontransport category airplanes: Landing limitations: Destination airport.

    Science.gov (United States)

    2010-01-01

    ... limitations: Destination airport. 121.203 Section 121.203 Aeronautics and Space FEDERAL AVIATION... airport. (a) No person operating a nontransport category airplane may take off that airplane at a weight... destination airport; and (2) Is greater than the weight allowable if the landing is to be made on the runway...

  8. 48 CFR 1836.203 - Government estimate of construction costs.(NASA supplements paragraph (c))

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Government estimate of construction costs.(NASA supplements paragraph (c)) 1836.203 Section 1836.203 Federal Acquisition Regulations... construction costs.(NASA supplements paragraph (c)) (c)(i) If the acquisition is by sealed bidding, the...

  9. 28 CFR 301.203 - Payment of lost-time wages.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Payment of lost-time wages. 301.203... ACCIDENT COMPENSATION Lost-Time Wages § 301.203 Payment of lost-time wages. (a) An inmate worker may receive lost-time wages for the number of regular work hours absent from work due to injury sustained in...

  10. 30 CFR 203.89 - What is in a cost report?

    Science.gov (United States)

    2010-07-01

    ..., engineering estimates, or analogous projects. These costs cover: (1) Platform well drilling and average depth... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What is in a cost report? 203.89 Section 203.89... in a cost report? This report lists all actual and projected costs for your field, must explain and...

  11. 31 CFR 203.11 - Same-day reporting and payment mechanisms.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Same-day reporting and payment mechanisms. 203.11 Section 203.11 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE PAYMENT OF FEDERAL TAXES...

  12. 31 CFR 203.6 - Obligations of TT&L depositaries.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Obligations of TT&L depositaries. 203.6 Section 203.6 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE PAYMENT OF FEDERAL TAXES AND THE...

  13. 31 CFR 203.4 - Financial institution eligibility for designation as a TT&L depositary.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Financial institution eligibility for designation as a TT&L depositary. 203.4 Section 203.4 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE...

  14. 31 CFR 203.5 - Designation of financial institutions as TT&L depositaries.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Designation of financial institutions as TT&L depositaries. 203.5 Section 203.5 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE...

  15. 31 CFR 203.8 - Application of part and procedural instructions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Application of part and procedural instructions. 203.8 Section 203.8 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE PAYMENT OF FEDERAL TAXES...

  16. 31 CFR 203.7 - Termination of agreement or change of election or option.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Termination of agreement or change of election or option. 203.7 Section 203.7 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE PAYMENT OF...

  17. 24 CFR 203.346 - Postponement of foreclosure-mortgagors in military service.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Postponement of foreclosure... Forbearance Relief for Military Personnel § 203.346 Postponement of foreclosure—mortgagors in military service... foreclosure or acquire the property by other means as provided in § 203.355 of this subpart. No postponement...

  18. 41 CFR 105-54.203-3 - Submission to Library of Congress.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Submission to Library of Congress. 105-54.203-3 Section 105-54.203-3 Public Contracts and Property Management Federal Property... Submission to Library of Congress. The GSA Committee Management Officer furnishes a copy of each charter to...

  19. 30 CFR 203.0 - What definitions apply to this part?

    Science.gov (United States)

    2010-07-01

    ....83 and 203.85 through 203.89, along with one set of digital information, which MMS has reviewed and... that continuous construction has begun, and a receipt for the customary down payment. Field means an..., characterized by a single pressure system and segregated from other such accumulations. Royalty suspension (RS...

  20. 24 CFR 203.52 - Acceptance of individual residential water purification equipment.

    Science.gov (United States)

    2010-04-01

    ... residential water purification equipment. 203.52 Section 203.52 Housing and Urban Development Regulations... water purification equipment. If a property otherwise eligible for insurance under this part does not have access to a continuing supply of safe and potable water without the use of a water purification...

  1. 21 CFR 203.11 - Applications for reimportation to provide emergency medical care.

    Science.gov (United States)

    2010-04-01

    ... emergency medical care. 203.11 Section 203.11 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF... Applications for reimportation to provide emergency medical care. (a) Applications for reimportation for emergency medical care shall be submitted to the director of the FDA District Office in the district where...

  2. 48 CFR 2152.203-70 - Misleading, deceptive, or unfair advertising.

    Science.gov (United States)

    2010-10-01

    ... unfair advertising. 2152.203-70 Section 2152.203-70 Federal Acquisition Regulations System OFFICE OF..., deceptive, or unfair advertising. As prescribed in 2103.571, insert the following clause: Misleading, Deceptive, or Unfair Advertising (OCT 2005) The Contractor agrees that any advertising material authorized...

  3. Effect of vitamin D on the intestinal absorption of 203Pb and 47Ca in chicks

    Energy Technology Data Exchange (ETDEWEB)

    Mykkaenen, H.M.; Wasserman, R.H.

    1982-03-01

    The transfer of 203Pb and/or 47Ca across the intestinal epithelium of the chick was investigated, with emphasis given to the functional role of cholecalciferol (vitamin D-3). 203Pb, after introduction in the intestinal lumen, is rapidly accumulated by the intestinal tissue, and only a fraction of 203Pb is translocated parenterally (absorbed). Cholecalciferol did not significantly affect the accumulation of 203Pb by intestinal tissue but did accelerate 203Pb movement across the basal-lateral membrane. In contrast, cholecalciferol both decreased 47Ca tissue levels and increased 47Ca absorption. In rachitic chicks, the rate of absorption of 203Pb was greater in the distal than in the proximal segments of the intestine; after cholecalciferol repletion, the degree of absorption in al segments was similar, indicting the order of cholecalciferol effectiveness as duodenum greater than or equal to jejunum greater than ileum. An acute dose of 1,25(OH)2D3 to rachitic chicks also enhanced both 203Pb and 47Ca absorption, but the time course and pattern of absorption of these metal cations differed. The time at which the absorption of 203Pb peaked and returned to base-line occurred sooner than for 47Ca. Also the back-flux (blood leads to intestinal lumen) of 47Ca was enhanced by cholecalciferol, whereas no effect on the back-flux of 203Pb was noted. These studies show that cholecalciferol and 1,25(OH)2D3 affects both the 203Pb and 47Ca absorptive processes, but the nature of these responses are not identical, suggesting differences in the transport path or the macromolecular interactions of these metal ions during the course of absorption, or both.

  4. 9 CFR 203.17 - Statement of general policy with respect to rates and charges at posted stockyards.

    Science.gov (United States)

    2010-01-01

    ... respect to rates and charges at posted stockyards. 203.17 Section 203.17 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE STATEMENTS OF GENERAL POLICY UNDER THE PACKERS AND STOCKYARDS ACT § 203.17 Statement of general...

  5. Host microRNA-203a Is antagonistic to the progression of foot-and-mouth disease virus infection.

    Science.gov (United States)

    Gutkoska, Joseph; LaRocco, Michael; Ramirez-Medina, Elizabeth; de Los Santos, Teresa; Lawrence, Paul

    2017-04-01

    Sam68 was previously shown to be a critical host factor for foot-and-mouth disease virus (FMDV) replication. MicroRNA (miR) miR-203a is reportedly a negative regulator of Sam68 expression both in vitro and in vivo. Here, transfection of miR-203a-3p and miR-203a-5p mimics separately and in combination in a porcine cell line followed by FMDV infection resulted in diminished viral protein synthesis and a 4 and 6log reduction in virus titers relative to negative controls, respectively. Unexpectedly, Sam68 expression was increased by miR-203a-5p transfection, but not miR-203a-3p. miR-203a-5p also down-regulated Survivin expression, which was predicted to play a role in FMDV infection. Moreover, miR-203a-5p but not miR-203a-3p affected a reduction in FMDV viral RNA. These effects were not replicated with a related Picornavirus, suggesting FMDV specificity. Importantly, miR-203a-3p and miR-203a-5p impaired FMDV infection across multiple FMDV serotypes. We concluded that miR-203a-3p and miR-203a-5p represent attractive potential naturally occurring bio-therapeutics against FMDV. Published by Elsevier Inc.

  6. 45 CFR 46.203 - Duties of IRBs in connection with research involving pregnant women, fetuses, and neonates.

    Science.gov (United States)

    2010-10-01

    ... involving pregnant women, fetuses, and neonates. 46.203 Section 46.203 Public Welfare DEPARTMENT OF HEALTH... Pregnant Women, Human Fetuses and Neonates Involved in Research § 46.203 Duties of IRBs in connection with research involving pregnant women, fetuses, and neonates. In addition to other responsibilities assigned to...

  7. MicroRNA-203 Modulates the Radiation Sensitivity of Human Malignant Glioma Cells

    Energy Technology Data Exchange (ETDEWEB)

    Chang, Ji Hyun [Department of Radiation Oncology, Graduate School of Medicine, Seoul National University, Seoul (Korea, Republic of); Hwang, Yeo Hyun; Lee, David J.; Kim, Dan Hyo; Park, Ji Min [Medical Science Research Institute, Seoul National University Bundang Hospital, Kyeonggido (Korea, Republic of); Wu, Hong-Gyun [Department of Radiation Oncology, Graduate School of Medicine, Seoul National University, Seoul (Korea, Republic of); Kim, In Ah, E-mail: inah228@snu.ac.kr [Department of Radiation Oncology, Graduate School of Medicine, Seoul National University, Seoul (Korea, Republic of); Medical Science Research Institute, Seoul National University Bundang Hospital, Kyeonggido (Korea, Republic of); Cancer Research Institute, Seoul National University, Seoul (Korea, Republic of)

    2016-02-01

    Purpose: We investigated whether miR-203 could modulate the radiation sensitivity of glioblastoma (GBM) cells and which target gene(s) could be involved. Methods and Materials: Three human malignant glioma (MG) cell lines and normal human astrocytes were transfected with control microRNA, pre-miR-203, or antisense miR-203. Real-time PCR (RT-PCR), clonogenic assays, immunofluorescence, and invasion/migration assays were performed. To predict the target(s), bioinformatics analyses using microRNA target databases were performed. Results: Overexpression of miR-203 increased the radiation sensitivity of all 3 human MG cell lines and prolonged radiation-induced γ-H2AX foci formation. Bioinformatics analyses suggested that miR-203 could be involved in post-transcriptional control of DNA repair, PI3K/AKT, SRC, and JAK/STAT3 and the vascular signaling pathway. Western blot analysis validated the fact that miR-203 downregulated ATM, RAD51, SRC, PLD2, PI3K-AKT, JAK-STAT3, VEGF, HIF-1α, and MMP2. Overexpression of miR-203 inhibited invasion and migration potentials, downregulated SLUG and Vimentin, and upregulated Claudin-1 and ZO1. Conclusions: These data demonstrate that miR-203 potentially controls DNA damage repair via the PI3K/AKT and JAK/STAT3 pathways and may collectively contribute to the modulation of radiation sensitivity in MG cells by inhibiting DNA damage repair, prosurvival signaling, and epithelium-mesenchyme transition. Taken together, these findings demonstrate that miR-203 could be a target for overcoming the radiation resistance of GBM.

  8. COH-203, a novel microtubule inhibitor, exhibits potent anti-tumor activity via p53-dependent senescence in hepatocellular carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Qi, Huan; Zuo, Dai-Ying; Bai, Zhao-Shi; Xu, Jing-Wen; Li, Zeng-Qiang [Department of Pharmacology, Shenyang Pharmaceutical University, Shenyang (China); Shen, Qi-Rong; Wang, Zhi-Wei [Key Laboratory of Structure-Based Drug Design and Discovery, Ministry of Education, Shenyang Pharmaceutical University, Shenyang (China); Zhang, Wei-Ge, E-mail: zhangweige2000@sina.com [Key Laboratory of Structure-Based Drug Design and Discovery, Ministry of Education, Shenyang Pharmaceutical University, Shenyang (China); Wu, Ying-Liang, E-mail: yingliang_1016@163.com [Department of Pharmacology, Shenyang Pharmaceutical University, Shenyang (China)

    2014-12-12

    Highlights: • COH-203 exhibits anti-hepatoma effects in vitro and in vivo with low toxicity. • COH-203 inhibits tubulin polymerization. • COH-203 induces mitotic arrest followed by mitotic slippage in BEL-7402 cells. • COH-203 induces p53-dependent senescence in BEL-7402 cells. - Abstract: 5-(3-Hydroxy-4-methoxyphenyl)-4-(3,4,5-trimethoxyphenyl)-3H-1, 2-dithiol-3-one (COH-203) is a novel synthesized analogue of combretastatin A-4 that can be classified as a microtubule inhibitor. In this study, we evaluated the anti-hepatoma effect of COH-203 in vitro and in vivo and explored the underlying molecular mechanisms. COH-203 was shown to be more effective in inhibiting the proliferation of liver cancer cells compared with normal liver cells. COH-203 also displayed potent anti-tumor activity in a hepatocellular carcinoma xenograft model without significant toxicity. Mechanistic studies demonstrated that treatment with COH-203 induced mitotic arrest by inhibiting tubulin polymerization in BEL-7402 liver cancer cells. Long-term COH-203 treatment in BEL-7402 cells led to mitotic slippage followed by senescence via the p14{sup Arf}–p53–p21 and p16{sup INK4α}–Rb pathways. Furthermore, suppression of p53 via pifithrin-α (p53 inhibitor) and p53-siRNA attenuated COH-203-induced senescence in BEL-7402 cells, suggesting that COH-203 induced senescence p53-dependently. In conclusion, we report for the first time that COH-203, one compound in the combretastatin family, promotes anti-proliferative activity through the induction of p-53 dependent senescence. Our findings will provide a molecular rationale for the development of COH-203 as a promising anti-tumor agent.

  9. 22 CFR 40.205 - Applicant for immigrant visa under INA 203(c).

    Science.gov (United States)

    2010-04-01

    ... NONIMMIGRANTS AND IMMIGRANTS UNDER THE IMMIGRATION AND NATIONALITY ACT, AS AMENDED Failure to Comply with INA... under INA 203(c) if the alien does not have a high school education or its equivalent, as defined in 22...

  10. 9 CFR 203.15 - Trust benefits under sections 206 and 207 of the Act.

    Science.gov (United States)

    2010-01-01

    ... STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE STATEMENTS OF GENERAL POLICY UNDER THE PACKERS AND STOCKYARDS ACT § 203.15 Trust benefits under sections 206 and 207 of the Act...

  11. 24 CFR 203.280 - One-time or Up-front MIP.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false One-time or Up-front MIP. 203.280... Payment § 203.280 One-time or Up-front MIP. For mortgages for which a one-time or up-front MIP is to be... the mortgage by the Commissioner or the up-front portion of the total obligation, as applicable...

  12. A norming study and library of 203 dance movements.

    Science.gov (United States)

    Christensen, Julia F; Nadal, Marcos; Cela-Conde, Camilo José

    2014-01-01

    Dance stimuli have been used in experimental studies of (i) how movement is processed in the brain; (ii) how affect is perceived from bodily movement; and (iii) how dance can be a source of aesthetic experience. However, stimulus materials across--and even within--these three domains of research have varied considerably. Thus, integrative conclusions remain elusive. Moreover, concerns have been raised that the movements selected for such stimuli are qualitatively too different from the actual art form dance, potentially introducing noise in the data. We propose a library of dance stimuli which responds to the stimuli requirements and design criteria of these three areas of research, while at the same time respecting a dance art-historical perspective, offering greater ecological validity as compared with previous dance stimulus sets. The stimuli are 5-6 s long video clips, selected from genuine ballet performances. Following a number of coding experiments, the resulting stimulus library comprises 203 ballet dance stimuli coded in (i) 25 qualitative and quantitative movement variables; (ii) affective valence and arousal; and (iii) the aesthetic qualities beauty, liking, and interest. An Excel spreadsheet with these data points accompanies this manuscript, and the stimuli can be obtained from the authors upon request.

  13. Conventional superconductivity at 203 K at high pressures

    Energy Technology Data Exchange (ETDEWEB)

    Drozdov, Alexander; Eremets, Mikhail; Troyan, Ivan [Max-Planck-Institut fuer Chemie, Hahn-Meitner-Weg 1, 55128 Mainz (Germany); Ksenofontov, Vadim; Shylin, Sergii [Institut fuer Anorganische Chemie und Analytische Chemie, Johannes Gutenberg-Universitet Mainz, Staudingerweg 9, 55099 Mainz (Germany)

    2016-07-01

    A search for high, room temperature conventional superconductivity is promising as the Bardeen-Cooper-Schrieffer (BCS) theory in the Eliashberg formulation puts no apparent limits on T{sub c}. Materials with light elements are especially favorable as they provide high frequencies in the phonon spectrum. However only a moderately high T{sub c} = 39 K has been found in this search in MgB{sub 2}. We systematically studied metallic hydrogen and covalent hydrogen dominant compounds and found the record T{sub c} of 203 K at pressure 140 GPa in sulfur hydride. We proved occurrence of superconductivity by the sharp drop of the resistivity to zero; the decrease of T{sub c} with magnetic field; the pronounce isotope shift of T{sub c} in D{sub 2}S which evidences of a major role of phonons in the superconductivity; and the magnetic susceptibility measurements. The X-ray diffraction data confirmed that the superconductive phase has the predicted bcc structure. This phase can be considered as an atomic hydrogen superconductor stabilized by sulfur.

  14. MicroRNA-203-mediated posttranscriptional deregulation of CPEB4 contributes to colorectal cancer progression

    Energy Technology Data Exchange (ETDEWEB)

    Zhong, Xiaohua; Xiao, Yipin; Chen, Chao, E-mail: chenchaopw@126.com; Wei, Xiuwen; Hu, Chen; Ling, Xukun; Liu, Xinbin

    2015-10-16

    Elevated cytoplasmic polyadenylation element-binding 4 (CPEB4) is aberrantly expressed in several malignant cancers. However, its expression pattern, clinical significance, and biological function in colorectal cancer are still unknown. In this study, we demonstrated that CPEB4 is abundantly overexpressed in colorectal cancers and has the potential to be used for predicting clinical outcomes of colorectal cancer patients. We suppressed CPEB4 expression by small interfering RNA (siRNA) in SW480 and LOVO cells to clarify the role of CPEB4 on the cell apoptosis and proliferation in vitro. Further study revealed that knockdown of CPEB4 decreased the expression of anti-apoptotic protein B-cell lymphoma-extra large (Bcl-XL), but enhanced the expression of B-cell lymphoma-2-associated X (Bax). In addition, we indicated that CPEB4 is a novel target of miR-203, a tumor suppressive microRNA. Notably, restoration of CPEB4 in SW480 cells inhibited miR-203-induced apoptosis signaling pathway, which in turn enhanced cell proliferation and suppressed cell apoptosis. Taken together, our findings imply that posttranscriptional deregulation of CPEB4 contributes to the inhibited cell proliferation and the enhanced cell apoptosis in colorectal cancer, and directly targeting CPEB4 by miR-203 might be a novel strategy in colorectal cancer treatment. - Highlights: • CPEB4 is aberrantly expressed in human colorectal cancers. • Knockdown of CPEB4 inhibited colorectal cancer cell proliferation and enhanced apoptosis. • CPEB4 is a direct target of miR-203 and inversely correlates with miR-203 expression. • miR-203 inhibited cell growth and enhanced cell apoptosis in CPEB4 dependent manner. • miR-203 is an upstream regulator of the CPEB4-induced apoptosis pathway.

  15. miR-203 inhibits cell proliferation and promotes cisplatin induced cell death in tongue squamous cancer

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Jiong; Lin, Yao [Guangdong Provincial Key Laboratory of Stomatology, Department of Orthodontics, Guanghua School of Stomatology, Hospital of Stomatology, Sun Yat-sen University, Guangzhou, 510055 (China); Fan, Li [Department of Pharmaceutical Analysis, School of Pharmacy, The Fourth Military Medical University, Xi' an, Shaanxi, 710032 (China); Guangdong Provincial Key Laboratory of Stomatology, Guangzhou, 510055 (China); Kuang, Wei [Department of Stomatology, Guangzhou General Hospital of Guangzhou Military Command, 111 Liuhua Road, Guangzhou, 510010 (China); Zheng, Liwei [State Key Laboratory of Oral Diseases, Sichuan University, Wuhou District, Chengdu, 610041 (China); Wu, Jiahua [Guangdong Provincial Key Laboratory of Stomatology, Department of Orthodontics, Guanghua School of Stomatology, Hospital of Stomatology, Sun Yat-sen University, Guangzhou, 510055 (China); Shang, Peng [Patient-specific Orthopedic Technology Research Center in GuangDong Research Centre for Neural Engineering, 1068 Xueyuan Boulevard, University Town of Shenzhen, Xili, Nanshan, Shenzhen, 518055 (China); Wang, Qiaofeng [Department of Pharmaceutical Chemistry, School of Pharmacy, The Fourth Military Medical University, Xi' an, Shanxi, 710032 (China); Tan, Jiali, E-mail: jasminenov@163.com [Guangdong Provincial Key Laboratory of Stomatology, Department of Orthodontics, Guanghua School of Stomatology, Hospital of Stomatology, Sun Yat-sen University, Guangzhou, 510055 (China)

    2016-04-29

    Oral squamous cell carcinoma (OSCC) is one of the most common types of the head and neck cancer. Chemo resistance of OSCC has been identified as a substantial therapeutic hurdle. In this study, we analyzed the role of miR-203 in the OSCC and its effects on cisplatin-induced cell death in an OSCC cell line, Tca8113. There was a significant decrease of miR-203 expression in OSCC samples, compared with the adjacent normal, non-cancerous tissue. After 3 days cisplatin treatment, the survived Tca8113 cells had a lower expression of miR-203 than that in the untreated control group. In contrast, PIK3CA showed an inverse expression in cancer and cisplatin survived Tca8113 cells. Transfection of Tca8113 cells with miR-203 mimics greatly reduced PIK3CA expression and Akt activation. Furthermore, miR-203 repressed PIK3CA expression through targeting the 3′UTR. Restoration of miR-203 not only suppressed cell proliferation, but also sensitized cells to cisplatin induced cell apoptosis. This effect was absent in cells that were simultaneously treated with PIK3CA RNAi. In summary, these findings suggest miR-203 plays an important role in cisplatin resistance in OSCC, and furthermore delivery of miR-203 analogs may serve as an adjuvant therapy for OSCC. - Highlights: • Much lower miR-203 expression in cisplatin resistant Tca8113 cells is discovered. • Delivery of miR-203 can sensitize the Tca8113 cells to cisplatin induced cell death. • MiR-203 can downregulate PIK3CA through the 3′UTR. • The effects of miR-203 on cisplatin sensitivity is mainly through PIK3CA pathway.

  16. 17 CFR 275.203(b)(3)-1 - Definition of “client” of an investment adviser.

    Science.gov (United States)

    2010-04-01

    ... Definition of “client” of an investment adviser. Preliminary Note to § 275.203(b)(3)-1. This section is a... single client for purposes of section 203(b)(3) of the Act. Under paragraph (b)(6) of this section, the... be a single client for purposes of section 203(b)(3) of the Act (15 U.S.C. 80b-3(b)(3)): (1) A...

  17. miR-203 inhibits melanoma invasive and proliferative abilities by targeting the polycomb group gene BMI1

    Energy Technology Data Exchange (ETDEWEB)

    Chang, Xiao [Department of Dermatology and Venereal Disease, Xuanwu Hospital, Capital Medical University, Beijing 100053 (China); Sun, Yong [Department of Burn and Plastic Surgery, Huai’an First People’s Hospital, Nanjing Medical University, Huai’an 223300 (China); Han, Siqi [Department of Medical Oncology, Jinling Hospital, Nanjing 210002 (China); Zhu, Wei [Department of Dermatology and Venereal Disease, Xuanwu Hospital, Capital Medical University, Beijing 100053 (China); Zhang, Haiping, E-mail: zhanghaiping_2000@163.com [Department of Dermatology and Venereal Disease, Xuanwu Hospital, Capital Medical University, Beijing 100053 (China); Lian, Shi, E-mail: lianshi_2020@163.com [Department of Dermatology and Venereal Disease, Capital Medical University, Beijing 100069 (China)

    2015-01-02

    Highlights: • First reported deregulation of miR-203 and up-regulation of BMI1 in metastatic melanoma. • miR-203 decreased BMI1 expression by directly binding to 3′UTR. • Further found miR-203 overexpression suppressed cell invasion and stemness. • Re-expression of BMI1 rescued miR-203-mediated suppression. • miR-203-BMI1 axis may be potential therapeutic targets of melanoma metastasis. - Abstract: Metastasis is the major problem in malignant melanoma, posing a therapeutic challenge to clinicians. The investigation of the underlying mechanism driving this progress remains a large unmet need. In this study, we revealed a miR-203-BMI1 axis that regulated melanoma metastasis. We found significantly deregulation of miR-203 and up-regulation of BMI1 in melanoma, particularly in metastatic melanoma. An inverse correlation between the levels of miR-203 and BMI1 was further observed in melanoma tissues and cell lines. We also identified BMI1 as a downstream target gene of miR-203, which bound to the 3′UTR of BMI1. Overexpression of miR-203 was associated with decreased BMI1 expression and impaired cell invasion and tumor sphere formation activities. Re-expression of BMI1 markedly rescued miR-203-mediated suppression of these events. Taken together, our results demonstrated that miR-203 regulated melanoma invasive and proliferative abilities in part by targeting BMI1, providing new insights into potential mechanisms of melanoma metastasis.

  18. Cadmium-109 and methyl mercury-203 metabolism, tissue distribution, and secretion into milk of cows

    Energy Technology Data Exchange (ETDEWEB)

    Neathery, M.W.; Miller, W.J.; Gentry, R.P.; Stake, P.E.; Blackmon, D.M.

    1974-01-01

    Metabolism of cadmium-109 and methyl mercury-203 was studied in six lactating Jersey cows for 14 days following single tracer oral doses. Most of the cadmium-109 was excreted in feces with only .05% in urine. When the cows were killed 14 to 16 days after dosing, kidney and liver had highest cadmium-109. About .75% of the cadmium-109 was retained in the body with 34% of this in gastrointestinal tract and contents, 32% in liver, and 10% in kidney. In fetal tissues highest cadmium-109 was in kidney, tibia, and liver whereas fetal liver had highest methyl mercury-203. Apparent methyl mercury-203 absorption was 59% with 1.1% in urine. Highest concentration was in kidney, followed by liver, skeletal muscles, heart, smooth muscle, spleen, lung, brain, ovaries, and pancreas. Of total body mercury-203, muscle had about 72% and liver 7%. In 14 days, only .17% of mercury-203 dose was secreted into milk. Cadmium-109 in milk was below detectable limits of .00008% of the dose/day. Feed of cattle kept for meat should be protected from methyl mercury, at least near slaughter. Milk is protected from methyl mercury. In sharp contrast to zinc, little of the ingested cadmium appears in muscle or milk. 31 references, 3 figures, 4 tables.

  19. 42 CFR 137.203 - May a Self-Governance Tribe participate in a voluntary national uniform data collection effort...

    Science.gov (United States)

    2010-10-01

    ...-Governance Tribe participate in a voluntary national uniform data collection effort with the IHS? Yes, in... 42 Public Health 1 2010-10-01 2010-10-01 false May a Self-Governance Tribe participate in a voluntary national uniform data collection effort with the IHS? 137.203 Section 137.203 Public Health PUBLIC...

  20. 9 CFR 203.4 - Statement with respect to the disposition of records by packers, live poultry dealers, stockyard...

    Science.gov (United States)

    2010-01-01

    ... disposition of records by packers, live poultry dealers, stockyard owners, market agencies and dealers. 203.4 Section 203.4 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE STATEMENTS OF GENERAL POLICY UNDER THE PACKERS AND...

  1. 9 CFR 203.14 - Statement with respect to advertising allowances and other merchandising payments and services.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Statement with respect to advertising allowances and other merchandising payments and services. 203.14 Section 203.14 Animals and Animal Products... services furnished on the dollar volume or on the quantity of goods purchased during a specified period...

  2. 12 CFR Appendix B to Part 203 - Form and Instructions for Data Collection on Ethnicity, Race, and Sex

    Science.gov (United States)

    2010-01-01

    ... Ethnicity, Race, and Sex B Appendix B to Part 203 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF... to Part 203—Form and Instructions for Data Collection on Ethnicity, Race, and Sex I. Instructions on Collection of Data on Ethnicity, Race, and Sex You may list questions regarding the ethnicity, race, and sex...

  3. 12 CFR Appendix A to Part 203 - Form and Instructions for Completion of HMDA Loan/Application Register

    Science.gov (United States)

    2010-01-01

    ... Loan/Application Register A Appendix A to Part 203 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM HOME MORTGAGE DISCLOSURE (REGULATION C) Pt. 203, App. A Appendix A..., numerals, or a combination of both. 2. Date Application Received a. Enter the date the loan application was...

  4. 24 CFR 203.438 - Mortgages on Indian land insured pursuant to section 248 of the National Housing Act.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgages on Indian land insured pursuant to section 248 of the National Housing Act. 203.438 Section 203.438 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued) OFFICE OF ASSISTANT SECRETARY FOR HOUSING...

  5. 78 FR 16247 - Approval for Export-Only Manufacturing Authority, Foreign-Trade Zone 203, SGL Automotive Carbon...

    Science.gov (United States)

    2013-03-14

    ... Automotive Carbon Fibers, LLC, (Carbon Fiber Manufacturing), Moses Lake, Washington Pursuant to its authority... requested export-only manufacturing authority on behalf of SGL Automotive Carbon Fibers, LLC, within FTZ 203... within FTZ 203-Site 3, on behalf of SGL Automotive Carbon Fibers, LLC, as described in the application...

  6. 5 CFR 2641.203 - One-year restriction on any former employee's representations, aid, or advice concerning ongoing...

    Science.gov (United States)

    2010-01-01

    ... employee's representations, aid, or advice concerning ongoing trade or treaty negotiation. 2641.203 Section... CONFLICT OF INTEREST RESTRICTIONS Prohibitions § 2641.203 One-year restriction on any former employee's representations, aid, or advice concerning ongoing trade or treaty negotiation. (a) Basic prohibition of 18 U.S.C...

  7. 49 CFR 1572.203 - Transportation of explosives from Canada to the United States via railroad carrier.

    Science.gov (United States)

    2010-10-01

    ... United States via railroad carrier. 1572.203 Section 1572.203 Transportation Other Regulations Relating... Transportation of explosives from Canada to the United States via railroad carrier. (a) Applicability. This... railroad carrier may transport in commerce any explosive into the United States from Canada, via a train...

  8. 36 CFR 223.203 - Indirect substitution exception for National Forest System timber from within Washington State.

    Science.gov (United States)

    2010-07-01

    ... exception for National Forest System timber from within Washington State. 223.203 Section 223.203 Parks... Indirect substitution exception for National Forest System timber from within Washington State. (a... Washington State could have been acquired by a person otherwise covered by the prohibition against indirect...

  9. 17 CFR 275.203(b)(3)-2 - Methods for counting clients in certain private funds.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Methods for counting clients....203(b)(3)-2 Methods for counting clients in certain private funds. (a) For purposes of section 203(b)(3) of the Act (15 U.S.C. 80b-3(b)(3)), you must count as clients the shareholders, limited partners...

  10. 24 CFR 203.16 - Certificate and contract regarding use of dwelling for transient or hotel purposes.

    Science.gov (United States)

    2010-04-01

    ... use of dwelling for transient or hotel purposes. 203.16 Section 203.16 Housing and Urban Development... use of dwelling for transient or hotel purposes. Every application filed with respect to insurance of... housing or any part thereof covered by the mortgage for transient or hotel purposes, together with the...

  11. 40 CFR 2.203 - Notice to be included in EPA requests, demands, and forms; method of asserting business...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Notice to be included in EPA requests, demands, and forms; method of asserting business confidentiality claim; effect of failure to assert claim at time of submission. 2.203 Section 2.203 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...

  12. Rewiring of an Epithelial Differentiation Factor, miR-203, to Inhibit Human Squamous Cell Carcinoma Metastasis

    Directory of Open Access Journals (Sweden)

    Nathan Benaich

    2014-10-01

    Full Text Available Metastatic colonization of distant organs underpins the majority of human-cancer-related deaths, including deaths from head and neck squamous cell carcinoma (HNSCC. We report that miR-203, a miRNA that triggers differentiation in multilayered epithelia, inhibits multiple postextravasation events during HNSCC lung metastasis. Inducible reactivation of miR-203 in already established lung metastases reduces the overall metastatic burden. Using an integrated approach, we reveal that miR-203 inhibits metastasis independently of its effects on differentiation. In vivo genetic reconstitution experiments show that miR-203 inhibits lung metastasis by suppressing the prometastatic activities of three factors involved in cytoskeletal dynamics (LASP1, extracellular matrix remodeling (SPARC, and cell metabolism (NUAK1. Expression of miR-203 and its downstream effectors correlates with HNSCC overall survival outcomes, indicating the therapeutic potential of targeting this signaling axis.

  13. Effect of vitamin D on the intestinal absorption of /sup 203/Pb and /sup 47/Ca in chicks

    Energy Technology Data Exchange (ETDEWEB)

    Mykkaenen, H.M.; Wasserman, R.H.

    1982-03-01

    The transfer of /sup 203/Pb and/or /sup 47/Ca across the intestinal epithelium of the chick was investigated, with emphasis given to the functional role of cholecalciferol (vitamin D-3). /sup 203/Pb, after introduction in the intestinal lumen, is rapidly accumulated by the intestinal tissue, and only a fraction of /sup 203/ Pb is translocated parenterally (absorbed). Cholecalciferol did not significantly affect the accumulation of /sup 203/Pb by intestinal tissue but did accelerate /sup 203/Pb movement across the basal-lateral membrane. In contrast, cholecalciferol both decreased /sup 47/Ca tissue levels and increased /sup 47/Ca absorption. In rachitic chicks, the rate of absorption of /sup 203/Pb was greater in the distal than in the proximal segments of the intestine; after cholecalciferol repletion, the degree of absorption in all segments was similar, indicating the order of cholecalciferol effectiveness as duodenum greater than or equal to jejunum > ileum. An acute dose of 1,25(OH)/sub 2/D/sub 3/ to rachitic chicks also enhanced both /sup 203/Pb and /sup 47/Ca absorption, but the time course and pattern of absorption of these metal cations differed. The time at which the absorption of /sup 203/Pb peaked and returned to base-line occurred sooner than for /sup 47/Ca. Also the back-flux (blood ..-->.. intestinal lumen) of /sup 47/Ca was enhanced by cholecalciferol, whereas no effect on the back-flux of /sup 203/Pb was noted. These studies show that cholecalciferol and 1,25(OH)/sub 2/D/sub 3/ affects both the /sup 203/Pb and /sup 47/Ca absorptive processes, but the nature of these responses are not identical, suggesting differences in the transport path or the macromolecular interactions of these metal ions during the course of absorption, or both.

  14. 20 CFR 25.203 - How is the Special Schedule applied to non-resident aliens in the Territory of Guam?

    Science.gov (United States)

    2010-04-01

    ...-resident aliens in the Territory of Guam? 25.203 Section 25.203 Employees' Benefits OFFICE OF WORKERS... Compensation § 25.203 How is the Special Schedule applied to non-resident aliens in the Territory of Guam? (a... on or after July 1, 1971 in the Territory of Guam to non-resident alien employees recruited in...

  15. 30 CFR 203.55 - Under what conditions can my end-of-life royalty relief arrangement for an oil and gas lease be...

    Science.gov (United States)

    2010-07-01

    ... royalty relief arrangement for an oil and gas lease be ended? 203.55 Section 203.55 Mineral Resources... ROYALTY RATES OCS Oil, Gas, and Sulfur General Royalty Relief for End-Of-Life Leases § 203.55 Under what conditions can my end-of-life royalty relief arrangement for an oil and gas lease be ended? (a) If you have...

  16. 6 CFR 27.203 - Calculating the screening threshold quantity by security issue.

    Science.gov (United States)

    2010-01-01

    ... SECRETARY CHEMICAL FACILITY ANTI-TERRORISM STANDARDS Chemical Facility Security Program § 27.203 Calculating... chemicals of interest: (1) Used as a structural component; (2) Used as products for routine janitorial maintenance; (3) Contained in food, drugs, cosmetics, or other personal items used by employees; (4) In...

  17. 14 CFR 16.203 - Appearances, parties, and rights of parties.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Appearances, parties, and rights of parties... § 16.203 Appearances, parties, and rights of parties. (a) Appearances. Any party may appear and be heard in person. (1) Any party may be accompanied, represented, or advised by an attorney licensed by a...

  18. 30 CFR 285.203 - With whom will MMS consult before issuance of a lease?

    Science.gov (United States)

    2010-07-01

    ... OFFSHORE RENEWABLE ENERGY ALTERNATE USES OF EXISTING FACILITIES ON THE OUTER CONTINENTAL SHELF Issuance of OCS Renewable Energy Leases General Lease Information § 285.203 With whom will MMS consult before... conflicts among users and maximize the economic and ecological benefits of the OCS, including multifaceted...

  19. 24 CFR 888.203 - Use of contract rent automatic annual adjustment factors.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Use of contract rent automatic... RENTS AND CONTRACT RENT ANNUAL ADJUSTMENT FACTORS Contract Rent Annual Adjustment Factors § 888.203 Use of contract rent automatic annual adjustment factors. (a) To compute an adjustment to a Contract Rent...

  20. 7 CFR 1710.203 - Requirement to prepare a load forecast-distribution borrowers.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Requirement to prepare a load forecast-distribution... TO ELECTRIC LOANS AND GUARANTEES Load Forecasts § 1710.203 Requirement to prepare a load forecast... utility plant of $500 million or more must maintain an approved load forecast that meets the requirements...

  1. 49 CFR 1542.203 - Security of the air operations area (AOA).

    Science.gov (United States)

    2010-10-01

    ...) TRANSPORTATION SECURITY ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY AIRPORT SECURITY Operations § 1542.203 Security of the air operations area (AOA). (a) Each airport operator required to have a... 49 Transportation 9 2010-10-01 2010-10-01 false Security of the air operations area (AOA). 1542...

  2. 24 CFR 203.417 - Rate of interest of certificate of claim.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Rate of interest of certificate of... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Certificate of Claim § 203.417...

  3. 24 CFR 203.416 - Amount and items of certificate of claim.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Amount and items of certificate of... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Certificate of Claim § 203.416...

  4. 9 CFR 203.7 - Statement with respect to meat packer sales and purchase contracts.

    Science.gov (United States)

    2010-01-01

    ... AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE STATEMENTS OF GENERAL POLICY UNDER THE PACKERS AND STOCKYARDS ACT § 203.7 Statement with respect to meat packer sales and purchase contracts. (a) The Grain Inspection, Packers and Stockyards Administration (Packers...

  5. Difficulties detecting miRNA-203 in human whole saliva by the use of PCR

    National Research Council Canada - National Science Library

    Lundegard, Martin; Nylander, Karin; Danielsson, Karin

    2015-01-01

    .... Micro-RNAs are short non coding RNAs capable of regulating mRNA expression. MiRNA:scan be detected in tissue, blood and human whole saliva, HWS, and recently we have shown miR-203 to be up-regulated in tissue from OLP lesions...

  6. Radio diagnosis using 125I-fibrinogen and 203Hg-thymidine.

    Science.gov (United States)

    Zimmermann, M; Schmutz, H

    1976-12-30

    A comparative study of 125I-fibrinogen and 203Hg-thymidine using 144 Ehrlich carcinoma-bearing mice, indicates that tumor affinity of carrier substances with covalent labeling could be better used for scintigraphic tumor diagnosis. Halogenated or possibly metallo-organic compounds offer an alternative to the metal complexes in general use up to now.

  7. 75 FR 2925 - Sixteenth Plenary Meeting: RTCA Special Committee 203: Unmanned Aircraft Systems

    Science.gov (United States)

    2010-01-19

    ...: Unmanned Aircraft Systems. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 203: Unmanned Aircraft Systems. DATES: The meeting will be held February 16-18...: Unmanned Aircraft Systems meeting. The agenda will include: February 16, 2010 Opening Plenary Session...

  8. 24 CFR 203.268 - Pro rata payment of periodic MIP.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Pro rata payment of periodic MIP...-Periodic Payment § 203.268 Pro rata payment of periodic MIP. (a) If the insurance contract is terminated... rata MIP shall not be due or payable where the mortgagee notifies the Commissioner that foreclosure or...

  9. 24 CFR 203.319 - Pro rata payment of premiums and charges.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Pro rata payment of premiums and... § 203.319 Pro rata payment of premiums and charges. No contract of insurance shall be terminated until the mortgagee has paid to the Commissioner the pro rata portion of the current annual MIP or open-end...

  10. 32 CFR Appendix A to Part 203 - Technical Assistance for Public Participation Request Form

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Technical Assistance for Public Participation Request Form A Appendix A to Part 203 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS TECHNICAL ASSISTANCE FOR PUBLIC PARTICIPATION (TAPP) IN DEFENSE ENVIRONMENTAL RESTORATION ACTIVITIES...

  11. CNS histopathology on 203 bovines with clinical suspicion of BSE in Denmark 2001 to 2016

    DEFF Research Database (Denmark)

    Jensen, Tim Kåre

    2017-01-01

    During 2001 to 2016 a total of 203 bovines were submitted to the instutute with clinical suspicion of having BSE. In two cases BSE was confirmed. The most common differential diagnosis was listeriosis, found in 54% of the cases. Listeriosis was characterized by multifocal, necrotizing, non-suppur...

  12. 33 CFR 203.49 - Rehabilitation of Hurricane and Shore Protection Projects.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Rehabilitation of Hurricane and... DISASTER PROCEDURES Rehabilitation Assistance for Flood Control Works Damaged by Flood or Coastal Storm: The Corps Rehabilitation and Inspection Program § 203.49 Rehabilitation of Hurricane and Shore...

  13. 33 CFR 203.44 - Rehabilitation of non-Federal flood control works.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Rehabilitation of non-Federal... DISASTER PROCEDURES Rehabilitation Assistance for Flood Control Works Damaged by Flood or Coastal Storm: The Corps Rehabilitation and Inspection Program § 203.44 Rehabilitation of non-Federal flood control...

  14. 33 CFR 203.85 - Rehabilitation of Federal flood control projects.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Rehabilitation of Federal flood... PROCEDURES Local Interests/Cooperation Agreements § 203.85 Rehabilitation of Federal flood control projects... Rehabilitation Assistance. If the existing PCA does not adequately address responsibilities, then a CA will be...

  15. 33 CFR 203.45 - Rehabilitation of Federal flood control works.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Rehabilitation of Federal flood... PROCEDURES Rehabilitation Assistance for Flood Control Works Damaged by Flood or Coastal Storm: The Corps Rehabilitation and Inspection Program § 203.45 Rehabilitation of Federal flood control works. Rehabilitation of...

  16. 48 CFR 52.203-14 - Display of Hotline Poster(s).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Display of Hotline Poster... Clauses 52.203-14 Display of Hotline Poster(s). As prescribed in 3.1004(b), insert the following clause: Display of Hotline Poster(s) (DEC 2007) (a) Definition. United States, as used in this clause, means the...

  17. 24 CFR 203.421 - Allocation of Mutual Mortgage Insurance Fund income or loss.

    Science.gov (United States)

    2010-04-01

    ... Mortgage Insurance Fund and Distributive Shares § 203.421 Allocation of Mutual Mortgage Insurance Fund... of the entire Mutual Mortgage Insurance Fund, such net income or such loss to the General Surplus... into consideration all income received from fees, premiums and earnings on investments of the fund...

  18. 30 CFR 203.87 - What is in an engineering report?

    Science.gov (United States)

    2010-07-01

    ... Section 203.87 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE... concept (e.g., tension leg platform, fixed platform, floater type, subsea tieback, etc.) which includes: (1) Its size along with basic design specifications and drawings; and (2) The construction schedule...

  19. 7 CFR 205.203 - Soil fertility and crop nutrient management practice standard.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Soil fertility and crop nutrient management practice... Requirements § 205.203 Soil fertility and crop nutrient management practice standard. (a) The producer must... nutrients and soil fertility through rotations, cover crops, and the application of plant and animal...

  20. 33 CFR 203.42 - Inspection of non-Federal flood control works.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Inspection of non-Federal flood... PROCEDURES Rehabilitation Assistance for Flood Control Works Damaged by Flood or Coastal Storm: The Corps Rehabilitation and Inspection Program § 203.42 Inspection of non-Federal flood control works. (a) Required...

  1. 7 CFR 1744.203 - Establishing amount of rural development investment.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Establishing amount of rural development investment... INSURED TELEPHONE LOANS Borrower Investments § 1744.203 Establishing amount of rural development investment. For purposes of determining whether a rural development investment is within the limits of the...

  2. 42 CFR 50.203 - Sterilization of a mentally competent individual aged 21 or older.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Sterilization of a mentally competent individual... HUMAN SERVICES GRANTS POLICIES OF GENERAL APPLICABILITY Sterilization of Persons in Federally Assisted Family Planning Projects § 50.203 Sterilization of a mentally competent individual aged 21 or older...

  3. 7 CFR 22.203 - Major responsibilities under title VI, Sec. 603.

    Science.gov (United States)

    2010-01-01

    ... Roles and Responsibilities of Federal Government § 22.203 Major responsibilities under title VI, Sec... Secretary of Agriculture with providing leadership in the development of a nationwide rural development... sewage and solid waste management, and rural industrialization. (3) The Rural Development Service will...

  4. 21 CFR 203.38 - Sample lot or control numbers; labeling of sample units.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Sample lot or control numbers; labeling of sample... SERVICES (CONTINUED) DRUGS: GENERAL PRESCRIPTION DRUG MARKETING Samples § 203.38 Sample lot or control numbers; labeling of sample units. (a) Lot or control number required on drug sample labeling and sample...

  5. miR-203a is involved in HBx-induced inflammation by targeting Rap1a

    Energy Technology Data Exchange (ETDEWEB)

    Wu, AiRong [Department of gastroenterology, The First affiliated Hospital of Soochow University, Suzhou 215006 (China); Chen, Huo [Institutes of Biology and Medical Sciences, Soochow University, Suzhou 215123 (China); Xu, ChunFang [Department of gastroenterology, The First affiliated Hospital of Soochow University, Suzhou 215006 (China); Zhou, Ji; Chen, Si [Institutes of Biology and Medical Sciences, Soochow University, Suzhou 215123 (China); Shi, YuQi [Department of gastroenterology, The First affiliated Hospital of Soochow University, Suzhou 215006 (China); Xu, Jie [Institutes of Biology and Medical Sciences, Soochow University, Suzhou 215123 (China); Gan, JianHe, E-mail: j_pzhang@suda.edu.cn [Department of gastroenterology, The First affiliated Hospital of Soochow University, Suzhou 215006 (China); Zhang, JinPing, E-mail: ganjianhe@aliyun.com [Institutes of Biology and Medical Sciences, Soochow University, Suzhou 215123 (China)

    2016-11-15

    Hepatitis B virus (HBV) causes acute and chronic hepatitis, and is one of the major causes of cirrhosis and hepatocellular carcinoma. Accumulating evidence suggests that inflammation is the key factor for liver cirrhosis and hepatocellular carcinoma. MicroRNAs play important roles in many biological processes. Here, we aim to explore the function of microRNAs in the HBX-induced inflammation. First, microarray experiment showed that HBV{sup +} liver samples expressed higher level of miR-203a compared to HBV{sup -} liver samples. To verify these alterations, HBx-coding plasmid was transfected into HepG2 cells to overexpress HBx protein. The real-time PCR results suggested that over-expression of HBx could induce up-regulation of miR-203a. To define how up-regulation of miR-203a can induce liver cells inflammation, we over-expressed miR-203a in HepG2 cells. Annexin V staining and BrdU staining suggested that overexpression of miR-203a significantly increased the cell apoptosis and proliferation, meanwhile, over-expression of miR-203a could lead to a decrease in G0/G1 phase cells and an increase in G2/M phase cells. Some cytokines production including IL-6 and IL-8 were significantly increased, but TGFβ and IFNγ were decreased in miR-203a over-expressed HepG2 cells. Luciferase reporter assay experiments, protein mass-spectrum assay and real-time PCR all together demonstrated that Rap1a was the target gene of miR-203a. Further experiments showed that these alterations were modulated through PI3K/ERK/p38/NFκB pathways. These data suggested that HBV-infection could up-regulate the expression of miR-203a, thus down regulated the expression of Rap1a and affected the PI3K/ERK/p38/NFκB pathways, finally induced the hepatitis inflammation. - Highlights: • HBX induces the over-expression of miR-203a in HepG2 cells. • miR-203a targets Rap1a to induce the inflammation in HepG2 cells. • miR-203a regulates the apoptosis and cell cycles of HepG2 cells. • miR-203a alters

  6. Basophil sensitivity through CD63 or CD203c is a functional measure for specific immunotherapy

    Directory of Open Access Journals (Sweden)

    Dahl Ronald

    2010-02-01

    Full Text Available Abstract Background Subcutaneous Immunotherapy (SCIT modifies the allergic response and relieves allergic symptoms. SCIT is the only and a very effective treatment for insect venom allergy. We hypothesized that basophil sensitivity, measured through the basophil activation test, would decrease during SCIT up dosing. Expression of CD203c was compared to CD63 as marker for basophil activation, using a Bland Altman plot and ROC curves. Methods Patients (n = 18 starting subcutaneous SCIT for wasp allergy with an up dosing scheme of 7 to 11 weeks were enrolled. Heparinised blood samples were drawn at weeks 1-4, 7 and at the first maintenance visit. Basophils were stimulated at 7 log dilutions of V. vespula allergen for 15 min, and were stained with CD203c and CD63. Basophils were identified as CD203c+ leukocytes, and the proportion of CD63+ and CD203c+ cells were plotted against allergen concentration. A sigmoid curve was fitted to the points, and the allergen concentration at which half of the maximal activation was achieved, LC50, was calculated. In another series of experiments, LC50 calculated in whole blood (AP was subtracted from LC50 calculated with basophils suspended in plasma from a nonatopic donor (HS to determine the protective effect of soluble factors in blood of patients treated with SCIT. Results Heparin blood basophil activation was similar through CD63 and CD203c. Basophils were significantly more sensitized three weeks after initiation of SCIT compared to baseline (p Conclusion Basophil activation is a versatile and sensitive tool that measures changes in the humoral immune response to allergen during SCIT.

  7. In Vitro Antitumor Effects of AHR Ligands Aminoflavone (AFP 464) and Benzothiazole (5F 203) in Human Renal Carcinoma Cells.

    Science.gov (United States)

    Luzzani, Gabriela A; Callero, Mariana A; Kuruppu, Anchala I; Trapani, Valentina; Flumian, Carolina; Todaro, Laura; Bradshaw, Tracey D; Loaiza Perez, Andrea I

    2017-12-01

    We investigated activity and mechanism of action of two AhR ligand antitumor agents, AFP 464 and 5F 203 on human renal cancer cells, specifically examining their effects on cell cycle progression, apoptosis, and migration. TK-10, SN12C, Caki-1, and ACHN human renal cancer cell lines were treated with AFP 464 and 5F 203. We evaluated cytotoxicity by MTS assays, cell cycle arrest, and apoptosis by flow cytometry and corroborated a mechanism of action involving AhR signal transduction activation. Changes in migration properties by wound healing assays were investigated: 5F 203-sensitive cells show decreased migration after treatment, therefore, we measured c-Met phosphorylation by Western blot in these cells. A 5F 203 induced a decrease in cell viability which was more marked than AFP 464. This cytotoxicity was reduced after treatment with the AhR inhibitor α-NF for both compounds indicating AhR signaling activation plays a role in the mechanism of action. A 5F 203 is sequestered by TK-10 cells and induces CYP1A1 expression; 5F 203 potently inhibited migration of TK-10, Caki-1, and SN12C cells, and inhibited c-Met receptor phosphorylation in TK-10 cells. AhR ligand antitumor agents AFP 464 and 5F 203 represent potential new candidates for the treatment of renal cancer. A 5F 203 only inhibited migration of sensitive cells and c-Met receptor phosphorylation in TK-10 cells. c-Met receptor signal transduction is important in migration and metastasis. Therefore, we consider that 5F 203 offers potential for the treatment of metastatic renal carcinoma. J. Cell. Biochem. 118: 4526-4535, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  8. 75 FR 44198 - Implementation of Section 203 of the Satellite Television Extension and Localism Act of 2010...

    Science.gov (United States)

    2010-07-28

    ...,'' even though the law was enacted by Presidential signature on May 27, 2010. STELA sec. 307. Congress...'' provisions (see STELA secs. 203, 103). Finally, also relevant are certain remarks made in floor statements in...

  9. Pump-limited, 203 W, single-frequency monolithic fiber amplifier based on laser gain competition.

    Science.gov (United States)

    Zeringue, Clint; Vergien, Christopher; Dajani, Iyad

    2011-03-01

    We present high power results of a Yb-doped fiber amplifier seeded with a combination of broad and single-frequency laser signals. This two-tone concept was used in conjunction with externally applied or intrinsically formed thermal gradients to demonstrate combined stimulated Brillouin scattering suppression in a copumped monolithic, polarization-maintaining (PM) fiber. Depending on the input parameters and the thermal gradient, the output power of the single-frequency signal ranged from 80 to 203 W with slope efficiencies from 70% to 80%. The 203 W amplifier was pump limited and is, to the best of our knowledge, the highest reported in the literature for monolithic, PM single-frequency fiber amplifiers.

  10. Comparative analysis of the complete genome of an epidemic hospital sequence type 203 clone of vancomycin-resistant Enterococcus faecium

    Science.gov (United States)

    2013-01-01

    Background In this report we have explored the genomic and microbiological basis for a sustained increase in bloodstream infections at a major Australian hospital caused by Enterococcus faecium multi-locus sequence type (ST) 203, an outbreak strain that has largely replaced a predecessor ST17 sequence type. Results To establish a ST203 reference sequence we fully assembled and annotated the genome of Aus0085, a 2009 vancomycin-resistant Enterococcus faecium (VREfm) bloodstream isolate, and the first example of a completed ST203 genome. Aus0085 has a 3.2 Mb genome, comprising a 2.9 Mb circular chromosome and six circular plasmids (2 kb–130 kb). Twelve percent of the 3222 coding sequences (CDS) in Aus0085 are not present in ST17 E. faecium Aus0004 and ST18 E. faecium TX16. Extending this comparison to an additional 12 ST17 and 14 ST203 E. faecium hospital isolate genomes revealed only six genomic regions spanning 41 kb that were present in all ST203 and absent from all ST17 genomes. The 40 CDS have predicted functions that include ion transport, riboflavin metabolism and two phosphotransferase systems. Comparison of the vancomycin resistance-conferring Tn1549 transposon between Aus0004 and Aus0085 revealed differences in transposon length and insertion site, and van locus sequence variation that correlated with a higher vancomycin MIC in Aus0085. Additional phenotype comparisons between ST17 and ST203 isolates showed that while there were no differences in biofilm-formation and killing of Galleria mellonella, ST203 isolates grew significantly faster and out-competed ST17 isolates in growth assays. Conclusions Here we have fully assembled and annotated the first ST203 genome, and then characterized the genomic differences between ST17 and ST203 E. faecium. We also show that ST203 E. faecium are faster growing and can out-compete ST17 E. faecium. While a causal genetic basis for these phenotype differences is not provided here, this study revealed conserved genetic

  11. Tank 241-T-203, core 190 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Steen, F.H.

    1997-08-05

    This document is the analytical laboratory report for tank 241-T-203 push mode core segments collected on April 17, 1997 and April 18, 1997. The segments were subsainpled and analyzed in accordance with the Tank 241-T-203 Push Mode Core Sampling andanalysis Plan (TSAP) (Schreiber, 1997a), the Safety Screening Data Quality Objective (DQO)(Dukelow, et al., 1995) and Leffer oflnstructionfor Core Sample Analysis of Tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204 (LOI)(Hall, 1997). The analytical results are included in the data summary report (Table 1). None of the samples submitted for Differential Scanning Calorimetry (DSC), Total Alpha Activity (AT) and Total Organic Carbon (TOC) exceeded notification limits as stated in the TSAP (Schreiber, 1997a). The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems (TWRS) Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997b) and not considered in this report.

  12. Development of a new radiolabel (lead-203) and new chelating agents for labeling monoclonal anntibodies for imaging

    Energy Technology Data Exchange (ETDEWEB)

    Srivastava, S.C.; Mease, R.C.; Meinken, G.E.; Mausner, L.F.; Steplewski, Z.

    1988-01-01

    High liver uptake and slow body clearance presently limit the usefulness of /sup 111/In labeled antibodies for tumor imaging. We have investigated /sup 203/Pb as an alternate and better antibody label. The DTPA and cyclohexyl EDTA (CDTA) conjugates of an anticolon carcinoma antibody, 17-1A were labeled (bicyclic anhydride method) with /sup 203/Pb and /sup 111/In with 60 and 90% labeling yields, respectively. The biodistribution of /sup 203/Pb-17-1A conjugates was compared with the corresponding /sup 111/In-labeled preparations and with /sup 203/Pb-DTPA, /sup 203/Pb-nitrate and nonrelevant antibody controls in normal and human tumor (SW948) xenografted nude mice at 24, and 96 hr. Lead-203-labeled CDTA and DTPA antibody conjugates gave similar in vivo distributions. Even though the lead bound to these chelate-antibody conjugates was more labile in serum and in vivo, compared to indium, it cleared much faster from the liver and the whole body. A new series of chelating agents based on the incorporation of a trans-1,2- diaminocyclohexane moiety into the carbon backbone of polyaminocarboxylates is being synthesized. These are expected to provide stronger complexing ability for lead and produce greater in vivo stability. These ligands are also expected to be superior to EDTA and DTPA for labeling antibodies with other radiometals, including indium. 32 refs., 3 tabs.

  13. miR-203 inhibition of renal cancer cell proliferation, migration and invasion by targeting of FGF2.

    Science.gov (United States)

    Xu, Mingxi; Gu, Meng; Zhang, Ke; Zhou, Jun; Wang, Zhong; Da, Jun

    2015-04-09

    Renal cell carcinoma (RCC) is one of the leading causes of cancer related mortality worldwide. Increasing evidence has shown that microRNAs function as oncogenes or tumor suppressors in human malignancies, but the roles of miR-203 in human RCC is still unclear. First, quantitative real-time PCR (qRT-PCR) was performed to detect miR-203 expression in renal cancer cell lines and clear cell RCC (ccRCC) specimens. Then, the association of miR-203 expression with clinicopathological features and survival was later analyzed. Finally, the roles of miR-203 in regulation of tumor proliferation, migration, invasion, and target gene expression were further investigated. Our study showed miR-203 was down-regulated in renal cancer cell lines and ccRCC specimens (P renal cancer cell growth and metastasis (P renal cancer cell growth and metastasis (P renal cancer cells. Our study suggested that miR-203 could be a potential prognostic marker and functions as a tumor suppressor in human renal cancer by post-transcriptionally targeting FGF2. The virtual slide(s) for this article can be found here: http://www.diagnosticpathology.diagnomx.eu/vs/6828145701534108 .

  14. miR-203 inhibits augmented proliferation and metastasis of hepatocellular carcinoma residual in the promoted regenerating liver.

    Science.gov (United States)

    Zheng, Xiao-Bo; Chen, Xiao-Bo; Xu, Liang-Liang; Zhang, Ming; Feng, Lei; Yi, Peng-Sheng; Tang, Jian-Wei; Xu, Ming-Qing

    2017-03-01

    Liver resection is still the most commonly used therapeutic treatment for hepatocellular carcinoma (HCC), and liver regeneration promotes HCC growth in the regenerating liver. The high recurrence/metastasis of HCC is the main cause of death for HCC patients after liver resection. However, how the augmented growth and metastasis of residual HCC induced by the promoted liver regeneration following liver resection can be abolished remains unclear. In this study, a rat model with liver cirrhosis and diffused HCC was established by administration of diethylnitrosamine. Recombinant miR-203 adenovirus was administered to induce hepatic miR-203 overexpression and 30% partial hepatectomy (PH) followed. The effect of miR-203 on the proliferation, invasion and metastasis of the residual HCC in the remnant cirrhotic liver with promoted regeneration was investigated. We found that the basic spontaneous regeneration of the non-tumorous liver by 30% PH promoted proliferation, invasion and lung metastasis of the hepatic residual HCC. miR-203 overexpression further promoted the regeneration of the non-tumorous liver by upregulating Ki67 expression and enhancing IL-6/SOCS3/STAT3 pro-proliferative signals. Importantly, miR-203 overexpression markedly inhibited the proliferation, invasion and metastasis of hepatic residual HCC through suppressing expression of Ki67, CAPNS1 and lung metastasis. Moreover, it was found that miR-203 overexpression reversed the epithelial-mesenchymal transition induced by hepatectomy through targeting IL-1β, Snail1 and Twist1. In conclusion, our results suggested that miR-203 overexpression inhibited the augmented proliferation and lung metastasis of the residual HCC induced by the promoted liver regeneration following PH partly by regulating epithelial-mesenchymal transition. © 2017 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.

  15. Excitation functions of $^{nat}$Pb(d,x)$^{206,205,204,203,202}$Bi, $^{203cum,202m,201cum}$Pb and $^{202cum,201cum}$Tl reactions up to 50 MeV

    OpenAIRE

    Ditrói, F.; Tárkányi, F.; Takács, S.; Hermanne, A.; Ignatyuk, A. V.

    2014-01-01

    Cross-sections of deuteron induced nuclear reactions on lead were measured up to 50 MeV using the standard stacked foil irradiation technique and high resolution $\\gamma$-ray spectrometry. Experimental cross-sections and derived integral yields are presented for the $^{nat}$Pb(d,x)$^{206,205,204,203,202}$Bi, $^{203cum,202m,201cum}$Pb and $^{202cum,201cum}$Tl reactions. The experimental data were compared with the results from literature and with the data in the TENDL-2013 library (obtained wi...

  16. Probing the energy structure of positronium with a 203 GHz Fabry-Perot Cavity

    Energy Technology Data Exchange (ETDEWEB)

    Suehara, T; Namba, T; Kobayashi, T [International Center for Elementary Particle Physics (ICEPP), University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo, 113-0033 (Japan); Miyazaki, A; Ishida, A; Asai, S [Department of Physics, Graduate School of Science, University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo, 133-0033 (Japan); Saito, H [Department of General Systems Studies, Graduate School of Arts and Sciences, University of Tokyo, 3-8-1 Komaba, Meguro-ku, Tokyo, 153-8902 (Japan); Yoshida, M [Accelerator Laboratory, High Energy Accelerator Research Organization (KEK), 1-1 Oho, Tsukuba, Ibaraki, 305-0801 (Japan); Idehara, T; Ogawa, I; Kobayashi, S; Urushizaki, Y [Research Center for Development of Far-Infrared Region, University of Fukui (FIR-FU), 3-9-1 Bunkyo, Fukui, Fukui, 910-8507 (Japan); Sabchevski, S, E-mail: suehara@icepp.s.u-tokyo.ac.j [Bulgarian Academy of Science, 1, 15 Noemvri Str., 1040 Sofia (Bulgaria)

    2010-01-01

    Positronium is an ideal system for the research of the bound state QED. The hyperfine splitting of positronium (Ps-HFS: about 203 GHz) is sensitive to new physics beyond the Standard Model via a vacuum oscillation between an ortho-Ps and a virtual photon. Previous experimental results of the Ps-HFS show 3.9 {sigma} (15 ppm) discrepancy from the QED calculation. All previous experiments used an indirect method with static magnetic field to cause Zeeman splitting (a few GHz) between triplet states of ortho-Ps, from which the HFS value was derived. One possible systematic error source of the indirect method is the static magnetic field. We are developing a new direct measurement system of the Ps-HFS without static magnetic field. In this measurement we use a gyrotron, a novel sub-THz light source, with a high-finesse Fabry-Perot cavity to obtain enough radiation power at 203 GHz. The present status of the optimization studies and current design of the experiment are described.

  17. 24 CFR 203.43h - Eligibility of mortgages on Indian land insured pursuant to section 248 of the National Housing Act.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Eligibility of mortgages on Indian land insured pursuant to section 248 of the National Housing Act. 203.43h Section 203.43h Housing and... mortgages on Indian land insured pursuant to section 248 of the National Housing Act. A mortgage covering a...

  18. 9 CFR 203.16 - Mailing of checks in payment for livestock purchased for slaughter, for cash and not on credit.

    Science.gov (United States)

    2010-01-01

    ... livestock purchased for slaughter, for cash and not on credit. 203.16 Section 203.16 Animals and Animal... of checks in payment for livestock purchased for slaughter, for cash and not on credit. (a) The Grain... sells livestock to a packer, market agency, or dealer, who is purchasing for slaughter, may not intend...

  19. MiR-182 and miR-203 induce mesenchymal to epithelial transition and self-sufficiency of growth signals via repressing SNAI2 in prostate cells.

    Science.gov (United States)

    Qu, Yi; Li, Wen-Cheng; Hellem, Margrete Reime; Rostad, Kari; Popa, Mihaela; McCormack, Emmet; Oyan, Anne Margrete; Kalland, Karl-Henning; Ke, Xi-Song

    2013-08-01

    MicroRNAs play critical roles in tumorigenesis and metastasis. Here, we report the dual functions of miR-182 and miR-203 in our previously described prostate cell model. MiR-182 and miR-203 were completely repressed during epithelial to mesenchymal transition (EMT) from prostate epithelial EP156T cells to the progeny mesenchymal nontransformed EPT1 cells. Re-expression of miR-182 or miR-203 in EPT1 cells and prostate cancer PC3 cells induced mesenchymal to epithelial transition (MET) features. Simultaneously, miR-182 and miR-203 provided EPT1 cells with the ability to self-sufficiency of growth signals, a well-recognized oncogenic feature. Gene expression profiling showed high overlap of the genes affected by miR-182 and miR-203. SNAI2 was identified as a common target of miR-182 and miR-203. Knock-down of SNAI2 in EPT1 cells phenocopied re-expression of either miR-182 or miR-203 regarding both MET and self-sufficiency of growth signals. Strikingly, considerable overlaps of changed genes were found between the re-expression of miR-182/203 and knock-down of SNAI2. Finally, P-cadherin was identified as a direct target of SNAI2. We conclude that miR-182 and miR-203 induce MET features and growth factor independent growth via repressing SNAI2 in prostate cells. Our findings shed new light on the roles of miR-182/203 in cancer related processes. Copyright © 2013 UICC.

  20. MicroRNA-203 Is a Prognostic Indicator in Bladder Cancer and Enhances Chemosensitivity to Cisplatin via Apoptosis by Targeting Bcl-w and Survivin.

    Directory of Open Access Journals (Sweden)

    Xin Zhang

    Full Text Available Resistance to cisplatin-based chemotherapy is a major cause of treatment failure in advanced bladder cancer (BC patients. There is increasing evidence that microRNAs are involved in the development and progression of BC. However, little is known about the function of microRNAs in predicting the effect of adjuvant chemotherapy on BC survival and regulating response to cisplatin. To address this issue, we employed RT-qPCR to evaluate the clinical significance of miR-203 expression in 108 tissues of BC patients receiving cisplatin-based adjuvant chemotherapy, and performed in vitro studies to explore chemotherapeutic sensitivity to cisplatin in miR-203 overexpressing BC cells. We found miR-203 levels were significantly lower in BC progression group than non-progression group (P<0.001. ROC curve analysis illustrated miR-203 could significantly distinguish progressed patients from those without progression (P<0.001, yielding an area under the ROC curve of 0.839 (95% CI, 0.756-0.903. Moreover, low miR-203 expression correlated with shortened progression free survival (PFS and overall survival (OS of BC patients, and was an independent prognostic factor. Overexpression of miR-203 in 5637 and T24 BC cells could decrease cell viability, enhance cisplatin cytotoxicity, and promote apoptosis. Western blotting and luciferase reporter assay showed Bcl-w and Survivin were direct downstream targets of miR-203. There was also a significant inverse association between miR-203 and Bcl-w or Survivin expression in BC tissues (r = -0.781, -0.740, both P<0.001. In conclusion, decreased miR-203 predicts progression and poor prognosis for BC patients treated with cisplatin-based chemotherapy while miR-203 overexpression can enhance cisplatin sensitization by promoting apoptosis via directly targeting Bcl-w and Survivin.

  1. 9 CFR 203.19 - Statement with respect to packers engaging in the business of livestock dealers or buying agencies.

    Science.gov (United States)

    2010-01-01

    ... Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE STATEMENTS OF GENERAL POLICY UNDER THE PACKERS AND STOCKYARDS ACT § 203.19... its administration of the Packers and Stockyards Act, the Grain Inspection, Packers and Stockyards...

  2. 9 CFR 203.5 - Statement with respect to market agencies paying the expenses of livestock buyers.

    Science.gov (United States)

    2010-01-01

    ... INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE STATEMENTS OF GENERAL POLICY UNDER THE PACKERS AND STOCKYARDS ACT § 203.5 Statement with respect... long distance telephone calls. Investigation by the Grain Inspection, Packers and Stockyards...

  3. 9 CFR 203.18 - Statement with respect to packers engaging in the business of custom feeding livestock.

    Science.gov (United States)

    2010-01-01

    ... GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE STATEMENTS OF GENERAL POLICY UNDER THE PACKERS AND STOCKYARDS ACT § 203.18 Statement with respect... Packers and Stockyards Act, the Grain Inspection, Packers and Stockyards Administration (Packers and...

  4. Hyper-methylated miR-203 dysregulates ABL1 and contributes to the nickel-induced tumorigenesis.

    Science.gov (United States)

    Zhang, Jing; Zhou, Yang; Wu, You-Jun; Li, Meng-Jie; Wang, Rui-Jin; Huang, Shun-Quan; Gao, Rong-Rong; Ma, Lin; Shi, Hong-Jun; Zhang, Jun

    2013-10-23

    Nickel compounds have been found to be carcinogenic based upon epidemiological, animal and cell culture studies. Previous studies suggest that epigenetic mechanisms play a role in Nickel-induced carcinogenesis such as DNA methylation and histone modification. In this study, we investigated the role of microRNAs (miRNAs) in nickel-induced carcinogenesis. The expression of several miRNAs which may function as tumor suppressor genes revealed a strong downregulation of miR-203 in Ni3S2-transformed 16HBE cells (NSTCs). Meanwhile, we observed hypermethylation of CpGs in miR-203 promoter and first exon area, and proved that the hyper-methylated miR-203 was involved in the Nickel-induced tumorigenesis. Moreover, we identified that miR-203 may suppress the tumorigenesis at least in part through negatively regulating its target gene ABL1. Our findings indicate that DNA methylation-associated silencing of tumor suppressor miRNAs contributes to the development of Nickel-induced cancer. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  5. 49 CFR 40.203 - What problems cause a drug test to be cancelled unless they are corrected?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false What problems cause a drug test to be cancelled... PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Problems in Drug Tests § 40.203 What problems cause a drug test to be cancelled unless they are corrected? (a) As the MRO, when a...

  6. 75 FR 31762 - Foreign-Trade Zone 203; Application for Subzone Authority; REC Silicon; Invitation for Public...

    Science.gov (United States)

    2010-06-04

    ... silicon metal subject to AD/ CVD orders at this plant and others in the industry, and the resulting price... Foreign-Trade Zones Board Foreign-Trade Zone 203; Application for Subzone Authority; REC Silicon... Corporation to establish a subzone at the REC Silicon facility in Moses Lake, Washington (Docket 22-2009). The...

  7. 75 FR 72968 - Implementation of Section 203 of the Satellite Television Extension and Localism Act of 2010...

    Science.gov (United States)

    2010-11-29

    ... Presidential signature on May 27, 2010. STELA sec. 307. Congress passed four short-term extensions of the... the House and Senate bills. (see STELA secs. 203, 103). Finally, also relevant are certain remarks...) (``Senate Floor Debate''). We also find relevant certain remarks made in floor statements in passing the...

  8. 21 CFR 203.36 - Fulfillment houses, shipping and mailing services, comarketing agreements, and third-party...

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Fulfillment houses, shipping and mailing services... Samples § 203.36 Fulfillment houses, shipping and mailing services, comarketing agreements, and third... manufacturer or authorized distributor of record that uses a fulfillment house, shipping or mailing service, or...

  9. 29 CFR 779.203 - Distinction between “enterprise,” “establishment,” and “employer.”

    Science.gov (United States)

    2010-07-01

    ... Apply; Enterprise Coverage Enterprise; the Business Unit § 779.203 Distinction between “enterprise... employee. (See § 779.19.) The term establishment means a distinct physical place of business rather than an entire business or enterprise. (See § 779.23.) The term enterprise was not used in the Act prior to the...

  10. Laser Safety Evaluation of the Oscmar M203PI Grenade Launcher Simulator (GLS) and the Associated Umpire Control Gun

    Energy Technology Data Exchange (ETDEWEB)

    AUGUSTONI, ARNOLD L.

    2002-06-01

    A laser safety evaluation and pertinent output measurements were performed (during March and April 2002) on the M203PI Grenade Launcher Simulator (GLS) and its associated Umpire Control Gun manufactured by Oscmar International Limited, Auckland, New Zealand. The results were the Oscmar Umpire Gun is laser hazard Class 1 and can be used without restrictions. The radiant energy output of the Oscmar M203PI GLS, under ''Small Source'' criteria at 10 centimeters, is laser hazard Class 3b and not usable, under SNL policy, in force-on-force exercises. However, due to a relatively large exit diameter and an intentionally large beam divergence, to simulate a large area blast, the output beam geometry met the criteria for ''Extended Source'' viewing [ANSI Std. 2136.1-2000 (S.l)]. Under this ''Extended Source'' criteria the output of the M203PI GLS unit was, in fact, laser hazard Class 1 (eye safe), for 3 of the 4 possible modes of laser operation. The 4'h mode, ''Auto Fire'', which simulates a continuous grenade firing every second and is not used at SNL, was laser hazard Class 3a (under the ''Extended Source'' viewing criteria). The M203PI GLS does present a laser hazard Class 3a to aided viewing with binoculars inside 3 meters from the unit. Farther than 3 meters it is ''eye safe''. The M203PI GLS can be considered a Class 1 laser hazard and can be used under SNL policy with the following restrictions: (1) The M203PI GLS unit shall only be programmed for: the ''Single Fire'' (which, includes ''Rapid Fire'') and the ''Auto Align'' (used in adjusting the alignment of the grenade launcher simulator system to the target) modes of operation. (2) The M203PI GLS shall never be directed against personnel, using binoculars, inside of 3 meters. DOE Order 5480.16A, Firearms Safety, (Chapter 1)(5)(a)(8

  11. Proteus mirabilis RMS 203 as a new representative of the O13 Proteus serogroup.

    Science.gov (United States)

    Palusiak, Agata; Siwińska, Małgorzata; Zabłotni, Agnieszka

    2015-01-01

    The unique feature of some Proteus O-polysaccharides is occurrence of an amide of galacturonic acid with N(ε)-[(S/R)-1-Carboxyethyl]-L-lysine, GalA6(2S,8S/R-AlaLys). The results of the serological studies presented here, with reference to known O-antigens structures suggest that GalA6(2S,8S/R-AlaLys) or 2S,8R-AlaLys contribute to cross-reactions of O13 Proteus antisera, and Proteeae LPSs. It was also revealed that the Proteus mirabilis RMS 203 strain can be classified into the O13 serogroup, represented so far by two strains: Proteus mirabilis 26/57 and Proteus vulgaris 8344. The O13 LPS is a serologically important antigen with a fragment common to LPSs of different species in the Proteeae tribe.

  12. London penetration depth and thermal fluctuations in the sulphur hydride 203 K superconductor

    Energy Technology Data Exchange (ETDEWEB)

    Talantsev, E.F.; Crump, W.P. [Robinson Research Institute, Victoria University of Wellington, Lower Hutt (New Zealand); Storey, J.G.; Tallon, J.L. [Robinson Research Institute, Victoria University of Wellington, Lower Hutt (New Zealand); MacDiarmid Institute for Advanced Materials and Nanotechnology, Lower Hutt (New Zealand)

    2017-03-15

    Recently, compressed H{sub 2}S has been shown to become superconducting at 203 K under a pressure of 155 GPa. One might expect fluctuations to dominate at such temperatures. Using the magnetisation critical current, we determine the ground-state London penetration depth, λ{sub 0} = 189 nm, and the superconducting energy gap, Δ{sub 0} = 27.8 meV, and find these parameters are similar to those of cuprate superconductors. We also determine the fluctuation temperature scale, T{sub fluc} = 1470 K, which shows that, unlike the cuprates, T{sub c} of the hydride is not limited by fluctuations. This is due to its three dimensionality and suggests the search for better superconductors should refocus on three-dimensional systems where the inevitable thermal fluctuations are less likely to reduce the observed T{sub c}. (copyright 2016 by WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  13. Hypersonic characteristics of an advanced aerospace plane at Mach 20.3

    Science.gov (United States)

    Mccandless, R. S.

    1985-01-01

    Wind-tunnel studies have been performed in the Langley Hypersonic Helium Tunnel Facility to obtain static longitudinal and lateral-directional aerodynamic characteristics of an advanced aerospace plane concept. The nominal test conditions are a Mach number of 20.3 and a Reynolds number of 6.8 x 10 to the 6th power per foot at angles of attack from 0 to 25 deg and angles of sideslip of -3 and 0 deg. Stability and control characteristics are obtained for several deflections of the elevators, elevons, and rudder. In addition, a modified canopy is examined. The results indicate that this vehicle is longitudinally stable at angles of attack near the maximum lift-drag ratio. Also, the vehicle is shown to be directionally unstable with positive dihedral effect.

  14. The SO-20.3 MC&A modernization plan final report.

    Energy Technology Data Exchange (ETDEWEB)

    Longmire, V. L. (Victoria L.); Ensslin, Norbert; Files, C. (Chistina); Joseph, Joshua A., Jr.; Rudy, C. R. (Clifford R.); Smith, M. K. (Morag K.); Russo, P. A. (Phyllis A.); Stevens, R. S. (Rebecca S.); Strittmatter, R. B. (Richard B.); Wilkey, D. D. (David Dennis); Pickett, C. (Chris); Brosey, W. (William); Swanson, J. (Joel)

    2004-01-01

    Materials Control and Accountability (MC&A) provides assurance to the nation that nuclear materials are controlled in accordance with their strategic and economic importance and that the misuse, theft or diversion of these materials will be detected. MC&A plays an important part in security at nuclear facilities, especially in addressing threats such as theft of materials, environmental contamination, and nuclear safety incidents associated with nuclear materials. For this reason, it is important that MC&A takes advantage of new technologies and methods in order to provide information on a site's nuclear materials in the most timely and useful manner possible. Within the U.S. Department of Energy (DOE), the Office of Security Policy, Policy Integration and Technical Support Program (SO-20.3) is responsible for the development of safeguards and security technology that enables DOE and NNSA facilities to safeguard their Special Nuclear Materials. The SO-20.3 Program tasked safeguards personnel at Los Alamos National Laboratory to lead a project with representatives from the Y-12 Plant, Lawrence Livermore National Laboratory, and the Savannah River Site to prepare an MC&A Modernization Plan that provides recommendations for development new technologies and methodologies for MC&A in both new and existing DOE facilities. The team was tasked with taking into account new concerns about the protection of nuclear material following the attacks of September 11, 2001. Opportunities for applying new MC&A approaches and technologies that provide increased freedom of operation, increased security and provide a potential for cost savings in existing and new DOE facilities are discussed in this report.

  15. Diurnal variation in cholesterol 7?-hydroxylase activity is determined by the -203A>C polymorphism of the CYP7A1 gene

    OpenAIRE

    Vlachov?, Milu?e; Blahov?, Tereza; L?nsk?, V?ra; Len??ek, Martin; Pi?ha, Jan; V?tek, Libor; Kov??, Jan

    2016-01-01

    Aim To determine whether the promoter polymorphism -203A>C of cholesterol-7α-hydroxylase encoding gene (CYP7A1) affects diurnal variation in CYP7A1 enzyme activity. Methods The study included 16 healthy male volunteers – 8 homozygous for -203A and 8 homozygous for the -203C allele of CYP7A1. Three 15-hour examinations (from 7am to 10pm) were carried out for each of the participants: after one-day treatment with cholestyramine; after one-day treatment with chenodeoxycho...

  16. β-delayed γ-ray spectroscopy of 203,204Au and 200-202Pt

    Science.gov (United States)

    Morales, A. I.; Benlliure, J.; Górska, M.; Grawe, H.; Verma, S.; Regan, P. H.; Podolyák, Zs.; Pietri, S.; Kumar, R.; Casarejos, E.; Algora, A.; Alkhomashi, N.; Álvarez-Pol, H.; Benzoni, G.; Blazhev, A.; Boutachkov, P.; Bruce, A. M.; Cáceres, L. S.; Cullen, I. J.; Denis Bacelar, A. M.; Doornenbal, P.; Estévez-Aguado, M. E.; Farrelly, G.; Fujita, Y.; Garnsworthy, A. B.; Gelletly, W.; Gerl, J.; Grebosz, J.; Hoischen, R.; Kojouharov, I.; Kurz, N.; Lalkovski, S.; Liu, Z.; Mihai, C.; Molina, F.; Mücher, D.; Prokopowicz, W.; Rubio, B.; Schaffner, H.; Steer, S. J.; Tamii, A.; Tashenov, S.; Valiente-Dobón, J. J.; Walker, P. M.; Wollersheim, H. J.; Woods, P. J.

    2013-07-01

    The β decay of five heavy, neutron-rich nuclei, 203,204Pt and 200-202Ir, has been investigated following relativistic cold fragmentation reactions of lead projectiles using the FRS+RISING setup at GSI. This paper reports on the study of the low-lying states in the decay daughter nuclei 203,204Au and 200-202Pt. The characteristic γ rays for each nucleus have been determined using β-delayed γ-ray spectroscopy. Tentative level schemes, relative intensities, and apparent β feedings are provided. These data are compared with shell-model calculations, which indicate a substantial contribution to the total β strength from high-energy first-forbidden β-decay transitions in this mass region.

  17. miR-203 as a novel biomarker for the diagnosis and prognosis of colorectal cancer: a systematic review and meta-analysis

    Directory of Open Access Journals (Sweden)

    Ye H

    2017-07-01

    Full Text Available Huajun Ye,1,* Haibin Hao,2,* Jincheng Wang,3 Renpin Chen,1 Zhiming Huang1 1Department of Gastroenterology, The First Affiliated Hospital of Wenzhou Medical University, Zhejiang, 2Department of General Surgery, Medical College of Nanchang University, Nanchang, 3Department of Medical Imaging, The First Affiliated Hospital of Wenzhou Medical University, Zhejiang, People’s Republic of China *These authors contributed equally to this work Abstract: We sought to systematically evaluate the diagnostic and prognostic value of miR-203 in patients with colorectal cancer. To explore the diagnostic performance of miR-203, eligible studies were identified from biomedical databases. Based on these results, 11 studies were pooled and included in this meta-analysis. The pooled sensitivity, specificity, and diagnostic odds ratios of miR-203 were 0.83 (95% confidence interval, CI: 0.78–0.86, 0.80 (95% CI: 0.77–0.83, and 19.27 (95% CI: 7.23–51.36 for the diagnosis of colorectal cancer. The area under the curve for miR-203 for diagnosing colorectal cancer was 0.89. Patients with higher expression of tissue miR-203 had poor overall survival (pooled hazard ratio: 1.63; 95% CI: 1.03–2.57, P=0.04, but serum miR-203 was not predictive (pooled hazard ratio: 1.59; 95% CI: 0.31–8.12, P=0.58. The miR-203 values of tissue and serum merged together may perhaps predict superior overall survival (pooled hazard ratio: 1.62; 95% CI: 0.93–2.82, but the effect was not significant (P=0.09. Keywords: colorectal cancer, CRC, diagnosis, miR-203, prognosis

  18. Hanford Tanks 241-C-203 and 241 C 204: Residual Waste Contaminant Release Model and Supporting Data

    Energy Technology Data Exchange (ETDEWEB)

    Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.

    2007-05-23

    This report was revised in May 2007 to correct 90Sr values in Chapter 3. The changes were made on page 3.9, paragraph two and Table 3.10; page 3.16, last paragraph on the page; and Tables 3.21 and 3.31. The rest of the text remains unchanged from the original report issued in October 2004. This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy.

  19. Hanford Tanks 241-C-203 and 241-C-204: Residual Waste Contaminant Release Model and Supporting Data

    Energy Technology Data Exchange (ETDEWEB)

    Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Schaef, Herbert T.

    2004-10-28

    This report describes the development of release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. Key results from this work are (1) future releases from the tanks of the primary contaminants of concern (99Tc and 238U) can be represented by relatively simple solubility relationships between infiltrating water and solid phases containing the contaminants; and (2) high percentages of technetium-99 in the sludges (20 wt% in C-203 and 75 wt% in C-204) are not readily water leachable, and, in fact, are very recalcitrant. This is similar to results found in related studies of sludges from Tank AY-102. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for the U.S. Department of Energy.

  20. The interaction of H(2)O(2) with ice surfaces between 203 and 233 K.

    Science.gov (United States)

    Pouvesle, N; Kippenberger, M; Schuster, G; Crowley, J N

    2010-12-21

    The interaction of H(2)O(2) with ice surfaces at temperatures between 203 and 233 K was investigated using a low pressure, coated-wall flow tube equipped with a chemical ionisation/electron impact mass spectrometer. Equilibrium surface coverages of H(2)O(2) on ice were measured at various concentrations and temperatures to derive Langmuir-type adsorption isotherms. H(2)O(2) was found to be strongly partitioned to the ice surface at low temperatures, with a partition coefficient, K(linC), equal to 2.1 × 10(-5) exp(3800/T) cm. At 228 K, this expression results in values of K(linC) which are orders of magnitude larger than the single previous determination and suggests that H(2)O(2) may be significantly partitioned to the ice phase in cirrus clouds. The partition coefficient for H(2)O(2) was compared to several other trace gases which hydrogen-bond to ice surfaces and a good correlation with the free energy of condensation found. For this class of trace gas a simple parameterisation for calculating K(linC)(T) from thermodynamic properties was established.

  1. Maternal-fetal distribution of mercury ( sup 203 Hg) released from dental amalgam fillings

    Energy Technology Data Exchange (ETDEWEB)

    Vimy, M.J.; Takahashi, Y.; Lorscheider, F.L. (Univ. of Calgary, Alberta (Canada))

    1990-04-01

    In humans, the continuous release of Hg vapor from dental amalgam tooth restorations is markedly increased for prolonged periods after chewing. The present study establishes a time-course distribution for amalgam Hg in body tissues of adult and fetal sheep. Under general anesthesia, five pregnant ewes had twelve occlusal amalgam fillings containing radioactive 203Hg placed in teeth at 112 days gestation. Blood, amniotic fluid, feces, and urine specimens were collected at 1- to 3-day intervals for 16 days. From days 16-140 after amalgam placement (16-41 days for fetal lambs), tissue specimens were analyzed for radioactivity, and total Hg concentrations were calculated. Results demonstrate that Hg from dental amalgam will appear in maternal and fetal blood and amniotic fluid within 2 days after placement of amalgam tooth restorations. Excretion of some of this Hg will also commence within 2 days. All tissues examined displayed Hg accumulation. Highest concentrations of Hg from amalgam in the adult occurred in kidney and liver, whereas in the fetus the highest amalgam Hg concentrations appeared in liver and pituitary gland. The placenta progressively concentrated Hg as gestation advanced to term, and milk concentration of amalgam Hg postpartum provides a potential source of Hg exposure to the newborn. It is concluded that accumulation of amalgam Hg progresses in maternal and fetal tissues to a steady state with advancing gestation and is maintained. Dental amalgam usage as a tooth restorative material in pregnant women and children should be reconsidered.

  2. Physical activity in patients with axial spondyloarthritis: a cross-sectional study of 203 patients.

    Science.gov (United States)

    Fabre, Stéphanie; Molto, Anna; Dadoun, Sabrina; Rein, Christopher; Hudry, Christophe; Kreis, Sarah; Fautrel, Bruno; Pertuiset, Edouard; Gossec, Laure

    2016-12-01

    Physical activity is recommended in axial spondyloarthritis (axSpA) but may be insufficiently performed. The objective of this study was to assess physical activity in axial spondyloarthritis and to explore its explanatory factors. This was a cross-sectional study of patients with definite axSpA. The level of physical activity (International Physical Activity Questionnaire-Long form, IPAQ-L), type of aerobic exercise and the Exercise Benefits and Barriers Score were collected. Multivariate logistic regression analyses were performed to explain levels of exercise at least as recommended by the World Health Organization. In all, 203 patients were included: mean age 46.0 ± 11.6 years, 108 (53.2 %) males, mean Bath Ankylosing Spondylitis Activity Index (0-100) 37.8 ± 19.9; 137 (68.8 %) were treated with TNF-inhibitors. In all, 111 patients (54.7 %) were exercising at least as recommended; 96 (47.2 %) were in the 'high physical activity' category. Aerobic exercise >30 min was performed at least once a week by 61 (30.0 %) patients; the most frequent activities were energetic walking (31.0 %) and swimming (21.2 %). Main perceived benefits of exercising were improving physical fitness and functioning of the cardiovascular system, and the main barrier was physical exertion. Patients with paid employment had lower levels of physical activity whereas other demographic variables, disease activity/severity or TNF-inhibitor treatment were not predictive. One half of these patients performed enough physical activity according to the recommendations, similarly to the French population. Levels of physical activity did not appear to be explained by disease-related variables. Physical activity should be encouraged in axSpA.

  3. Insight into the structure and the mechanism of the slow proton transfer in the GFP double mutant T203V/S205A.

    Science.gov (United States)

    Wineman-Fisher, Vered; Simkovitch, Ron; Shomer, Shay; Gepshtein, Rinat; Huppert, Dan; Saif, Mari; Kallio, Karen; Remington, S James; Miller, Yifat

    2014-06-21

    Mutations near the fluorescing chromophore of the green fluorescent protein (GFP) have direct effects on the absorption and emission spectra. Some mutants have significant band shifts and most of the mutants exhibit a loss of fluorescence intensity. In this study we continue our investigation of the factors controlling the excited state proton transfer (PT) process of GFP, in particular to study the effects of modifications to the key side chain Ser205 in wt-GFP, proposed to participate in the proton wire. To this aim we combined mutagenesis, X-ray crystallography, steady-state spectroscopy, time-resolved emission spectroscopy and all-atom explicit molecular dynamics (MD) simulations to study the double mutant T203V/S205A. Our results show that while in the previously described GFP double mutant T203V/S205V the PT process does not occur, in the T203V/S205A mutant the PT process does occur, but with a 350 times slower rate than in wild-type GFP (wt-GFP). Furthermore, the kinetic isotope effect in the GFP double mutant T203V/S205A is twice smaller than in the wt-GFP and in the GFP single mutant S205V, which forms a novel PT pathway. On the other hand, the crystal structure of GFP T203V/S205A does not reveal a viable proton transfer pathway. To explain PT in GFP T203V/S205A, we argue on the basis of the MD simulations for an alternative, novel proton-wire pathway which involves the phenol group of the chromophore and water molecules infrequently entering from the bulk. This alternative pathway may explain the dramatically slow PT in the GFP double mutant T203V/S205A compared to wt-GFP.

  4. Up-regulation of selenoprotein P and HIP/PAP mRNAs in hepatocytes by intermittent hypoxia via down-regulation of miR-203

    Directory of Open Access Journals (Sweden)

    Tomoko Uchiyama

    2017-09-01

    Full Text Available Sleep apnea syndrome is characterized by recurrent episodes of oxygen desaturation and reoxygenation (intermittent hypoxia [IH] and is a risk factor for insulin resistance/type 2 diabetes. However, the mechanisms linking IH stress and insulin resistance remain elusive. We exposed human hepatocytes (JHH5, JHH7, and HepG2 to experimental IH or normoxia for 24 h, measured mRNA levels by real-time reverse transcription polymerase chain reaction (RT-PCR, and found that IH significantly increased the mRNA levels of selenoprotein P (SELENOP — a hepatokine — and hepatocarcinoma-intestine-pancreas/pancreatitis-associated protein (HIP/PAP — one of REG (Regenerating gene family. We next investigated promoter activities of both genes and discovered that they were not increased by IH. On the other hand, a target mRNA search of micro RNA (miRNA revealed that both mRNAs have a potential target sequence for miR-203. The miR-203 level of IH-treated cells was significantly lower than that of normoxia-treated cells. Thus, we introduced miR-203 inhibitor and a non-specific control RNA (miR-203 inhibitor NC into HepG2 cells and measured the mRNA levels of SELENOP and HIP/PAP. The IH-induced expression of SELENOP and HIP/PAP was abolished by the introduction of miR-203 inhibitor but not by miR-203 inhibitor NC. These results demonstrate that IH stress up-regulates the levels of SELENOP in human hepatocytes to accelerate insulin resistance and up-regulates the levels of HIP/PAP mRNAs to proliferate such hepatocytes, via the miR-203 mediated mechanism.

  5. Epidermal anti-Inflammatory properties of 5,11,14 20:3: Effects on mouse ear edema, PGE2 levels in cultured keratinocytes, and PPAR activation

    Directory of Open Access Journals (Sweden)

    Baur Markus

    2002-12-01

    Full Text Available Abstract Background 5,11,14 20:3 is similar to 20:4n-6 but lacks the internal Δ8 double bond essential for prostaglandin and eicosanoid synthesis. When previously fed to laboratory animals as a gymnosperm seed oil component it has shown anti-inflammatory properties. Results Herein, topically applied Podocarpus nagi methyl esters (containing 26% 5,11,14 20:3 were incorporated into mouse ear phospholipids, reduced 20:4n-6, and reduced 20:4n-6- and TPA-induced mouse ear edema. Purified 5,11,14 20:3 was taken up by cultured human skin keratinocytes, reduced 20:4n-6, and reduced PGE2 levels dramatically. Purified 5,11,14 20:3 did not affect PPARα, PPARγ, or PPARδ transactivation. Conclusions Topical application of 5,11,14 20:3 to skin surfaces can thus reduce inflammatory processes, most likely by displacing 20:4n-6 from phospholipid pools and reducing downstream inflammatory products derived from 20:4n-6 such as PGE2 and leukotrienes. It could have potential use in treating clinical skin disorders resulting from overproduction of 20:4n-6-derived eicosanoid products.

  6. High-precision mass measurements of {sup 203-207}Rn and {sup 213}Ra with SHIPTRAP

    Energy Technology Data Exchange (ETDEWEB)

    Droese, C.; Marx, G.; Schweikhard, L. [Ernst-Moritz-Arndt-Universitaet, Greifswald (Germany); Ackermann, D.; Block, M.; Dworschak, M.; Herfurth, F.; Hofmann, S. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Andersson, L.L. [University of Liverpool, Liverpool (United Kingdom); Johannes Gutenberg-Universitaet, Helmholtz-Institut Mainz, Mainz (Germany); Blaum, K. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Ruprecht-Karls-Universitaet Heidelberg, Heidelberg (Germany); Eibach, M. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Johannes Gutenberg-Universitaet Mainz, Mainz (Germany); Eliseev, S.; Ketelaer, J. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Forsberg, U.; Rudolph, D. [Lund University, Lund (Sweden); Haettner, E.; Plass, W.R.; Scheidenberger, C. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Justus-Liebig-Universitaet Giessen, Giessen (Germany); Hessberger, F.P. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Johannes Gutenberg-Universitaet, Helmholtz-Institut Mainz, Mainz (Germany); Minaya Ramirez, E. [Johannes Gutenberg-Universitaet, Helmholtz-Institut Mainz, Mainz (Germany); Nesterenko, D.; Novikov, Yu.N. [NRC Kurchatov Institute, PNPI, Gatchina (Russian Federation); Rodriguez, D. [Universidad de Granada, Campus de Fuentenueva, Granada (Spain); Stolze, S. [University of Jyvaeskylae, Jyvaeskylae (Finland); Thirolf, P.G.; Weber, C. [Ludwig Maximilians-Universitaet Muenchen, Garching (Germany)

    2013-01-15

    The masses of the nuclides {sup 203-207}Rn and {sup 213}Ra were measured directly for the first time with the Penning-trap mass spectrometer SHIPTRAP at GSI Darmstadt. The results confirm the previously determined mass values. The mass uncertainties for {sup 205}Rn and {sup 213}Ra were significantly reduced. The results are relevant for the investigation of the nuclear shell structure between N=82 and N=126. As an indicator of structural changes the two-neutron separation energies S{sub 2n}(Z,N) have been studied. (orig.)

  7. Conventional superconductivity at 203 kelvin at high pressures in the sulfur hydride system

    Science.gov (United States)

    Drozdov, A. P.; Eremets, M. I.; Troyan, I. A.; Ksenofontov, V.; Shylin, S. I.

    2015-09-01

    A superconductor is a material that can conduct electricity without resistance below a superconducting transition temperature, Tc. The highest Tc that has been achieved to date is in the copper oxide system: 133 kelvin at ambient pressure and 164 kelvin at high pressures. As the nature of superconductivity in these materials is still not fully understood (they are not conventional superconductors), the prospects for achieving still higher transition temperatures by this route are not clear. In contrast, the Bardeen-Cooper-Schrieffer theory of conventional superconductivity gives a guide for achieving high Tc with no theoretical upper bound--all that is needed is a favourable combination of high-frequency phonons, strong electron-phonon coupling, and a high density of states. These conditions can in principle be fulfilled for metallic hydrogen and covalent compounds dominated by hydrogen, as hydrogen atoms provide the necessary high-frequency phonon modes as well as the strong electron-phonon coupling. Numerous calculations support this idea and have predicted transition temperatures in the range 50-235 kelvin for many hydrides, but only a moderate Tc of 17 kelvin has been observed experimentally. Here we investigate sulfur hydride, where a Tc of 80 kelvin has been predicted. We find that this system transforms to a metal at a pressure of approximately 90 gigapascals. On cooling, we see signatures of superconductivity: a sharp drop of the resistivity to zero and a decrease of the transition temperature with magnetic field, with magnetic susceptibility measurements confirming a Tc of 203 kelvin. Moreover, a pronounced isotope shift of Tc in sulfur deuteride is suggestive of an electron-phonon mechanism of superconductivity that is consistent with the Bardeen-Cooper-Schrieffer scenario. We argue that the phase responsible for high-Tc superconductivity in this system is likely to be H3S, formed from H2S by decomposition under pressure. These findings raise hope for the

  8. Hanford Tanks 241-C-202 and 241-C-203 Residual Waste Contaminant Release Models and Supporting Data

    Energy Technology Data Exchange (ETDEWEB)

    Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Mattigod, Shas V.; Schaef, Herbert T.; Arey, Bruce W.

    2007-09-13

    As directed by Congress, the U. S. Department of Energy (DOE) established the Office of River Protection in 1998 to manage DOE's largest, most complex environmental cleanup project – retrieval of radioactive waste from Hanford tanks for treatment and eventual disposal. Sixty percent by volume of the nation's high-level radioactive waste is stored at Hanford in aging deteriorating tanks. If not cleaned up, this waste is a threat to the Columbia River and the Pacific Northwest. CH2M Hill Hanford Group, Inc., is the Office of River Protection's prime contractor responsible for the storage, retrieval, and disposal of Hanford's tank waste. As part of this effort, CH2M HILL Hanford Group, Inc. contracted with Pacific Northwest National Laboratory (PNNL) to develop release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for DOE.

  9. Identification of C/EBPα as a novel target of the HPV8 E6 protein regulating miR-203 in human keratinocytes.

    Directory of Open Access Journals (Sweden)

    Anna M Marthaler

    2017-06-01

    Full Text Available Patients suffering from Epidermodysplasia verruciformis (EV, a rare inherited skin disease, display a particular susceptibility to persistent infection with cutaneous genus beta-human papillomavirus (beta-HPV, such as HPV type 8. They have a high risk to develop non-melanoma skin cancer at sun-exposed sites. In various models evidence is emerging that cutaneous HPV E6 proteins disturb epidermal homeostasis and support carcinogenesis, however, the underlying mechanisms are not fully understood as yet. In this study we demonstrate that microRNA-203 (miR-203, a key regulator of epidermal proliferation and differentiation, is strongly down-regulated in HPV8-positive EV-lesions. We provide evidence that CCAAT/enhancer-binding protein α (C/EBPα, a differentiation-regulating transcription factor and suppressor of UV-induced skin carcinogenesis, directly binds the miR-203 gene within its hairpin region and thereby induces miR-203 transcription. Our data further demonstrate that the HPV8 E6 protein significantly suppresses this novel C/EBPα/mir-203-pathway. As a consequence, the miR-203 target ΔNp63α, a proliferation-inducing transcription factor, is up-regulated, while the differentiation factor involucrin is suppressed. HPV8 E6 specifically down-regulates C/EBPα but not C/EBPβ expression at the transcriptional level. As shown in knock-down experiments, C/EBPα is regulated by the acetyltransferase p300, a well-described target of cutaneous E6 proteins. Notably, p300 bound significantly less to the C/EBPα regulatory region in HPV8 E6 expressing keratinocytes than in control cells as demonstrated by chromatin immunoprecipitation. In situ analysis confirmed congruent suprabasal expression patterns of C/EBPα and miR-203 in non-lesional skin of EV-patients. In HPV8-positive EV-lesions both factors are potently down-regulated in vivo further supporting our in vitro data. In conclusion our study has unraveled a novel p300/C/EBPα/mir-203-dependent

  10. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  11. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  12. Maintenance of the stemness in CD44+ HCT-15 and HCT-116 human colon cancer cells requires miR-203 suppression

    Directory of Open Access Journals (Sweden)

    Sy-Yeuan Ju

    2014-01-01

    Taken together, CD44 is a critical molecule for modulating stemness in CSCs. More importantly, we show for the first time that the downregulation of miR-203 by HA/CD44 signaling is the main reason for stemness-maintenance in colon cancer cells.

  13. 76 FR 24832 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes, A330-300...

    Science.gov (United States)

    2011-05-03

    ...-201, -202, -203, - 223, and -243 Airplanes, A330-300 Series Airplanes, A340-200 Series Airplanes, and A340-300 Series Airplanes AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of... some rudders fitted on A330 and A340-200/-300 aeroplanes. An extended de-bonding, if not detected and...

  14. 24 CFR 257.203 - Calculation of up-front and annual mortgage insurance premiums for H4H program mortgages.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Calculation of up-front and annual... Rights and Obligations Under the Contract of Insurance § 257.203 Calculation of up-front and annual... to the following requirements: (1) Up-front premium. FHA shall establish and collect a single premium...

  15. Japanese Language and Culture: 10-3Y, 20-3Y, 30-3Y. 3-Year Program Guide to Implementation

    Science.gov (United States)

    Alberta Education, 2009

    2009-01-01

    This guide to implementation is intended to support the Japanese Language and Culture 10-3Y, 20-3Y, 30-3Y Program of Studies. It was developed primarily for teachers, yet it includes information that may be useful for administrators and other stakeholders in their efforts to plan for and implement the new Japanese program of studies. Familiarity…

  16. 13 CFR 123.203 - What interest rate will my business pay on a physical disaster business loan and what are the...

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What interest rate will my... Business Loans § 123.203 What interest rate will my business pay on a physical disaster business loan and what are the repayment terms? (a) SBA will announce interest rates with each disaster declaration. If...

  17. Non-traditional wearing positions of pedometers: validity and reliability of the Omron HJ-203-ED pedometer under controlled and free-living conditions.

    Science.gov (United States)

    De Cocker, Katrien A; De Meyer, Jotie; De Bourdeaudhuij, Ilse M; Cardon, Greet M

    2012-09-01

    To test the validity and intra-instrument reliability of the HJ-203 Omron pedometer when worn in different positions, under controlled and free-living conditions. Cross-sectional. Forty healthy adults (20 men, 29.5±7.7 years) participated in three controlled tests, i.e. 20 step test, stair climbing (up and down), and treadmill walking (five bouts at different speeds). All participants wore a HJ-203 pedometer in the pants pocket, in a carrier bag, and around the neck. Fifty-four adults (23 men, 33.9±11.1 years) participated in a free-living conditions test, wearing a HJ-203 in the pants pocket and around the neck during one day. During controlled tests, absolute percentage error ranged between 0.1% and 14.0%. Accuracy was influenced by wearing position (pHJ-203 Omron pedometer showed acceptable accuracy for all wearing positions during stairs walking and treadmill walking at higher speeds; but limited accuracy during free-living conditions when worn at non-traditional wearing positions (necklace and pants pocket). Reliability was acceptable during treadmill walking at higher speeds and free-living conditions. Copyright © 2012 Sports Medicine Australia. Published by Elsevier Ltd. All rights reserved.

  18. 16 CFR 20.3 - Misrepresentation of the terms “rebuilt,” “factory rebuilt,” “remanufactured,” etc.

    Science.gov (United States)

    2010-01-01

    ... GUIDES AND TRADE PRACTICE RULES GUIDES FOR THE REBUILT, RECONDITIONED AND OTHER USED AUTOMOBILE PARTS INDUSTRY § 20.3 Misrepresentation of the terms “rebuilt,” “factory rebuilt,” “remanufactured,” etc. (a) It... describe an industry product which, since it was last subjected to any use, has not been dismantled and...

  19. 25 CFR 900.203 - If the contractor or contractor's employee receives a summons and/or a complaint alleging a tort...

    Science.gov (United States)

    2010-04-01

    ... 900.203 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR, AND INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES CONTRACTS UNDER THE INDIAN SELF-DETERMINATION AND EDUCATION... 25 Indians 2 2010-04-01 2010-04-01 false If the contractor or contractor's employee receives a...

  20. Factors Affecting Examination Attrition: Does Academic Support Help? A Survey of ACN203S (Cost Accounting and Control) Students at Unisa

    Science.gov (United States)

    Tladi, Lerato Sonia

    2013-01-01

    This study sought to determine the attributing and contributing factors to examination absence as well as whether the academic and social support available to students had a role to play in discouraging or reducing absence from examinations using results from a quantitative survey of ACN203S (Cost Accounting and Control) students who were admitted…

  1. Identification of the impact of crime on physical activity depends upon neighbourhood scale: multilevel evidence from 203,883 Australians.

    Science.gov (United States)

    Astell-Burt, Thomas; Feng, Xiaoqi; Kolt, Gregory S

    2015-01-01

    Equivocal findings on crime as a deterrent for physical activity may be due to effects of geographic scale on exposure measurement. To investigate this hypothesis, physical activity was measured in 203,883 Australians and linked to standardised crime counts within small ('Census Collection Districts'; approx. 330 residents) and larger areas ('Statistical Local Areas'; approx. 32,000 residents). A median rate ratio of 2.26 indicated substantive geographic variation in moderate-to-vigorous physical activity (MVPA). Adjusting for confounders, multilevel negative binomial regression reported lower MVPA with more crime consistently in small, but not in larger areas. Reducing small pockets of local crime may encourage more physically active lifestyles. Copyright © 2014. Published by Elsevier Ltd.

  2. Lack of clinical evidence for a specific HIV-associated glomerulopathy in 203 patients with HIV infection.

    Science.gov (United States)

    Brunkhorst, R; Brunkhorst, U; Eisenbach, G M; Schedel, I; Deicher, H; Koch, K M

    1992-01-01

    Several authors described a high incidence of proteinuria with frequent progression to nephrotic syndrome and/or renal failure in patients with HIV infection. Though renal histological changes were rather non-specific, the existence of a specific, HIV-associated glomerulopathy was postulated. We repeatedly investigated proteinuria and serum creatinine in 203 HIV-infected patients. One hundred and twenty-two patients (group 1) had early stages of the disease without opportunistic infections, 81 suffered from acute opportunistic infections (group 2). In patients with a positive qualitative test (Combistix), quantitative measurement (Biuret) for proteinuria was carried out; when proteinuria was greater than 0.5 g/24 h, SDS gel electrophoresis was performed. None of the patients of group 1 had a proteinuria greater than 0.5 g/24 h or an elevated serum creatinine. Eleven of 81 patients from group 2 had a proteinuria between 0.5 and 3 g/24 h; one further patient of group 2 developed a transient proteinuria of 7.7 g/24 h. Only three of the proteinuric patients showed a glomerular pattern in SDS gel electrophoresis, all three during acute CMV or EBV infections. Fourteen of 81 group 2 patients showed a transient elevation of serum creatinine (x +/- SD of the maximum serum creatinines: 225.3 +/- 163 mumol/l), most during pentamidine therapy for Pneumocystis carinii infection; one patient treated with high-dose acyclovir had to be temporarily dialysed. In the investigated 203 HIV patients no nephrotic syndrome and no sustained elevation of serum creatinine greater than 200 mumol/l was observed. All cases of proteinuria and elevation of serum creatinine were associated with severe opportunistic infections and the administration of potentially nephrotoxic antibiotics.

  3. Evaluation of the Potency of Two Novel Bispyridinium Oximes (K456, K458) in Comparison with Oxime K203 and Trimedoxime to Counteract Tabun‐Induced Neurotoxicity in Rats

    National Research Council Canada - National Science Library

    Kassa, Jiri; Misik, Jan; Karasova, Jana Z

    2013-01-01

    The ability of two newly developed bispyridinium oximes ( K 456, K 458) to reduce tabun‐induced acute neurotoxic signs and symptoms was compared with oxime K 203 and trimedoxime using the functional observational battery...

  4. The L‐type Ca2+ channel facilitates abnormal metabolic activity in the cTnI‐G203S mouse model of hypertrophic cardiomyopathy

    Science.gov (United States)

    Viola, Helena; Johnstone, Victoria; Cserne Szappanos, Henrietta; Richman, Tara; Tsoutsman, Tatiana; Filipovska, Aleksandra; Semsarian, Christopher

    2016-01-01

    Key points Genetic mutations in cardiac troponin I (cTnI) are associated with development of hypertrophic cardiomyopathy characterized by myocyte remodelling, disorganization of cytoskeletal proteins and altered energy metabolism.The L‐type Ca2+ channel is the main route for calcium influx and is crucial to cardiac excitation and contraction. The channel also regulates mitochondrial function in the heart by a functional communication between the channel and mitochondria via the cytoskeletal network.We find that L‐type Ca2+ channel kinetics are altered in cTnI‐G203S cardiac myocytes and that activation of the channel causes a significantly greater increase in mitochondrial membrane potential and metabolic activity in cTnI‐G203S cardiac myocytes.These responses occur as a result of impaired communication between the L‐type Ca2+ channel and cytoskeletal protein F‐actin, involving decreased movement of actin–myosin and block of the mitochondrial voltage‐dependent anion channel, resulting in a ‘hypermetabolic’ mitochondrial state.We propose that L‐type Ca2+ channel antagonists, such as diltiazem, might be effective in reducing the cardiomyopathy by normalizing mitochondrial metabolic activity. Abstract Genetic mutations in cardiac troponin I (cTnI) account for 5% of families with hypertrophic cardiomyopathy. Hypertrophic cardiomyopathy is associated with disorganization of cytoskeletal proteins and altered energy metabolism. The L‐type Ca2+ channel (ICa‐L) plays an important role in regulating mitochondrial function. This involves a functional communication between the channel and mitochondria via the cytoskeletal network. We investigate the role of ICa‐L in regulating mitochondrial function in 25‐ to 30‐week‐old cardiomyopathic mice expressing the human disease‐causing mutation Gly203Ser in cTnI (cTnI‐G203S). The inactivation rate of ICa‐L is significantly faster in cTnI‐G203S myocytes [cTnI‐G203S: τ1 = 40.68 ± 3.22, n

  5. MALAT1 is a prognostic factor in glioblastoma multiforme and induces chemoresistance to temozolomide through suppressing miR-203 and promoting thymidylate synthase expression.

    Science.gov (United States)

    Chen, Wei; Xu, Xin-Ke; Li, Jun-Liang; Kong, Kuan-Kei; Li, Hui; Chen, Cheng; He, Jing; Wang, Fangyu; Li, Ping; Ge, Xiao-Song; Li, Fang-Cheng

    2017-04-04

    Glioblastoma multiforme (GBM) is the most malignant brain tumor with limited therapeutic options. Temozolomide (TMZ) is a novel cytotoxic agent used as first-line chemotherapy for GBM, however, some individual cells can't be isolated for surgical resection and show treatment-resistance, thus inducing poor prognosis. By using the HiSeq sequencing and bioinformatics methods, we identified lncRNAs showing different expression levels in TMZ-resistant and non-resistant patients. RT-qPCR was then performed in tissues and serum samples, and lncRNA MALAT1 was finally identified to show considerable discriminating potential to identify responding patients from non-responding patients. Moreover, high serum MALAT1 expression was associated with poor chemoresponse and survival in GBM patients receiving TMZ treatment. Subsequently, the TMZ resistant cell lines were established, and the CCK8 assay showed that lncRNA MALAT1 knockdown significantly reversed TMZ resistance in GBM cells. The gain and loss-function experiments revealed that miR-203 was down-regulated by MALAT1 and this interaction has reciprocal effects. Besides, thymidylate synthase (TS) mRNA was identified as a direct target of miR-203. LncRNA MALAT1 inhibition re-sensitized TMZ resistant cells through up-regulating miR-203 and down-regulating TS expression. On the other hand, MALAT1 overexpression promoted resistance by suppressing miR-203 and promoting TS expression. In conclusion, our integrated approach demonstrates that enhanced expression of lncRNA MALAT1 confers a potent poor therapeutic efficacy and inhibition of MALAT1 levels could be a future direction to develop a novel therapeutic strategy to overcome TMZ resistance in GBM patients.

  6. IER 203 CED-2 Report: LLNL Final Design for BERP Ball With a Composite Reflector of Thin Polyethylene Backed by Nickel

    Energy Technology Data Exchange (ETDEWEB)

    Percher, C. M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Heinrichs, D. P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Kim, S. K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2016-07-18

    This report documents the results of final design (CED-2) for IER 203, BERP Ball Composite Reflection, and focuses on critical configurations with a 4.5 kg α-phase plutonium sphere reflected by a combination of thin high-density polyethylene (HDPE) backed by a thick nickel reflector. The Lawrence Livermore National Laboratory’s (LLNL’s) Nuclear Criticality Safety Division, in support of fissile material operations, calculated surprisingly reactive configurations when a fissile core was surrounded by a thin, moderating reflector backed by a thick metal reflector. These composite reflector configurations were much more reactive than either of the single reflector materials separately. The calculated findings have resulted in a stricter-than-anticipated criticality control set, impacting programmatic work. IER 203 was requested in response to these seemingly anomalous calculations to see if the composite reflection effect could be shown experimentally. This report focuses on the Beryllium Reflected Plutonium (BERP) ball as a fissile material core reflected by polyethylene and nickel. A total of four critical configurations were designed as part of CED-2. Fabrication costs are estimated to be $98,500, largely due to the cost of the large nickel reflectors. The IER 203 experiments could reasonably be expected to begin in early FY2017.

  7. The 203 kbp Mitochondrial Genome of the Phytopathogenic Fungus Sclerotinia borealis Reveals Multiple Invasions of Introns and Genomic Duplications

    Science.gov (United States)

    Mardanov, Andrey V.; Beletsky, Alexey V.; Kadnikov, Vitaly V.; Ignatov, Alexander N.; Ravin, Nikolai V.

    2014-01-01

    Here we report the complete sequence of the mitochondrial (mt) genome of the necrotrophic phytopathogenic fungus Sclerotinia borealis, a member of the order Helotiales of Ascomycetes. The 203,051 bp long mtDNA of S. borealis represents one of the largest sequenced fungal mt genomes. The large size is mostly determined by the presence of mobile genetic elements, which include 61 introns. Introns contain a total of 125,394 bp, are scattered throughout the genome, and are found in 12 protein-coding genes and in the ribosomal RNA genes. Most introns contain complete or truncated ORFs that are related to homing endonucleases of the LAGLIDADG and GIY-YIG families. Integrations of mobile elements are also evidenced by the presence of two regions similar to fragments of inverton-like plasmids. Although duplications of some short genome regions, resulting in the appearance of truncated extra copies of genes, did occur, we found no evidences of extensive accumulation of repeat sequences accounting for mitochondrial genome size expansion in some other fungi. Comparisons of mtDNA of S. borealis with other members of the order Helotiales reveal considerable gene order conservation and a dynamic pattern of intron acquisition and loss during evolution. Our data are consistent with the hypothesis that horizontal DNA transfer has played a significant role in the evolution and size expansion of the S. borealis mt genome. PMID:25216190

  8. Downregulation of miRNA-30c and miR-203a is associated with hepatitis C virus core protein-induced epithelial–mesenchymal transition in normal hepatocytes and hepatocellular carcinoma cells

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Dongjing [Hepatobiliary and Enteric Surgery Research Center, Xiangya Hospital, Central South University, Changsha 410008 (China); Wu, Jilin, E-mail: 6296082@qq.com [Hepatobiliary and Enteric Surgery Research Center, Xiangya Hospital, Central South University, Changsha 410008 (China); Liu, Meizhou [Department of Medical Service, Shenzhen Second People' s Hospital, Shenzhen, Guangdong 518035 (China); Yin, Hui [Staff' s Hospital, Central South University, Changsha, Hunan 410078 (China); He, Jiantai [Hepatobiliary and Enteric Surgery Research Center, Xiangya Hospital, Central South University, Changsha 410008 (China); Zhang, Bo, E-mail: zhangbo8095@126.com [Department of Ultrasonography, Xiangya Hospital, Central South University, Changsha, Hunan 410008 (China)

    2015-09-04

    Hepatitis C virus (HCV) Core protein has been demonstrated to induce epithelial–mesenchymal transition (EMT) and is associated with cancer progression of hepatocellular carcinoma (HCC). However, how the Core protein regulates EMT is still unclear. In this study, HCV Core protein was overexpressed by an adenovirus. The protein levels of EMT markers were measured by Western blot. The xenograft animal model was established by inoculation of HepG2 cells. Results showed that ectopic expression of HCV core protein induced EMT in L02 hepatocytes and HepG2 tumor cells by upregulating vimentin, Sanl1, and Snal2 expression and downregulating E-cadherin expression. Moreover, Core protein downregulated miR-30c and miR-203a levels in L02 and HepG2 cells, but artificial expression of miR-30c and miR-203a reversed Core protein-induced EMT. Further analysis showed that ectopic expression of HCV core protein stimulated cell proliferation, inhibited apoptosis, and increased cell migration, whereas artificial expression of miR-30c and miR-203a significantly reversed the role of Core protein in these cell functions in L02 and HepG2 cells. In the HepG2 xenograft tumor models, artificial expression of miR-30c and miR-203a inhibited EMT and tumor growth. Moreover, L02 cells overexpressing Core protein can form tumors in nude mice. In HCC patients, HCV infection significantly shortened patients' survival time, and loss of miR-30c and miR-203 expression correlated with poor survival. In conclusion, HCV core protein downregulates miR-30c and miR-203a expression, which results in activation of EMT in normal hepatocytes and HCC tumor cells. The Core protein-activated-EMT is involved in the carcinogenesis and progression of HCC. Loss of miR-30c and miR-203a expression is a marker for the poor prognosis of HCC. - Highlights: • HCV core protein downregulates miR-30c and miR-203a expression. • Downregulation of miR-30c and miR-203a activates EMT. • Activated-EMT is involved in the

  9. Laparoscopic Roux-en-Y Gastric bypass after failed vertical banded gastroplasty: a multicenter experience with 203 patients.

    Science.gov (United States)

    Suter, M; Ralea, S; Millo, P; Allé, J L

    2012-10-01

    Vertical banded gastroplasty (VBG) has long been the main restrictive procedure for morbid obesity but has many long-term complications for which conversion to Roux-en-Y gastric bypass (RYGBP) is often considered the best option. This series regroups patients operated on by three different surgeons in four different centers. All data were collected prospectively, then pooled and analyzed retrospectively. Out of 2,522 RYGBP performed between 1998 and 2010, 538 were reoperations, including 203 laparoscopic RYGBP after VBG. There were 175 women and 28 men. The mean BMI before VBG was 43.2 ± 6.3, and the mean BMI before reoperation was 37.4 ± 8.3. Most patients had more than one indication for reoperation and/or had regained significant weight. There was no conversion to open surgery. A total of 24 patients (11.8 %) developed complications, including nine (4.5 %) who required reoperation and one death. With a follow-up of 88.9 % after 8 years, the mean BMI after 1, 3, 5, 7, and 9 years was 29.1, 28.8, 28.7, 29.9, and 28.8, respectively. On the basis of this experience, the largest with laparoscopic reoperative RYGBP after failed VBG, we conclude that this procedure can safely be performed in experienced hands, with weight loss results similar to those observed after primary RYGBP. In patients with too difficult an anatomy below the cardia, dividing the esophagus just above the esophago-gastric junction and performing an esophagojejunostomy may be a safe alternative to converting to a Scopinaro-type BPD, obviating the additional long-term risks associated with malabsorption.

  10. A phase III, multicentre, randomised, double-blind, active-controlled, parallel-group trial comparing safety and efficacy of HD203, with innovator etanercept, in combination with methotrexate, in patients with rheumatoid arthritis: the HERA study.

    Science.gov (United States)

    Bae, Sang-Cheol; Kim, Jinseok; Choe, Jung-Yoon; Park, Won; Lee, Sang-Heon; Park, Yong-Beom; Shim, Seung-Cheol; Lee, Shin-Seok; Sung, Yoon-Kyoung; Choi, Chan-Bum; Lee, So-Ra; Park, HanYu; Ahn, Yongho

    2017-01-01

    To evaluate equivalence in efficacy for rheumatoid arthritis (RA) and compare the safety of the biosimilar HD203 with innovator etanercept (ETN) plus methotrexate (MTX) (ClinicalTrials.gov NCT01270997). Patients with active RA received 25 mg HD203 or ETN subcutaneously twice-weekly with MTX for 48 weeks in a phase III, multicentre, randomised, double-blind, parallel-group design. The primary end point was the proportion of patients achieving the American College of Rheumatology 20% response (ACR20) at week 24 for per-protocol study completer set (PPS). Secondary end points included ACR response criteria, ACRn, European League against Rheumatism (EULAR) response, change in Disease Activity Score 28 (DAS28), patient-reported outcomes, safety and immunogenicity. Of the 294 randomised patients (HD203, n=147; ETN, n=147), 233 comprised the 24-week PPS (n=115 and 118, respectively). ACR20 at week 24 was achieved by 83.48% and 81.36% of PPS patients, respectively, demonstrating equivalent efficacy within predefined margins of ±20% (treatment difference 2.12%, 95% CI -7.65% to 11.89%). Outcomes for secondary end points were consistent with the primary efficacy findings. Groups were comparable for overall incidences of treatment-emergent (all-causality) adverse events (AEs) (HD203 113 (76.9%) vs ETN 114 (78.1%) (p=0.804)), adverse drug reactions, serious AEs and discontinuations due to AEs. Few patients (HD203, n=8; ETN, n=3) tested positive for anti-drug antibodies. The study met the primary objective of demonstrating equivalent efficacy of HD203 and ETN. HD203 was well tolerated, with safety comparable with ETN in this population of patients with RA. NCT01270997; Results. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  11. Reaction profiles of the interaction between sarin and acetylcholinesterase and the S203C mutant: model nucleophiles and QM/MM potential energy surfaces.

    Science.gov (United States)

    Beck, Jeremy M; Hadad, Christopher M

    2010-09-06

    The phosphonylation mechanism of AChE and the S203C mutation by sarin (GB) is evaluated using two reaction schemes: a small model nucleophile (ethoxide, CH(3)CH(2)O(-)) and quantum mechanical/molecular mechanical (QM/MM) simulations. Calculations utilizing small model nucleophiles indicate that the reaction barrier for addition to GB is the rate-limiting step for both ethoxide and ethyl thiolate (CH(3)CH(2)S(-)); moreover, the activation barrier for addition to the phosphorus center of GB by ethyl thiolate is significantly larger (13.2 kcal/mol) than for ethoxide (8.3 kcal/mol). The decomposition transition state for both nucleophiles was determined to be approximately 1 kcal/mol. QM/MM simulations for AChE suggest a similar reaction mechanism for phosphonylation of the catalytic S203; however, the relative energetics are altered significantly compared to the isolated system. QM/MM results indicate that formation of the penta-coordinate intermediate is the rate-limiting step in the enzymatic system, with an activation barrier of 3.6 kcal/mol. Hydrogen-bonding interactions between the fluoride leaving group of GB with Y124 in AChE are observed throughout the reaction profile. The S203C mutation alters the relative energetics of the reaction, increasing the energy barrier for formation of the penta-coordinate intermediate to a value of 4.5 kcal/mol; moreover, the penta-coordinate intermediate (as product) is stabilized by an additional 6 kcal/mol when compared to wild-type AChE. Copyright (c) 2010 Elsevier Ireland Ltd. All rights reserved.

  12. Reaction Profiles of the Interaction between Sarin and Acetylcholinesterase and the S203C Mutant: Model Nucleophiles and QM/MM Potential Energy Surfaces

    OpenAIRE

    Beck, Jeremy M.; Hadad, Christopher M.

    2010-01-01

    The phosphonylation mechanism of AChE and the S203C mutation by sarin (GB) is evaluated using two reaction schemes: a small model nucleophile (ethoxide, CH3CH2O−) and quantum mechanical/molecular mechanical (QM/MM) simulations. Calculations utilizing small model nucleophiles indicate that the reaction barrier for addition to GB is the rate-limiting step for both ethoxide and ethyl thiolate (CH3CH2S−); moreover, the activation barrier for addition to the phosphorus center of GB by ethyl thiola...

  13. The Clinical Phenotype of Idiopathic Rapid Eye Movement Sleep Behavior Disorder at Presentation: A Study in 203 Consecutive Patients.

    Science.gov (United States)

    Fernández-Arcos, Ana; Iranzo, Alex; Serradell, Mónica; Gaig, Carles; Santamaria, Joan

    2016-01-01

    To describe the clinical phenotype of idiopathic rapid eye movement (REM) sleep behavior disorder (IRBD) at presentation in a sleep center. Clinical history review of 203 consecutive patients with IRBD identified between 1990 and 2014. IRBD was diagnosed by clinical history plus video-polysomnographic demonstration of REM sleep with increased electromyographic activity linked to abnormal behaviors. Patients were 80% men with median age at IRBD diagnosis of 68 y (range, 50-85 y). In addition to the already known clinical picture of IRBD, other important features were apparent: 44% of the patients were not aware of their dream-enactment behaviors and 70% reported good sleep quality. In most of these cases bed partners were essential to convince patients to seek medical help. In 11% IRBD was elicited only after specific questioning when patients consulted for other reasons. Seven percent did not recall unpleasant dreams. Leaving the bed occurred occasionally in 24% of subjects in whom dementia with Lewy bodies often developed eventually. For the correct diagnosis of IRBD, video-polysomnography had to be repeated in 16% because of insufficient REM sleep or electromyographic artifacts from coexistent apneas. Some subjects with comorbid obstructive sleep apnea reported partial improvement of RBD symptoms following continuous positive airway pressure therapy. Lack of therapy with clonazepam resulted in an increased risk of sleep related injuries. Synucleinopathy was frequently diagnosed, even in patients with mild severity or uncommon IRBD presentations (e.g., patients who reported sleeping well, onset triggered by a life event, nocturnal ambulation) indicating that the development of a neurodegenerative disease is independent of the clinical presentation of IRBD. We report the largest IRBD cohort observed in a single center to date and highlight frequent features that were not reported or not sufficiently emphasized in previous publications. Physicians should be aware of

  14. Cosmetology 103, 203, 303.

    Science.gov (United States)

    Manitoba Dept. of Education, Winnipeg.

    As part of the high school vocational industrial program in Manitoba, this course has been designed to provide students with the foundation for a career in cosmetology. The program introduces and provides opportunities for student skill development in the techniques of hairdressing, hair cutting, facial preparation, and skin care. The program,…

  15. MicroRNAs 142-3p, miR-155 and miR-203 Are Deregulated in Gastric MALT Lymphomas Compared to Chronic Gastritis.

    Science.gov (United States)

    Fernández, Concepción; Bellosillo, Beatriz; Ferraro, Mariana; Seoane, Agustín; Sánchez-González, Blanca; Pairet, Silvia; Pons, Aina; Barranco, Luis; Vela, María Carmen; Gimeno, Eva; Colomo, Lluís; Besses, Carles; Navarro, Alfons; Salar, Antonio

    2017-01-02

    Over the last years, our knowledge on pathogenesis of gastric MALT lymphoma has greatly improved, but its morphological diagnosis is still hampered by overlapping histological features with advanced chronic gastritis. MicroRNAs are deregulated in lymphomas, but their role and usefulness in gastric MALT lymphoma has not been extensively investigated. We analyzed the expression of 384 miRNAs using TaqMan microRNA assay in a training series of 10 gastric MALT lymphomas, 3 chronic gastritis and 2 reactive lymph nodes. Then, significantly deregulated miRNAs were individually assessed by real-time PCR in a validation series of 16 gastric MALT lymphomas and 12 chronic gastritis. Gastric MALT lymphoma is characterized by a specific miRNA expression profile. Among the differentially expressed miRNAs, a significant overexpression of miR-142-3p and miR-155 and down-regulation of miR-203 was observed in gastric MALT lymphoma when compared to chronic gastritis. miR-142-3p, miR-155 and miR-203 expression levels might be helpful biomarkers for the differential diagnosis between gastric MALT lymphomas and chronic gastritis. Copyright© 2017, International Institute of Anticancer Research (Dr. George J. Delinasios), All rights reserved.

  16. A comparison of the neuroprotective efficacy of individual oxime (HI-6) and combinations of oximes (HI-6+trimedoxime, HI-6+K203) in soman-poisoned rats.

    Science.gov (United States)

    Kassa, Jiri; Karasova, Jana Zdarova; Tesarova, Sandra

    2011-07-01

    The ability of two combinations of oximes (HI-6+trimedoxime, HI-6+K203) to reduce soman-induced acute neurotoxic signs and symptoms was compared with the neuroprotective efficacy of the oxime HI-6 alone, using a functional observational battery. Soman-induced neurotoxicity and the neuroprotective effects of HI-6 alone and HI-6 combined with trimedoxime or K203 in rats poisoned with soman at a sublethal dose (90 μg/kg intramuscularly, i.m.; 80% of LD₅₀ value) were monitored by the functional observational battery at 24 hours following soman administration. The results indicate that both tested oxime mixtures combined with atropine were able to allow soman-poisoned rats to survive 24 hours following soman challenge, while 4 nontreated soman-poisoned rats and 1 soman-poisoned rat treated with oxime HI-6 alone combined with atropine died within 24 hours following soman poisoning. While the oxime HI-6 alone combined with atropine treatment was able to eliminate a few soman-induced neurotoxic signs and symptoms, both oxime mixtures showed higher neuroprotective efficacy in soman-poisoned rats. Especially, the combination of HI-6 with trimedoxime was able to eliminate most soman-induced neurotoxic signs and symptoms and markedly reduce acute neurotoxicity of soman in rats. Thus, both tested mixtures of oximes combined with atropine were able to increase the neuroprotective effectiveness of antidotal treatment of acute soman poisonings, compared to the individual oxime.

  17. Modulation of miR-203 and its regulators as a function of time during the development of 7, 12 dimethylbenz [a] anthracene induced mouse skin tumors in presence or absence of the antitumor agents

    Energy Technology Data Exchange (ETDEWEB)

    Tiwari, Prakash; Gupta, Krishna P., E-mail: krishnag522@yahoo.co.in

    2014-07-15

    We investigated the chemopreventive effects of naturally occurring compounds like butyric acid (BA), nicotinamide (NA) and calcium glucarate (CAG) individually or in combination in 7, 12-dimethylbenz [a] anthracene (DMBA) treated mouse skin at 4 and 16 weeks, the time before and after the tumor development. DMBA application did not show any skin tumors at 4 weeks but well defined tumors appeared at 16 weeks. BA, NA or CAG prevented the tumor development significantly but the protection was highly enhanced when all these compounds were given together. In order to see the molecular changes progressing with tumors, we showed the downregulation of tumor suppressor miR-203 at 16 weeks and upregulation of histone deacetylases (HDAC), DNA methyltransferase, promoter methylation of miR-203 at 4 or 16 weeks. Regulators of micro RNA biogenesis such as DICER1 and Ago2 were also deregulated by DMBA. Proto-oncogene c-myc and BMI1 were upregulated and tumor suppressor gene p16 was downregulated by DMBA as a function of time. Effects of BA, NA or CAG were more pronounced after 16 weeks as compared to 4 weeks in preventing the tumor development and altered gene expression. Concomitant administration of BA, NA and CAG tried to prevent these alterations more effectively than that of individual compound possibly by regulating miR-203 status through epigenetic or biogenetic modulations before and after the tumor development. Study provides a rationale for chemoprevention by combination of different compounds targeting miR-203. - Highlights: • DMBA modulates miR-203 and its regulator before and after the onset of tumors. • Suppression of miR-203 and p16 could be the result of gene promoter methylation. • BA, NA or CAG prevents the effects of DMBA. • Combination of BA, NA or CAG is more effective in preventing the DMBA modulations.

  18. The assessment and control of the implementation of Articles 3 and 7 of EC Directive 80/779/EEC (sulphur dioxide and suspended particulates) and EC Directive 85/203/EEC (nitrogen dioxide) in the Netherlands

    NARCIS (Netherlands)

    Sluyter RJCF; LLO

    1994-01-01

    De implementatie in de Nederlandse wetgeving van de EG richtlijnen 80/799 (zwaveldioxide en zwevende deeltjes) en 85/203 (stikstofdioxide) is beschreven in dit rapport. De nadruk hierbij is gelegd op de monitoring van zwaveldioxide, zwevende deeltjes en stikstofdioxide in overeenstemming met de

  19. The assessment and control of the implementation of Articles 3 and 7 of EC Directive 80/779/EEC (sulphur dioxide and suspended particulates) and EC Directive 85/203/EEC (nitrogen dioxide) in Belgium

    NARCIS (Netherlands)

    Sluyter RJCF; LLO

    1994-01-01

    De implementatie in de Belgische wetgeving van de EG richtlijnen 80/799 (zwaveldioxide en zwevende deeltjes) en 85/203 (stikstofdioxide) is beschreven in dit rapport. De nadruk hierbij is gelegd op de monitoring van zwaveldioxide, zwevende deeltjes en stikstofdioxide in overeenstemming met de

  20. Separation of no-carrier-added {sup 203}Pb, a surrogate radioisotope, from proton irradiated {sup nat}Tl{sub 2}CO{sub 3} target using calcium alginate hydrogel beads

    Energy Technology Data Exchange (ETDEWEB)

    Sarkar, Kangkana; Sen, Kamalika [Univ. of Calcutta, Kolkata (India). Dept. of Chemistry; Lahiri, Susanta [Saha Institute of Nuclear Physics, Kolkata (India)

    2016-07-01

    {sup 203}Pb is a promising radioisotope in the field of medical science as an imaging surrogate of {sup 212}Pb. In the present investigation {sup 203}Pb was produced by proton irradiation of natural Tl{sub 2}CO{sub 3} target and was separated from the bulk Tl target using calcium alginate (CA) hydrogel beads with a high separation factor (3.8 x 10{sup 4} at 10{sup -3} M HNO{sub 3}). During the separation process {sup 203}Pb was encapsulated in CA beads and desorption of the radioisotope could only be achieved in 1M HNO{sub 3}. Possibility of Tl uptake was also checked in Fe doped CA (Fe-CA) beads after oxidation of Tl(I) to Tl(III) by sodium bismuthate. No significant uptake of Tl(III) was noticed in the Fe-CA beads. The matrix is therefore suitable for isolation of {sup 203}Pb from the target as well as its storage in the bead for therapeutic as well as diagnostic purpose.

  1. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  2. /sup 203/Hg excretion and tissue distribution in Holstein calves following single tracer intravenous doses of methyl mercury chloride or mercuric chloride

    Energy Technology Data Exchange (ETDEWEB)

    Stake, P.E.; Neathery, M.W.; Miller, W.J.; Gentry, R.P.

    1975-01-01

    Eight male Holstein calves were given a single tracer intravenous dose of /sup 203/Hg as mercuric chloride or methyl mercury chloride 7 days before sacrifice. Total 7-day fecal and urinary Hg excretions were much higher from mercuric chloride dosing than from methyl mercury chloride. Retention of Hg from mercuric chloride was greater in kidney, liver, spleen, lung, testicle, rib shaft, tibia joint, tibia shaft, abomasum, small intestine, cecum, large intestine and pancreas and less in brain cerebellum and cerebrum, supraspinatus muscle and heart, and substantially lower in psoas and semitendinosus muscles. Fifteen minutes after dosing, whole blood Hg was lower from mercuric chloride followed by a similar rapid clearance for both Hg forms. Throughout the 7-day period, plasma Hg was greater from mercuric chloride. In red blood cells, Hg from methyl mercury chloride was higher during the first 2 hr after dosing, with no significant differences thereafter. 5 references, 2 figures, 1 table.

  3. Physiological studies of environmental pollutants. Progress report, September 1, 1975--May 31, 1976. [/sup 210/Po, /sup 203/Pb, /sup 201/Tl, /sup 207/Bi, /sup 65/Zn

    Energy Technology Data Exchange (ETDEWEB)

    Lengemann, F W; Wentworth, R A

    1976-01-01

    In the past year we have looked at the transfer of some members of the actinide decay series into milk of goats. These were /sup 210/Po, /sup 203/Pb, /sup 201/Tl and /sup 207/Bi. All of these appeared in milk after oral ingestion but at levels less than 1 percent per liter. In addition we have looked at the transfer of /sup 65/Zn into milk of goats after oral and I.V. doses; the experiments are incomplete at this time. In controlled temperature studies it was found that 6.6 times as much radioiodine was secreted into milk when goats were at 33/sup 0/ as opposed to 5/sup 0/C. When radioiodine is put into the mammary gland the transfer from milk to body is rapid; more rapid than is the case for /sup 65/Zn. The analysis of these data indicate the need for a model capable of handling expansion of a compartment.

  4. The Roles of miR-26, miR-29, and miR-203 in the Silencing of the Epigenetic Machinery during Melanocyte Transformation

    Directory of Open Access Journals (Sweden)

    Cláudia Regina Gasque Schoof

    2015-01-01

    Full Text Available The epigenetic marks located throughout the genome exhibit great variation between normal and transformed cancer cells. While normal cells contain hypomethylated CpG islands near gene promoters and hypermethylated repetitive DNA, the opposite pattern is observed in cancer cells. Recently, it has been reported that alteration in the microenvironment of melanocyte cells, such as substrate adhesion blockade, results in the selection of anoikis-resistant cells, which have tumorigenic characteristics. Melanoma cells obtained through this model show an altered epigenetic pattern, which represents one of the first events during the melanocytes malignant transformation. Because microRNAs are involved in controlling components of the epigenetic machinery, the aim of this work was to evaluate the potential association between the expression of miR-203, miR-26, and miR-29 family members and the genes Dnmt3a, Dnmt3b, Mecp2, and Ezh2 during cells transformation. Our results show that microRNAs and their validated or predicted targets are inversely expressed, indicating that these molecules are involved in epigenetic reprogramming. We also show that miR-203 downregulates Dnmt3b in mouse melanocyte cells. In addition, treatment with 5-aza-CdR promotes the expression of miR-26 and miR-29 in a nonmetastatic melanoma cell line. Considering the occurrence of CpG islands near the miR-26 and miR-29 promoters, these data suggest that they might be epigenetically regulated in cancer.

  5. Clinical utility of multiplex ligation-dependent probe amplification technique in identification of aetiology of unexplained mental retardation: A study in 203 Indian patients

    Directory of Open Access Journals (Sweden)

    Vijay R Boggula

    2014-01-01

    Full Text Available Background & objectives: Developmental delay (DD/mental retardation also described as intellectual disability (ID, is seen in 1-3 per cent of general population. Diagnosis continues to be a challenge at clinical level. With the advancement of new molecular cytogenetic techniques such as cytogenetic microarray (CMA, multiplex ligation-dependent probe amplification (MLPA techniques, many microdeletion/microduplication syndromes with DD/ID are now delineated. MLPA technique can probe 40-50 genomic regions in a single reaction and is being used for evaluation of cases with DD/ID. In this study we evaluated the clinical utility of MLPA techniques with different probe sets to identify the aetiology of unexplained mental retardation in patients with ID/DD. Methods: A total of 203 randomly selected DD/ID cases with/without malformations were studied. MLPA probe sets for subtelomeric regions (P070/P036 and common microdeletions/microduplications (P245-A2 and X-chromosome (P106 were used. Positive cases with MLPA technique were confirmed using either fluorescence in situ hybridization (FISH or follow up confirmatory MLPA probe sets. Results: The overall detection rate was found to be 9.3 per cent (19 out of 203. The detection rates were 6.9 and 7.4 per cent for common microdeletion/microduplication and subtelomeric probe sets, respectively. No abnormality was detected with probe set for X-linked ID. The subtelomeric abnormalities detected included deletions of 1p36.33, 4p, 5p, 9p, 9q, 13q telomeric regions and duplication of 9pter. The deletions/duplications detected in non telomeric regions include regions for Prader Willi/Angelman regions, Williams syndrome, Smith Magenis syndrome and Velocardiofacial syndrome. Interpretation & conclusions: Our results show that the use of P245-A2 and P070/P036-E1 probes gives good diagnostic yield. Though MLPA cannot probe the whole genome like cytogenetic microarray, due to its ease and relative low cost it is an

  6. Factors Associated with Advanced Inferior Vena Cava Filter Removals: A Single-Center Retrospective Study of 203 Patients Over 7 Years

    Energy Technology Data Exchange (ETDEWEB)

    Dowell, Joshua D., E-mail: Joshua.Dowell@osumc.edu; Wagner, Daniel, E-mail: Daniel.Wagner@osumc.edu; Elliott, Eric, E-mail: Eric.Elliott@osumc.edu [The Ohio State University Wexner Medical Center, Department of Radiology, Division of Interventional Radiology (United States); Yildiz, Vedat O., E-mail: Vedat.Yildiz@osumc.edu; Pan, Xueliang, E-mail: Jeff.Pan@osumc.edu [The Ohio State University Wexner Medical Center, Center for Biostatistics (United States)

    2016-02-15

    PurposeTo identify factors associated with advanced inferior vena cava filter (IVCF) retrieval to raise awareness on technical considerations, retrieval efficiency, and patient safety.Materials and MethodsA single-center retrospective review was performed of 203 consecutive retrievable IVC filters placed between 2007 and 2014. Attempted retrievals were classified as advanced if the routine “snare and sheath” technique was initially unsuccessful after multiple attempts, or an alternate endovascular maneuver or access site was utilized. Patient and filter characteristics were recorded.Results203 attempted retrievals were reviewed (48.7 % male, 51.2 % female, mean age 52.7 years, mean dwell time 109 days). Advanced retrievals were observed in 20 patients (9.8 %) (15 females, 5 males). Fluoroscopy time (p ≤ 0.01, 34.3 ± 21.1 and 5.3 ± 4.5 min for advanced retrievals and routine retrievals respectively, same below), gender (p = 0.031), and retrieval tilt angle (p ≤ 0.01, 5.7 ± 5.10° vs. 11.9 ± 11.03°) were associated with advanced retrievals. Females were 3.16 times more likely to have an advanced retrieval performed than males with a significantly higher tilt angle in those with advanced retrieval. History of cancer (p = 0.502), dwell time (p = 0.916), retrieval caval diameter (p = 0.053), placement caval diameter (p = 0.365), filter type (p = 0.710), strut perforation (p = 0.506), placement tilt angle (p = 0.311), and age (p = 0.558) were not found significantly associated with advanced retrievals.ConclusionsWomen are at increased risk for advanced filter retrieval secondary to a significant change in filter tilt over time compared to men, independent of filter type or competing demographic or filter risks, likely placing them at increased risk for higher procedural fluoroscopy times.

  7. NITRATE + NITRITE CONTENT (CONCENTRATION), PHOSPHATE, NITRITE, SILICATE and other profile and discrete sample data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX203, HX205 and others as part of the NEP project from 1998-03-08 to 2004-07-05 (NODC Accession 0115260)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115260 includes profile, discrete sample and chemical data collected aboard the ALPHA HELIX and WECOMA during cruises HX203, HX205, HX208, HX211,...

  8. SALINITY, WATER TEMPERATURE, FLUORESCENCE, PHOTOSYNTHETIC ACTIVE RADIATION (PAR) and other profile data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX201, HX203 and others as part of the NEP project from 1997-10-10 to 2004-12-09 (NODC Accession 0113922)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113922 includes profile, biological and physical data collected aboard the ALPHA HELIX and WECOMA during cruises HX201, HX203, HX205, HX208, HX211,...

  9. BIOMASS, SPECIES IDENTIFICATION, TAXONOMIC CODE, SPECIES IDENTIFICATION - LIFE STAGE and species abundance tows data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX201, HX203 and others as part of the NEP project from 1997-10-10 to 2004-10-07 (NODC Accession 0113896)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113896 includes tows and biological data collected aboard the ALPHA HELIX and WECOMA during cruises HX201, HX203, HX205, HX208, HX211, HX215, HX217,...

  10. BIOMASS, SPECIES IDENTIFICATION, SPECIES IDENTIFICATION - LIFE STAGE, TAXONOMIC CODE and species abundance tows data collected in the Gulf of Alaska on the ALPHA HELIX and WECOMA cruises HX201, HX203 and others as part of the NEP project from 1997-10-14 to 2004-10-08 (NODC Accession 0113956)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113956 includes tows and biological data collected aboard the ALPHA HELIX and WECOMA during cruises HX201, HX203, HX205, HX208, HX211, HX215, HX217,...

  11. Yield and excitation function measurements of some nuclear reactions on natural thallium induced by protons leading to the production of medical radioisotopes {sup 201}Tl and {sup 203}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Al-Saleh, F.S.; Al-Harbi, A.A. [Girls College of Education, Riyadh (Saudi Arabia). Physics Dept.; Azzam, A. [Nuclear Research Center, Cairo (Egypt). Nuclear Physics Dept.

    2007-07-01

    Excitation functions for {sup 201}Pb, {sup 202m}Pb, {sup 203}Pb and {sup 204m}Pb radionuclides which are formed via proton induced reactions with natural thallium target have been measured from their respective threshold (E{sub thr}) to 27.5 MeV using activation technique. Natural copper foils were used to monitor the cyclotron beam. The integral yields (MBq/{mu}A h) of the produced radionuclides were calculated from the measured excitation functions. The optimum proton energy range for the production of {sup 203}Pb with low amount of impurities is (16-10 MeV) after 5 h of EOB. The experimental cross-sections for {sup nat}Tl(p,xn) reactions were compared with the cross-sections recommended by the IAEA and with earlier published data when it was possible. (orig.)

  12. Intraoperative autotransfusion for repair of unruptured aneurysms of the infrarenal abdominal aorta. A multicenter study of 203 patients. Association Universitaire de Recherche en Chirurgie (AURC).

    Science.gov (United States)

    Patra, P; Chaillou, P; Bizouarn, P

    2000-06-01

    The goals of this study were to evaluate the costs and savings of intra- and postoperative blood transfusions as well as the potential biological modifications associated with the use of intraoperative blood salvage. Intraoperative autotransfusion (IOAT) with wash-out was prospectively studied during the repair of unruptured aneurysms of infrarenal abdominal aorta in 203 patients operated on in 13 institutions. The mean quantity of blood retrieved was 688+/-468 mL The mean quantity of blood derivatives and intraoperative solutes used for repletion was 4,261 ml, ranging from 1,723 ml between days 0 to D2 to 562 ml from D3 to D8. Ninety-eight patients did not receive any blood derivatives at all. Thirty-five patients received plasma to correct coagulation factors. The quantity of autotransfused globular concentrate was less than 500 ml in 89 patients. IOAT precluded the need for transfusion of homologous globular concentrates, particularly in those patients who had bled most. On average, more than two globular concentrates were recuperated. Use of IOAT led to financial savings. Perioperative bleeding is not the only factor that intervenes in the decision to transfuse globular concentrates. Postoperative dilution is the most important factor as attested by the amount of protides and the hematocrit. Coagulation factors are modified but remain compatible with normal hematosis in 83% of patients undergoing operation.

  13. Depth profile of production yields of {sup nat}Pb(p, xn) {sup 206,205,204,203,202,201}Bi nuclear reactions

    Energy Technology Data Exchange (ETDEWEB)

    Mokhtari Oranj, Leila [Division of Advanced Nuclear Engineering, POSTECH, Pohang 37673 (Korea, Republic of); Jung, Nam-Suk; Kim, Dong-Hyun; Lee, Arim; Bae, Oryun [Pohang Accelerator Laboratory, POSTECH, Pohang 37673 (Korea, Republic of); Lee, Hee-Seock, E-mail: lee@postech.ac.kr [Pohang Accelerator Laboratory, POSTECH, Pohang 37673 (Korea, Republic of)

    2016-11-01

    Experimental and simulation studies on the depth profiles of production yields of {sup nat}Pb(p, xn) {sup 206,205,204,203,202,201}Bi nuclear reactions were carried out. Irradiation experiments were performed at the high-intensity proton linac facility (KOMAC) in Korea. The targets, irradiated by 100-MeV protons, were arranged in a stack consisting of natural Pb, Al, Au foils and Pb plates. The proton beam intensity was determined by activation analysis method using {sup 27}Al(p, 3p1n){sup 24}Na, {sup 197}Au(p, p1n){sup 196}Au, and {sup 197}Au(p, p3n){sup 194}Au monitor reactions and also by Gafchromic film dosimetry method. The yields of produced radio-nuclei in the {sup nat}Pb activation foils and monitor foils were measured by HPGe spectroscopy system. Monte Carlo simulations were performed by FLUKA, PHITS/DCHAIN-SP, and MCNPX/FISPACT codes and the calculated data were compared with the experimental results. A satisfactory agreement was observed between the present experimental data and the simulations.

  14. Depth profiles of production yields of natPb(p, xn206,205,204,203,202 Bi reactions using 100-MeV proton beam

    Directory of Open Access Journals (Sweden)

    Oranj Leila Mokhtari

    2017-01-01

    Full Text Available In this study, results of the experimental study on the depth profiles of production yields of 206,205,204,203,202Bi radio-nuclei in the natural Pb target irradiated by a 100-MeV proton beam are presented. Irradiation was performed at proton linac facility (KOMAC in Korea. The target, irradiated by 100-MeV protons, was arranged in a stack consisting of natural Pb, Al, Au foils and Pb plates. The proton beam intensity was determined by activation analysis method using 27Al(p, 3p1n24Na, 197Au(p, p1n196Au, and 197Au(p, p3n194Au monitor reactions and also using dosimetry method by a Gafchromic film. The production yields of produced Bi radio-nuclei in the natural Pb foils and monitor reactions were measured by gamma-ray spectroscopy. Monte Carlo simulations were performed by FLUKA, PHITS, and MCNPX codes and compared with the measurements in order to verify validity of physical models and nuclear data libraries in the Monte Carlo codes. A fairly good agreement was observed between the present experimental data and the simulations by FLUKA, PHITS, and MCNPX. However, physical models and the nuclear data relevant to the end of range of protons in the codes need to be improved.

  15. Estrategias de enseñanza para el curso EIF-203 Estructuras discretas para informática a través del uso de las redes sociales Facebook y Twitter

    Directory of Open Access Journals (Sweden)

    Enrique Vílchez Quesada

    2014-05-01

    Full Text Available Recibido 29 de octubre de 2013 • Corregido 2 de marzo de 2014 • Aceptado 2 de abril de 2014. Este artículo corresponde a un trabajo científico derivado del proyecto de investigación en docencia adscrito a la Escuela de Informática de la Universidad Nacional de Costa Rica (UNA, titulado: Facebook como herramienta de enseñanza y aprendizaje para el curso EIF-203 Estructuras discretas para informática a través del uso de cuadernos interactivos. El objetivo general del proyecto consistió en analizar técnica y pedagógicamente la red social Facebook como un entorno de enseñanza y aprendizaje. En este documento se presenta una serie de estrategias de enseñanza creadas para complementar la docencia en el contexto del curso EIF-203, utilizando como plataforma educativa las redes sociales Facebook y Twitter. Las estrategias compartidas constituyen una intensa búsqueda de nuevas metodologías para mejorar los procesos de enseñanza e, idealmente, los procesos de aprendizaje en la materia EIF-203, integrada dentro del plan de estudios de la carrera Ingeniería en Sistemas de Información de la UNA. Estas fueron implementadas en un grupo de 31 estudiantes de la Sede Interuniversitaria de Alajuela, durante el I semestre 2013. Lo anterior permitió evaluar las estrategias de enseñanza desarrolladas utilizando una metodología de carácter cuantitativo. El instrumento empleado (un cuestionario se validó mediante una prueba de fiabilidad “Alfa de Cronbach” recurriendo a una muestra de 65 participantes. Los resultados obtenidos forman parte del análisis expuesto en el presente trabajo.

  16. Search for squarks and gluinos with the ATLAS detector in final states with jets and missing transverse momentum and 20.3 $fb^{−1}$ of $\\sqrt{s}$=8 TeV proton-proton collision data

    CERN Document Server

    Javurek, T; The ATLAS collaboration

    2016-01-01

    Weak scale supersymmetry is one of the best motivated and studied Standard Model extensions. It predicts the existence of new heavy coloured particles called squarks and gluinos which are the supersymmetric partners of the quarks and gluons respectively. The poster summarises results on inclusive searches for supersymmetric squarks and gluinos in events containing jets and missing transverse momentum without leptons. The searches use the full data sample of $20.3fb^{-1}$ recorded in 2012 at $\\sqrt{s}=8$TeV centre-of-mass energy by the ATLAS experiment at the LHC.

  17. Femtosecond stage of electron transfer in reaction centers of the triple mutant SL178K/GM203D/LM214H of Rhodobacter sphaeroides.

    Science.gov (United States)

    Yakovlev, A G; Shkuropatova, T A; Shkuropatova, V A; Shuvalov, V A

    2010-04-01

    Coherent processes in an initial phase of charge transfer in reaction centers (RCs) of the triple mutant S(L178)K/G(M203)D/L(M214)H of Rhodobacter sphaeroides were investigated by difference (light - dark) absorption spectroscopy with 18 fsec time resolution. Electron transfer in the B cofactor branch is activated in this mutant, while the A-branch electron transfer is slowed in comparison with native RCs of Rba. sphaeroides. A bulk of absorption difference spectra was analyzed in the 940-1060 nm range (stimulated emission of excited bacteriochlorophyll dimer P* and absorption of bacteriochlorophyll anions B(A)(-) and beta(-), where beta is a bacteriochlorophyll substituting the native bacteriopheophytin H(A)) and in the 735-775 nm range (bleaching of the absorption band of the bacteriopheophytin H(B) in the B-branch) in the -0.1 to 4 psec range of delays with respect to the moment of photoexcitation of P at 870 nm. Spectra were measured at 293 and 90 K. The kinetics of P* stimulated emission at 940 nm shows its decay with a time constant of approximately 14 psec at 90 K and approximately 18 psec at 293 K, which is accompanied by oscillations with a frequency of approximately 150 cm(-1). A weak absorption band is found at 1018 nm that is formed approximately 100 fsec after excitation of P and reflects the electron transfer from P* to beta and/or B(A) with accumulation of the P(+)beta(-) and/or P(+)B(A)(-) states. The kinetics of DeltaA at 1018 nm contains the oscillations at approximately 150 cm(-1) and distinct low-frequency oscillations at 20-100 cm(-1); also, the amplitude of the oscillations at 150 cm(-1) is much smaller at 293 than at 90 K. The oscillations in the kinetics of the 1018 nm band do not contain a 32 cm(-1) mode that is characteristic for native Rba. sphaeroides RCs having water molecule HOH55 in their structure. The DeltaA kinetics at 751 nm reflects the electron transfer to H(B) with formation of the P(+)H(B)(-) state. The oscillatory part of

  18. Millimeter- and submillimeter-wave surveys of Orion A emission lines in the ranges 200.7-202.3, 203.7-205.3, and 330-360 GHz

    Science.gov (United States)

    Jewell, P. R.; Hollis, J. M.; Lovas, F. J.; Snyder, L. E.

    1989-01-01

    A continuous spectral line survey of the Orion A position from 330.5 to 360.1 GHz was carried out. This survey covers nearly the entire 870 micron atmospheric window accessible from ground-based observations. Approximately 160 distinct spectral features composed of about 180 lines were detected, 29 of which could not be readily identified. In addition, Orion A from 200.7 to 202.3 GHz and from 203.7 to 205.3 GHz and 42 distinct new spectral lines were detected, including four that are unidentified at present. These data sets are the first thorough survey results in these spectral regions. The new interstellar lines in the survey bands are tabulated and displayed graphically. Moreover, the data are being made available to the Astronomical Data Center at the Goddard Space Flight Center for distribution by request to the astronomical community.

  19. Ratio of late to early radionuclide uptake: a method for distinguishing osteoporosis from osteomalacia in animal models. [/sup 131/Ba, /sup 85/Sr, /sup 203/Pb, /sup 111/In, rats

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, J.S.; Genant, H.K.; Hattner, R.S.; Hoffer, P.B.

    1978-01-01

    The ratio of late to early uptake of several radionuclides was examined as a method for distinguishing states of abnormal bone metabolism. Nutritional osteoporosis (secondary hyperparathyroidism) and osteomalacia were produced in young rats and compared to a control group. The ratio of early (3 to 6 hrs) to late (4 to 6 days) uptake of barium-131, nitrate, indium-111 EDTMP, and lead-203 were studied, as was that of strontium-85 chloride, a calcium analogue. Ratios of late to early uptake were found to distinguish osteomalacia from osteoporosis in the models when strontium-85 or barium-131 were used. Barium-131 may be a clinically useful alternative to strontium-85 in the evaluation of metabolic bone disease due to its shorter half-life and lower radiation dose.

  20. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  1. Indirect immunofluorescence(IgG and IgM tests for toxoplasmosis on 203 persons, with no symptomatology suggesting the disease, located in the city of Rio de Janeiro. Serological follow up one to two years later.

    Directory of Open Access Journals (Sweden)

    Maria Regina Reis Amendoeira

    1981-12-01

    Full Text Available Clinical and serological follow up examinations were performed on 203 persons, from three to twenty years of age, from the otolaryngology department of a hospital in the city of Rio de Janeiro, with no symptomatology suggesting toxoplasmosis, but suffering from chronic tonsillitis. According to results obtained during the first indirect immunofluorescence tests, the patients were divided into following groups: Group I (non-reactive IgG and IgM, 98 persons (48.3%; Group II (1:16 ≤ IgG ≤ 1:256 and non-reactive IgM, 74 persons (36.5%; Group III (IgM ≥ 1:1024 and non-reactive IgM, 18 persons (8.8%, and Group IV (IgG and IgM reactive, 13 persons (6.4%. One to two years later, 131 (64.5% of the 203 persons were reexamined by a second indirect immunofluorescence test. In the case of 66 persons (Group I whose serum was non-reactive in the IgG and IgM classes during the first indirect immunofluorescence test, serum conversion was observed in aproximately 21.2%. in 65 individuals (49.6%, (Groups II, III and IV,with reactive serum in the IgG classes during the first indirect immunofluorescence test, the second reaction showed an increase in titres in 20% of the cases, a decrease in 67.7% of the cases, or no alterations in 12.3 of the cases. In the IgM class, all 131 sera were non-reactive at 116 dilution the second immunofluorescence test, including the 13 cases that had previously been reactive in the immunoglobulin class, Symptomatology suggesting toxoplasmosis was only observed in one case during the second testing, this patient's principal physical sign being hypertrophied lymph nodes. during this period, the Toxoplasma antibodies showed titres of IgG 1:32000 and non-reactive IgM, whilst one year previously, during the first test, these titres were IgG 1:1024 and IgM 1:64. Differences in the age, sex and skin coloring of patients were not statistically significant as regards alterations in the indirect immunofluorescence test titres.Foi feito o

  2. Search for Vector-like Quarks using trilepton and same-sign dilepton events in 20.3 fb$^{-1}$ of proton-proton collisions at $\\sqrt{s}$ = 8 TeV with the ATLAS detector

    CERN Document Server

    O'Grady, Fionnbarr

    A search is presented for vector-like quarks using 20.3 ​fb$^{-1}$​ of proton-proton collisions at a center-of-mass energy of ​$\\sqrt{s}$​ = 8 TeV collected with the ATLAS detector​ ​in 2012 at the CERN Large Hadron Collider. Vector-like quarks are predicted to​ ​exist in many theories beyond the Standard Model of particle physics that attempt​ ​to resolve the hierarchy problem. Events are selected containing jets including at​ ​​least one b-jet, sizable missing transverse momentum, large scalar sum of the jet​ ​and lepton transverse momenta, and either three leptons or two leptons with the​ ​same electric charge. Standard Model processes rarely produce this ​final state and​ ​production of vector-like quarks would lead to an enhanced rate of such events. The​ ​data are interpreted in the context of a variety of models including pair production​ ​of vector-like quarks T and B, which have the same electric charge as the corresponding Standard Model quarks and can...

  3. Green space is associated with walking and moderate-to-vigorous physical activity (MVPA) in middle-to-older-aged adults: findings from 203 883 Australians in the 45 and Up Study.

    Science.gov (United States)

    Astell-Burt, Thomas; Feng, Xiaoqi; Kolt, Gregory S

    2014-03-01

    Green space is widely hypothesised to promote physical activity. Few studies, however, examine whether this is the case for walking and moderate-to-vigorous physical activity (MVPA). We investigated to what extent neighbourhood green space was associated with weekly participation and frequency of walking and MVPA in a large cross-sectional survey of Australian adults 45 years and older. Logit and negative binomial regression were used to estimate the degree of association between walking, MVPA and neighbourhood green space in a sample of 203 883 adults from the Australian 45 and Up Study. Walking and MVPA were measured using the Active Australia Survey. Green space was measured as a percentage of the total land-use within 1 km radius of residence. We controlled for a range of individual and neighbourhood characteristics. 86.6% of the sample walked and 85.8% participated in MVPA at least once a week. These rates fell steeply with age. Compared with residents of neighbourhoods containing 0-20% green space, those in greener areas were significantly more likely to walk and participate in MVPAs at least once a week (trend for both pgreen space participated with a greater frequency of walking (incidence rate ratio (IRR) 1.09, 95% CI 1.05 to 1.13) and MVPA (IRR 1.10, 95% CI 1.05 to 1.15). Our findings suggest that the amount of green space available to adults in middle-to-older age within their neighbourhood environments could help to promote walking and MVPA.

  4. Subsite-based alterations in miR-21, miR-125b, and miR-203 in squamous cell carcinoma of the oral cavity and correlation to important target proteins

    Directory of Open Access Journals (Sweden)

    Linda Boldrup

    2012-01-01

    Full Text Available Background: MicroRNAs (miRNAs are small noncoding RNA molecules with an essential role in regulation of gene expression. miRNA expression profiles differ between tumor and normal control tissue in many types of cancers and miRNA profiling is seen as a promising field for finding new diagnostic and prognostic tools. Materials and Methods: In this study, we have analyzed expression of three miRNAs, miR-21, miR-125b, and miR-203, and their potential target proteins p53 and p63, known to be deregulated in squamous cell carcinoma of the head and neck (SCCHN, in two distinct and one mixed subsite in squamous cell carcinoma in the oral cavity. Results: We demonstrate that levels of miRNA differ between tumors of different subsites with tongue tumors showing significant deregulation of all three miRNAs, whereas gingival tumors only showed significant downregulation of miR-125b and the mixed group of tumors in tongue/floor of the mouth showed significant deregulation of miR-21 and miR-125b. In the whole group of oral squamous cell carcinoma (SCC, a significant negative correlation was seen between miR-125b and p53 as well as a significant correlation between TP53 mutation status and miR-125b. Conclusion: The present data once again emphasize the need to take subsite into consideration when analyzing oral SCC and clearly show that data from in vitro studies cannot be transferred directly to the in vivo situation.

  5. 23 CFR 620.203 - Procedures.

    Science.gov (United States)

    2010-04-01

    ... standards for the facility involved; (3) That the release will not adversely affect the Federal-aid highway... order to restore, preserve, or improve the scenic beauty adjacent to the highway consonant with the...

  6. 18 CFR 1304.203 - Vegetation management.

    Science.gov (United States)

    2010-04-01

    ... mowed within the access corridor, and stone, brick, concrete, mulch, or wooden paths, walkways and/or... for erosion control projects must be replaced with native species of vegetation. (j) The forest floor...

  7. Publications | Page 203 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Can India become an export platform for global operations of Japanese and American multinational corporations affiliates? (restricted access). This paper examines various indicators of the economic activities of Japanese and American multinational corporation (MNC) affiliates in India compared to the case of China, using ...

  8. 28 CFR 42.203 - Discrimination prohibited.

    Science.gov (United States)

    2010-07-01

    ... summary punishment, or deny any individual the rights guaranteed by the Constitution to all persons; (9..., section 815(c)(1) of the JSIA shall be interpreted by the Office consistently with title VII of the Civil Rights Act of 1964, Public Law 88-352, 79 Stat. 253, as amended by the Equal Employment Opportunity Act...

  9. 47 CFR 13.203 - Examination elements.

    Science.gov (United States)

    2010-10-01

    ... Training for Radio Personnel (GMDSS), Annex 3. (7) Element 8: Ship radar techniques. Questions concerning specialized theory and practice applicable to the proper installation, servicing and maintenance of ship radar... procedures and practices that are applicable to ship stations on vessels that sail exclusively in sea area A1...

  10. 48 CFR 31.203 - Indirect costs.

    Science.gov (United States)

    2010-10-01

    ... fiscal year used for financial reporting purposes in accordance with generally accepted accounting... contract or other work, indirect costs are those remaining to be allocated to intermediate or two or more... basis of the benefits accruing to intermediate and final cost objectives. When substantially the same...

  11. 47 CFR 20.3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... emergency medical services provider, or fire department. Automatic Number Identification (ANI). A system that identifies the billing account for a call. For 911 systems, the ANI identifies the calling party... of receiving compensation or monetary gain; (2) An interconnected service; and (3) Available to the...

  12. 48 CFR 370.203 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... SPECIAL PROGRAMS AFFECTING ACQUISITION Indian Preference in Employment, Training, and Subcontracting...-owned commercial, industrial, or business activity established or organized for the purpose of profit...

  13. MISSING MATTHEW'S MEANING. WITH 'TEXTUAL MEANING' 203 ...

    African Journals Online (AJOL)

    communication and of textual meaning are inadequate. Let me pause to emphasize the two "phenomena" involved here. One is the vast phenomenon of linguistic, or if you like, verbal communication. The other is the marginally less vast phenomenon of textual meaning. So what, you may be wondering, are the relevance.

  14. 22 CFR 203.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... organization designated by USAID as a voluntary, independent business enterprise formed to meet specific needs... or abroad, or public international organizations such as the United Nations and the World Health...

  15. 50 CFR 223.203 - Anadromous fish.

    Science.gov (United States)

    2010-10-01

    ... government in Oregon and pursuant to ordinances that Metro has found comply with its Urban Growth Management... of stormwater management and other conservation measures; and a summary of any flood damage... steelhead harvest. If NMFS does not receive a fishery management plan for Puget Sound steelhead by November...

  16. 5 CFR 2635.203 - Definitions.

    Science.gov (United States)

    2010-01-01

    ..., discount, entertainment, hospitality, loan, forbearance, or other item having monetary value. It includes... coverage. A corporate hotel chain, which does not meet the definition of a prohibited source for DOJ...

  17. 5 CFR 2640.203 - Miscellaneous exemptions.

    Science.gov (United States)

    2010-01-01

    ... an action against Alpha for failing to make required payments to its employee pension fund, even...) Ownership of publicly traded securities issued by the corporation; or (2) Participation in a pension plan... by the board's recommendations because all SES awards are derived from the same limited pool of funds...

  18. 21 CFR 131.203 - Lowfat yogurt.

    Science.gov (United States)

    2010-04-01

    ... be decreased as a result of adding such ingredients. (2) Nutritive carbohydrate sweeteners. Sugar (sucrose), beet or cane; invert sugar (in paste or sirup form); brown sugar; refiner's sirup; molasses..., dried maltose sirup; malt extract, dried malt extract; malt sirup, dried malt sirup; honey; maple sugar...

  19. 24 CFR 203.673 - Habitability.

    Science.gov (United States)

    2010-04-01

    ... market value of the property. The cost of hazard reduction or abatement of lead-based paint hazards in... regulations in part 35 of this title, is excluded from these repair cost limitations. (b)(1) Each residential..., exposed or unsafe electrical wiring, or an accumulation of minor hazards, such as broken stairs. (c) If...

  20. 32 CFR 203.5 - TAPP process.

    Science.gov (United States)

    2010-07-01

    ... restoration program at the installation and its impact upon the community. These factors include, but are not... the nature and extent of contamination or the proposed remedial actions. Eligibility requirements for... under $100,000, the acquisition is reserved for small businesses, unless there is a reasonable...

  1. 24 CFR 203.251 - Definitions.

    Science.gov (United States)

    2010-04-01

    ...) Debentures means registered, transferable securities in certificated or book entry form which are valid and binding obligations, issued in the name of the Mutual Mortgage Insurance Fund in accordance with the... to be used within an automated underwriting system (AUS). TOTAL is a tool to assist the mortgagee in...

  2. 24 CFR 203.200 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... defect: Roofing; drywall and plaster; exterior siding; brick, stone, or stucco veneer; floor covering... attached garages; electrical; plumbing, heating, cooling and ventilation systems; appliances, fixtures and...

  3. 24 CFR 3282.203 - DAPIA services.

    Science.gov (United States)

    2010-04-01

    ... of electrical load and branch circuit calculations, a table of the branch circuit protection provided... and procedures for the erection and hook-up of the home at its permanent location, and (11) Reports of...

  4. 5 CFR 845.203 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... established by the FCCS (4 CFR part 103). Consumer reporting agency has the same meaning provided in 31 U.S.C.... Reconsideration means the process of reexamining an individual's liability for a debt based on— (a) Proper... decision not to recover a debt under authority of 5 U.S.C. 8470(b). ...

  5. Publications | Page 203 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Performance analysis of decode-and-forward multi-hop communication : a difference equation approach (restricted access). The presence of multiple users between signal transmission source and destination enables division of long links into multiple shorter links; this reduces signal attenuation, extends battery life, and ...

  6. 15 CFR 20.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... necessarily imply a particular age or range of ages (for example: “children,” “adult,” “older persons,” but... other school system; (3)(i) An entire corporation, partnership, or other private organization, or an..., State statute, or local statute or ordinance adopted by an elected, general purpose legislative body. (n...

  7. 48 CFR 203.903 - Policy.

    Science.gov (United States)

    2010-10-01

    ... DEFENSE GENERAL IMPROPER BUSINESS PRACTICES AND PERSONAL CONFLICTS OF INTEREST Whistleblower Protections... related to a DoD contract (including the competition for or negotiation of a contract): (i) A Member of...

  8. 32 CFR 203.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    .... Application. A completed formal written request for TAPP that is submitted to the installation commander or to... legally authorized to obligate the organization executing a TAPP purchase order to the terms and... communications with the Department of Defense regarding the TAPP procurement process. The community point of...

  9. 5 CFR 752.203 - Procedures.

    Science.gov (United States)

    2010-01-01

    ... cause a conflict of interest or position, or an employee of the agency whose release from his or her official position would give rise to unreasonable costs or whose priority work assignments preclude his or... Procedures. (a) Employee entitlements. An employee under this subpart whose suspension is proposed under this...

  10. BDML Metadata: 203 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available Ce_KK_P002 BDML file for quantitative information about nuclear division dynamics o...f T12D8.6(RNAi) embryo quantitative information about nuclear division dynamics in T12D8.6(RNAi) embryo C. e...legans nuclear division dynamics T12D8.6(gPCR)071101_02 Measurement Kyoda, K., Furukawa, M., Arai, R., Onami

  11. 24 CFR 945.203 - Allocation plan.

    Science.gov (United States)

    2010-04-01

    ... DESIGNATED HOUSING-PUBLIC HOUSING DESIGNATED FOR OCCUPANCY BY DISABLED, ELDERLY, OR DISABLED AND ELDERLY...; (iii) Representative advocacy groups for each of these family types: disabled families, elderly families, and families with children, where such advocacy groups exist; (iv) Representatives of the...

  12. 47 CFR 90.203 - Certification required.

    Science.gov (United States)

    2010-10-01

    ... prior to September 1, 1996 for use by LMS systems. (c) Radiolocation transmitters for use in public... must provide the algorithm used to reduce the equivalent isotropically radiated power (EIRP) to the...

  13. Reference: 203 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 92-701 15854901 2005 Apr Current biology Chelysheva Liudmila|Doutriaux Marie-Pascale|Giovanni Mait辿|Grelon Mathilde|Horlow Christine...|Huppe Emelyne|Jolivet Sylvie|Mercier Rapha谷l|M辿zard Christine|Nogu辿 Fabien|Vezon Daniel

  14. 49 CFR 228.203 - Program components.

    Science.gov (United States)

    2010-10-01

    ... Program components. (a) System security. The integrity of the program and database must be protected by a security system that utilizes an employee identification number and password, or a comparable method, to... Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION...

  15. 20 CFR 655.203 - Assurances.

    Science.gov (United States)

    2010-04-01

    ... service system in the active recruitment of U.S. workers until the foreign workers have departed for the..., corporation or organization in order to secure foreign workers, making the same kind and degree of efforts to secure U.S. workers; (e) From the time the foreign workers depart for the employer's place of employment...

  16. 50 CFR 665.203 - Permits.

    Science.gov (United States)

    2010-10-01

    ... single vessel for use with a Ho'omalu Zone permit and a Mau Zone permit at the same time. Mau Zone... permit holder's application. The Ho'omalu Zone and the Mau Zone limited entry systems described in this... as described in § 665.13. (2) Ho'omalu Zone limited access permit. In addition to an application...

  17. 40 CFR 211.203 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... all trials under otherwise identical test conditions. (cc) Reverberation Time. The time that would be... characterized by very short rise time and duration. (o) Label. That item, as described in this regulation, which... field in which the angle of arrival of sound at a given point in space is random in time. (bb) Real-Ear...

  18. 23 CFR 668.203 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS EMERGENCY RELIEF... engineering (PE), construction engineering (CE), and temporary traffic operations, undertaken during or... occurrence such as a flood, hurricane, severe storm, tidal wave, earthquake, or landslide which causes...

  19. 33 CFR 203.83 - Additional requirements.

    Science.gov (United States)

    2010-07-01

    ..., placing sod, or seeding completed work. (d) Adequacy of requirements of local cooperation. In determining... furnishing flood fight assistance during an emergency. (b) Areas of minor damage, flood control works... maintenance requirements if apparent inadequacies of protective works indicate maintenance costs will be...

  20. 5 CFR 179.203 - Definitions.

    Science.gov (United States)

    2010-01-01

    ...) Other independent establishments that are entities of the Federal Government. Certification means a...: Agency means: (1) An Executive Agency as defined by section 105 of title 5, United States Code; (2) A... the paying agency to offset the salary of an employee. Claim See debt. Creditor agency means an agency...

  1. 42 CFR 37.203 - Autopsy specifications.

    Science.gov (United States)

    2010-10-01

    ...) Shall include: (i) Gross and microscopic examination of the lungs, pulmonary pleura, and tracheobronchial lymph nodes; (ii) Weights of the heart and each lung (these and all other measurements required... shall be measured at a point midway between the tricuspid valve and the apex, and the left ventricle...

  2. 29 CFR 20.3 - Agency responsibilities.

    Science.gov (United States)

    2010-07-01

    ... the Secretary of Labor FEDERAL CLAIMS COLLECTION Disclosure of Information to Credit Reporting... report all delinquent consumer debts to consumer credit reporting agencies and may also report all commercial debts to appropriate commercial credit reporting agencies. (b) Information provided to a consumer...

  3. 48 CFR 16.203-2 - Application.

    Science.gov (United States)

    2010-10-01

    ... bid contracts, see 14.408-4. (a) In establishing the base level from which adjustment will be made... clause. (b) In contracts that do not require submission of certified cost or pricing data, the contracting officer shall obtain adequate data to establish the base level from which adjustment will be made...

  4. 10 CFR 600.203 - Applicability.

    Science.gov (United States)

    2010-01-01

    ... Budget Reconciliation Act of 1981 (Community Services; Preventive Health and Health Services; Alcohol, Drug Abuse, and Mental Health Services; Maternal and Child Health Services; Social Services; Low-Income...), Alcohol and Drug Abuse Treatment and Rehabilitation Block Grant and part C of Title V, Mental Health...

  5. Dicty_cDB: VSH203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SLB133 (SLB133Q) /CSM/SL/SLB1-B/SLB133Q.Seq.d/ 442 e-123 SLI866 (SLI866Q) /CSM/SL/SLI8-C/SLI866Q.Seq.d/ 440 e-123 SLD508 (SLD50...8Q) /CSM/SL/SLD5-A/SLD508Q.Seq.d/ 406 e-112 VFE757 (VFE757Q) /CSM/VF/VFE7-C/VFE757Q.Seq....yostelium discoideum slug cDNA, clone SLD508. 406 e-109 1 ( AU267066 ) Dictyostelium discoideum vegetative c

  6. 31 CFR 203.19 - Sources of balances.

    Science.gov (United States)

    2010-07-01

    ... investments, an investor depositary, or a retainer depositary to participate in the investment program... transactions, Fedwire® non-value transactions, and Fedwire® value transfers pursuant to subpart B of this part...

  7. 26 CFR 601.203 - Offers in compromise.

    Science.gov (United States)

    2010-04-01

    ... compromise of civil cases involving liability of $100,000 or more, based solely on doubt as to liability... respect to compromise of civil cases involving liability under $100,000, and of certain specific penalties... are asserted, or specific civil or criminal penalties are incurred by taxpayers. A criminal liability...

  8. 24 CFR 3286.203 - Installation license required.

    Science.gov (United States)

    2010-04-01

    ... home manufacturer under warranty or other obligations or service agreements; (6) Installations performed by authorized representatives of the Federal Emergency Management Agency in order to provide...

  9. 24 CFR 203.605 - Loss mitigation performance.

    Science.gov (United States)

    2010-04-01

    ... (Tiers 1, 2, 3, and 4), with Tier 1 representing the highest or best ranking mortgagees and Tier 4 representing the lowest or least satisfactory ranking mortgagees. The precise methodology for calculating the... Ranking System (TRS). Under the TRS, HUD will analyze each mortgagee's loss mitigation efforts portfolio...

  10. Dicty_cDB: SFK203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pnt*icnygcigcnyrflcsywwcfnirsit --- Frame B: EPVPWYSNIPQKIKNSMSKETITILIYVVLYVTSGVINSVLLKKVMNKFTNYAFFLSQLT NF... Frames) Frame A: rasamvlkyttkn*klye*rnnhnfnlcsficylwcnq*cfikksyeqiyklcifp*sid kfwlctnfwssnsi*dflykgyparnkrf

  11. 48 CFR 28.203-2 - Acceptability of assets.

    Science.gov (United States)

    2010-10-01

    ... cash equivalents with a federally insured financial institution; (2) United States Government... security exchanges are—(i) the New York Stock Exchange; (ii) the American Stock Exchange; (iii) the Boston Stock Exchange; (iv) the Cincinnati Stock Exchange; (v) the Midwest Stock Exchange; (vi) the...

  12. 49 CFR 172.203 - Additional description requirements.

    Science.gov (United States)

    2010-10-01

    ..., there must be entered for— (1) Anhydrous ammonia. (i) The words “0.2 PERCENT WATER” to indicate the... transportation as “limited quantity,” as authorized by this subchapter, must include the words “Limited Quantity... labels. (6) For a package containing fissile Class 7 (radioactive) material: (i) The words “Fissile...

  13. 22 CFR 203.8 - IPVO annual documentation requirements.

    Science.gov (United States)

    2010-04-01

    ... by an independent CPA; or unaudited financial statements if total support and revenue is less than... the USAID Registrar, Office of Private Voluntary Cooperation—American Schools & Hospitals Abroad, 1300...

  14. 22 CFR 203.7 - IPVO initial documentation requirements.

    Science.gov (United States)

    2010-04-01

    ... for applying for registration; and (ii) A description of current or intended program activities abroad... IPVO's country of domicile by an independent certified public accountant (CPA) and in U.S. dollars; (6... Schools & Hospitals Abroad, 1300 Pennsylvania Avenue, NW., Washington, DC 20523-7600. ...

  15. 28 CFR 55.6 - Coverage under section 203(c).

    Science.gov (United States)

    2010-07-01

    ... citizens are members of a single language minority group and are limited-English proficient; and (ii) The... limited-English proficient; (ii) The illiteracy rate of such language minority citizens in the state is... (ii) The illiteracy rate of such language minority citizens in the political subdivision is higher...

  16. 12 CFR Supplement I to Part 203 - Staff Commentary

    Science.gov (United States)

    2010-01-01

    ... transitory residences such as hotels, hospitals, and college dormitories—whose occupants have principal... “Metropolitan Division.” The U.S. Office of Management and Budget defines Metropolitan Statistical Areas and...

  17. 24 CFR 203.552 - Fees and charges after endorsement.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Fees and charges after endorsement....552 Fees and charges after endorsement. (a) The mortgagee may collect reasonable and customary fees and charges from the mortgagor after insurance endorsement only as provided below. The mortgagee may...

  18. 48 CFR 15.203 - Requests for proposals.

    Science.gov (United States)

    2010-10-01

    ... information regarding cost comparisons between Government and contractor performance. (c) Electronic commerce... RFP shall specify the electronic commerce method(s) that offerors may use (see subpart 4.5). (d... and suitability of electronic commerce methods; and (iv) Adequacy of administrative procedures and...

  19. All projects related to | Page 203 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2013-02-01

    Releasing freely accessible, standardized, and easily readable government data can increase transparency and accountability. Start Date: February 1, 2013. End Date: February 1, 2016. Topic: INFORMATION SYSTEMS, INFORMATION POLICY, Internet, ACCESS TO INFORMATION, DEVELOPING COUNTRIES, Economic ...

  20. 14 CFR 1216.203 - Definition of key terms.

    Science.gov (United States)

    2010-01-01

    ... similar areas such as sloughs, potholes, river overflows, mud flats, wet meadows, and natural ponds... roads or utilities into or near a floodplain, therefore making floodplain development more feasible. ...

  1. 49 CFR 377.203 - Extension of credit to shippers.

    Science.gov (United States)

    2010-10-01

    ...-receipt of a carrier's freight bill, or shipper's payment check lost in the mail, or carrier mailing of... service if the carrier's bill of lading independently provides that the shipper is liable for fees... collection charges though contract terms in a bill of lading. By using the carrier and its bill of lading...

  2. Dicty_cDB: VFJ203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ELQSEN GLLGMGPFPKMGEHDADLINAGKETVTTIPGSSIFSSADSFAMIRGGHVDLTILGGMQVS GNGDLANWVIPGSMVKGPGGAMDLTSSGSRVV...ELQSEN GLLGMGPFPKMGEHDADLINAGKETVTTIPGSSIFSSADSFAMIRGGHVDLTILGGMQVS GNGDLANWVIPGSMVKGPGGAMDLTSSGSRVV

  3. Dicty_cDB: SHC203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A sequence. 56 0.001 1 CV682907 |CV682907.1 service43_H06_sjs2-16-2B11-T3 SJS Schistosoma japonicum cDNA, mR...NA sequence. 56 0.001 1 CV682854 |CV682854.1 service30_G09_sjs2-14-10C09-T3 SJS Schistosoma japonicum cDNA,

  4. Probing fusion-fission dynamics in Bi203

    Science.gov (United States)

    Mukul, Ish; Nath, S.; Golda, K. S.; Jhingan, A.; Gehlot, J.; Prasad, E.; Kalkal, Sunil; Naik, M. B.; Banerjee, Tathagata; Varughese, T.; Sugathan, P.; Madhavan, N.; Pal, Santanu

    2015-11-01

    Background: Complete fusion between two massive nuclei after capture inside the potential barrier is inhibited by competing fission-like processes. The target-projectile composite system may reseparate after capture without proceeding towards formation of the compound nucleus (CN), which is equilibrated in all degrees of freedom. The nature of these non-CN fission (NCNF) processes and factors that affect them are not completely known yet. Purpose: The nuclear mass regions from where NCNF processes begin to manifest themselves are not clearly demarcated. This work aims to study the onset of NCNF, if any, in the mass region ˜200 . Methods: Fission fragment (FF) mass and angular distribution (MAD) and pre-scission and post-scission neutron multiplicities were measured for the reaction +W184F19 at a laboratory energy (Elab) range of 84-125 MeV. The measurements were carried out using two multiwire proportional counters (MWPC) to detect the FFs in coincidence and four neutron detectors to measure neutron time of flight (TOF). Statistical model (SM) calculation was performed. Results: No significant mass-angle correlation was observed in the MAD plots. Extracted mass ratio distributions were single-peaked and of Gaussian shape. Measured pre-scission neutron multiplicity values indicated dissipative nature of CN decay for this reaction. Conclusions: No clear signatures of NCNF were observed in the studied reaction, indicating that the target-projectile composite system predominantly proceeds towards formation of the CN after capture.

  5. 41 CFR 101-42.203 - Reassignment of hazardous materials.

    Science.gov (United States)

    2010-07-01

    ... perpetuate in the inventory or control records visibility of the nature of the actual or potential hazard. ... Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS UTILIZATION AND DISPOSAL 42-UTILIZATION...

  6. 22 CFR 203.6 - IPVO conditions of registration.

    Science.gov (United States)

    2010-04-01

    ... institution of education, private foundation, hospital, organization engaged exclusively in research or... generally accepted accounting principles (GAAP) or generally accepted accounting standards of IPVO's country...

  7. Dicty_cDB: CFK203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available stercoralis cDNA 5' similar to WP:C41C4.8 CE05402 TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE HOMOLOG 2 ;, mRNA...Full=Transitional endoplasmic reticulum ATPase... 263 3e-69 ( P54812 ) RecName: Full=Transitional endoplasmic...VCP gene... 258 1e-67 (Q7KN62) RecName: Full=Transitional endoplasmic reticulum ATPase... 255 7e-67 AE013599_1006(...AF047037_1( AF047037 |pid:none) Drosophila melanogaster transition... 253 3e-66 AK167794_1( AK167794 |pid:none)

  8. Dicty_cDB: CFJ203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AASTDAPCTSLAVL YKDN--- ---VVMVTAPPRLFSSGVGDALATYFEARQCFQSFGNNLTNTKPSLIGYNLSKLCYKIIS ENIEKAMDSLNCKSNS...AASTDAPCTSLAVL YKDN--- ---VVMVTAPPRLFSSGVGDALATYFEARQCFQSFGNNLTNTKPSLIGYNLSKLCYKIIS ENIEKAMDSLNCKSNS

  9. 5 CFR 353.203 - Length of service.

    Science.gov (United States)

    2010-01-01

    ... date counts under USERRA rules. Thus, if a technician was on a 32 U.S.C. 502(f) AGR tour on October 13... work. When a conflict arises between the Reserve duty and the legitimate needs of the employer, the...

  10. Dicty_cDB: VHI203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s producing significant alignments: (bits) Value AF325215_2( AF325215 |pid:none) Lymphocytic choriomeningitis...5090 |pid:none) Schistosoma japonicum SJCHGC03255 ... 36 2.8 EU480452_2( EU480452 |pid:none) Lymphocytic choriomeningitis...325214_2( AF325214 |pid:none) Lymphocytic choriomeningitis virus... 35 8.2 BX2941

  11. Dicty_cDB: CFC203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available a ... 40 0.17 EF084406_1( EF084406 |pid:none) Picea sitchensis clone WS02712_K12... 39 0.38 ( P56873 ) RecName: Full=Sjoe... days embryo whole ... 37 1.4 ( O60232 ) RecName: Full=Sjoegren syndrome/scleroderma autoantigen... 36 1.9 B

  12. 24 CFR 203.602 - Delinquency notice to mortgagor.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Delinquency notice to mortgagor....602 Delinquency notice to mortgagor. The mortgagee shall give notice to each mortgagor in default on a... the Secretary, no later than the end of the second month of any delinquency in payments under the...

  13. Phenotype-gene: 203 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available in organ named epidermal pavement cell in organ named vascular leaf for AT5G24630 Kirik Viktor et al. 2007 ...d size in organ named epidermal pavement cell in organ named vascular leaf http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u724i AT5G24630

  14. Preface: phys. stat. sol. (a) 203/4

    Science.gov (United States)

    Kittler, Martin; Yang, Deren

    2006-03-01

    This issue of physica status solidi (a) contains the majority of papers presented at the 2nd Sino-German Symposium The Silicon Age which was held at the Lindner Hotel Cottbus, Germany, 19-24 September 2005. This meeting followed the 1st Symposium Progress in Silicon Materials held in June 2002 in Hangzhou, P.R. China. 8 Chinese and 14 German scientists from universities, research institutes and industry were invited to present their views about different aspects of silicon.There was a continuous progress in silicon materials development during the last 40-50 years, driven by the need of the IC industry for better and larger monocrystalline silicon wafers. Moreover, low-cost crystalline silicon now dominates the world's production of solar cells in the photovoltaics industry. Furthermore, there are intensive research activities worldwide for on-chip integration of Si-based photonics in CMOS technology. In addition, new areas being connected with silicon are starting to appear, namely Si-based biochips and nanoelectronics. Silicon, one can reasonably argue, is already the most investigated of all materials. However, there is still a need for continuation of research and development regarding numerous aspects of Si and also SiGe, including related technologies, advanced diagnostics or the role of crystal defects, which are the working fields of many laboratories all over the world. This was also shown by the presentations at the symposium and can be found in the contributions contained in this issue.The organizers would like to thank the participants for their high level contributions and discussions during the symposium. This intensive and open communication allowed the participants to create synergies between the different fields of silicon research and also to build up relationships for cooperation between Chinese and German research groups.Finally, we would like to thank the Sino-German Science Center for the financial support of the symposium.

  15. 47 CFR 25.203 - Choice of sites and frequencies.

    Science.gov (United States)

    2010-10-01

    ... theoretical calculations and/or actual measurements) of any special techniques, such as the use of artificial... Management Coordinator, Department of Commerce, Research Support Services, NOAA R/E5X2, Boulder Laboratories... the theoretical field strength value and existing root-sum-square or other ambient radio field signal...

  16. 1935 15' Quad #203 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  17. 48 CFR 51.203 - Means of obtaining service.

    Science.gov (United States)

    2010-10-01

    ... MANAGEMENT USE OF GOVERNMENT SOURCES BY CONTRACTORS Contractor Use of Interagency Fleet Management System... interagency fleet management system (IFMS) vehicles and related services in writing to the appropriate GSA regional Federal Supply Service Bureau, Attention: Regional fleet manager, except that requests for more...

  18. 24 CFR 984.203 - FSS family selection procedures.

    Science.gov (United States)

    2010-04-01

    ...) Permissible motivational screening factors. Permitted motivational factors include requiring attendance at FSS...) Prohibited motivational screening factors. Prohibited motivational screening factors include the family's... Action Plan. (c) Motivation as a selection factor—(1) General. a PHA may screen families for interest...

  19. 40 CFR 59.203 - Standards for consumer products.

    Science.gov (United States)

    2010-07-01

    ... that the VOC content levels in table 1 of this subpart and HVOC content levels in table 2 of this... concentrated product to deal with limited special applications such as hard-to-remove soils or stains. (c) For... included in the weight-percent VOC calculation. (f) The VOC content limits in table 1 of this subpart shall...

  20. Dicty_cDB: SHL203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C8, complete sequence. 48 0.39 1 DY882957 |DY882957.1 AresSEQ12202 Amorphotheca resina...e pBluescript (EcoRI-XhoI) Amorphotheca resinae cDNA clone AresSEQ12202, mRNA sequence. 46 1.5 1 dna up