WorldWideScience

Sample records for astatine 202

  1. Organic chemistry of astatine

    International Nuclear Information System (INIS)

    The paper surveys the investigations on the chemical behaviour of astatine in organic systems and deals with the preparation and identification of its organic compounds. A discussion is given on some of the physico-chemical properties of these compounds determined by extrapolation techniques as well as by direct measurement. The biomedical importance of 211At-labelled compounds is briefly referred to. (authors)

  2. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  3. Astatine-211: production and availability.

    Science.gov (United States)

    Zalutsky, Michael R; Pruszynski, Marek

    2011-07-01

    The 7.2-h half life radiohalogen (211)At offers many potential advantages for targeted α-particle therapy; however, its use for this purpose is constrained by its limited availability. Astatine-211 can be produced in reasonable yield from natural bismuth targets via the (209)Bi(α,2n)(211)At nuclear reaction utilizing straightforward methods. There is some debate as to the best incident α-particle energy for maximizing 211At production while minimizing production of (210)At, which is problematic because of its 138.4-day half life α-particle emitting daughter, (210)Po. The intrinsic cost for producing (211)At is reasonably modest and comparable to that of commercially available (123)I. The major impediment to (211)At availability is attributed to the need for a medium energy α-particle beam for its production. On the other hand, there are about 30 cyclotrons in the world that have the beam characteristics required for (211)At production. PMID:22201707

  4. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211At species, 211At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  5. Dosimetrical considerations in astatine-211 radioimmunotherapy

    International Nuclear Information System (INIS)

    Several dosimetrical quantities have been suggested for use in alpha-particle dosimetry. To evaluate the expected biological effect when using these quantities, a Monte Carlo program was set to register the single-event distribution of both specific energy and alpha-particle track length to a cell nucleus (r=5.6 μm). Distributions were acquired for both 'bound' (simulating the effect of 211At-labelled antibodies bound to antigens on cell surfaces (r=7.0 μm)) as well as 'non-bound' (simulating 211At-labelled antibodies that have not bound to a cell) astatine-211. From these distributions, various theoretical cell survival curves were established for 3 different dosimetrical quantities, i.e. specific energy, number of alpha-particle hits and total track length. The survival curves for all quantities are presented for the corresponding mean absorbed dose in order to facilitate comparisons of the expected effects of using the 3 different quantities for both distributions of 211At decays. The theoretical survival curves presented here could, combined with experiments using 'bound' and 'non-bound' 211At in a single-cell suspension, reveal which dosimetrical quantity is most suitable for 211 At-radioimmunotherapy. (author)

  6. Discovery of the astatine, radon, francium, and radium isotopes

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  7. Extraction of astatine isotopes for development of radiopharmaceuticals using a 211Rn-211At generator

    International Nuclear Information System (INIS)

    In order to utilize a 211At isotope, a promising α-emitter for radionuclide therapy, the chemical properties of astatine isotopes are studied. We have examined wet chemistry methods through the distribution ratios of astatine in liquid-liquid extraction. The astatine isotopes have been found to be well extracted into DIPE and MIBK. We observed that the distribution ratio of astatine isotopes increases with concentrations of HCl greater than 3 M, while it decreases with the HCl concentration less than 2 M. The results will be useful for development of the 211Rn-211At generator. (author)

  8. Astatine-211-Labeled Targeted Radiotherapeutics: An Update

    International Nuclear Information System (INIS)

    The heavy halogen 211At was first proposed for use in α-particle targeted radiotherapy more than 30 years ago and continues to be one of the most promising radionuclides for this purpose. Although its 7.2-h half life is not ideal for intravenously administered whole antibodies, it is compatible with the pharmacokinetics of antibody fragments, peptides, aptamers and organic molecules. Its diverse chemistry allows its incorporation into a wide array of targeting vehicles, relying on its chemical similarity to iodine to provide a useful point of departure. On the other hand, the relatively low carbon-astatine bond strength is challenging. In common with the other α-emitters being discussed at this symposium, lack of reliable availability is one of the biggest hurdles in the use of 211At for targeted radiotherapy. However, in the case of 211At, it is not a question of production cost or availability of target material, because 211At can be produced in reasonable yield from natural bismuth targets. Rather, the difficulty is the lack of cyclotrons equipped with the medium energy α-particle beams required for its production. If the infrastructure for producing 211At is to be improved to the stage where 211At-labeled radiopharmaceuticals can have a meaningful impact, several developments must occur. First, the ability to produce clinically relevant levels of 211At that can be shipped to remote locations in chemically tractable form must be demonstrated. Approaches under consideration include compensating for radiolysis-mediated effects and the consideration of alternative chemistries. Second, strategies for compensating for heterogeneities in dose deposition must be developed, hopefully in a way that is compatible with approval for human use. And third, it is essential that more clinical trials be performed with 211At-labeled therapeutics, particularly in settings of minimum residual disease where the radiobiological advantages of α-particles can be best exploited. Our

  9. Scrutinizing "Invisible" astatine: A challenge for modern density functionals.

    Science.gov (United States)

    Sergentu, Dumitru-Claudiu; David, Grégoire; Montavon, Gilles; Maurice, Rémi; Galland, Nicolas

    2016-06-01

    The main-group 6p elements did not receive much attention in the development of recent density functionals. In many cases it is still difficult to choose among the modern ones a relevant functional for various applications. Here, we illustrate the case of astatine species (At, Z = 85) and we report the first, and quite complete, benchmark study on several properties concerning such species. Insights on geometries, transition energies and thermodynamic properties of a set of 19 astatine species, for which reference experimental or theoretical data has been reported, are obtained with relativistic (two-component) density functional theory calculations. An extensive set of widely used functionals is employed. The hybrid meta-generalized gradient approximation (meta-GGA) PW6B95 functional is overall the best choice. It is worth noting that the range-separated HSE06 functional as well as the old and very popular B3LYP and PBE0 hybrid-GGAs appear to perform quite well too. Moreover, we found that astatine chemistry in solution can accurately be predicted using implicit solvent models, provided that specific parameters are used to build At cavities. © 2016 Wiley Periodicals, Inc. PMID:27059181

  10. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  11. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates.

    Science.gov (United States)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Svedhem, Sofia; Lindegren, Sture

    2016-03-16

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single cancer cells. A promising radioactive nuclide for this type of therapy is astatine-211. Astatine-211 attached to tumor-specific antibodies as carrier molecules is a system currently under investigation for use in targeted alpha therapy. In the common radiolabeling procedure, astatine is coupled to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies. PMID:26791409

  12. Astatine-211: production, injection into monoclonal antibodies radiological effect, possible application to cancer treatment

    International Nuclear Information System (INIS)

    Methods developed in the Laboratory of Nuclear Problems, JINR, for producing astatine-211 and injecting it into monoclonal antibodies are described. The use of its diethylene triamine penta-acetic acid complex is shown to be the most effective method of injecting astatine into a biomolecules. The biological effect of the α-particles emitted from the astatine-211 is investigated using Chinese hamster fibroblasts and Ehrlich carcinoma cells. It is established that the mitotic activity depression, number of degenerating cells, number of cells with chromosome aberrations, and cellular surviving fraction depend on the concentration of the radionuclide in the medium 'in vitro'. The RBE of α-particles in comparison with 60Co γ-rays is 3. Injection of astatine-211 absorbed on tellurium particles into mice with ascitic tumors resulted in prolongation of their life or elimination of the tumors. (author). 39 refs, 7 figs

  13. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    OpenAIRE

    Rothe, S.; A. N. Andreyev; Antalic, S; Borschevsky, A.; Capponi, L.; Cocolios, T.E.; Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the io...

  14. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    Science.gov (United States)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-07-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and physical properties for use in targeted therapies for cancer. Due to the very short range of the emitted α-particles, this therapy is particularly suited to treating occult, disseminated cancers. Astatine is not intrinsically tumour-specific; therefore, it requires an appropriate tumour-specific targeting vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method that combines dry distillation of astatine-211 and a synthesis module for producing radiopharmaceuticals into a process platform. This platform will standardize production of astatinated radiopharmaceuticals, and hence, it will facilitate large clinical studies focused on this promising, but chemically challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies.

  15. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-01-01

    vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method......To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  16. Study of Astatine (III) reactions with O, S and N ligands in solution

    International Nuclear Information System (INIS)

    Full text of publication follows. Astatine (At, Z=85: [Xe]4f145d106s26p5) belongs to the halogen group and is located below iodine in the periodic table. One of its isotopes (211At) appears promising as a therapeutic agent in nuclear medicine (Ref.1) owing to the energy of the alpha particles emitted during the disintegration of its nucleus and its short physical half-life (7.2 h). Since there are no stable isotopes of astatine, the chemistry of this element remains poorly understood. Generally, At is supposed to behave as a halogen (Ref.2) but it has been shown recently in our group that astatine presents a metallic behaviour in aqueous solution: it notably exists as At+ and AtO+ species under the oxidation states +I and +III (Ref.3). At the present time, the number of studies dealing with the complexation properties of the cationic forms of astatine remains limited (Ref.4), owing to its low availability. In this work, we have investigated the reactions of AtO+ species with different hetero-atomic (N, S, O) model ligands. A combined approach based on experimental and theoretical studies has been used (Ref.5). On account of the difficulties of experimental investigations of astatine species, the reactivity of AtO+ was explored using a competition method founded on astatine distributions between two distinct phases. Furthermore, for each AtO+/ ligand complex, the nature of the species formed and the associated thermodynamic constants were determined by computational modeling (DFT calculations). In this framework, an original computational methodology was developed to take into account the specificities of astatine, notably the associated relativistic effects. The computed equilibrium constants have been confronted with the experimental results. This comparison demonstrates an outstanding coherence between experience and theory. Furthermore, the analysis of the results shows a key role of solvent effects on astatine chemistry. Lastly, a specific reactivity for the

  17. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments (209At, 210At, 211At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  18. Astatine-211 Pathway from Radiochemistry to Clinical Investigation

    International Nuclear Information System (INIS)

    Particularly in clinical settings where tumour burden is low and cancers are located in close proximity to essential normal tissue structures, α-particle emitting radionuclides can offer significant advantages for targeted radionuclide therapy. One of the first alpha emitters to be evaluated for this purpose is the 7.2-h half-life radiohalogen Astatine-211 (211At). From a commercialization-potential perspective 211At, is less appealing than the longer half-life alpha particle emitters Radium-223, Actinium-225 and Thorium-227, which have become the focus of many laboratories. However, if methods for providing a better supply of 211At could be developed, this alpha emitter would be the radionuclide of choice for many potential therapeutic applications. With regard to the production of 211At, this can be readily be accomplished by bombarding natural bismuth targets with 28−29.5 MeV alpha particles via the 209Bi(α,2n)211At reaction. The goal is to utilize an alpha particle beam energy that provides the required balance for maximizing 211At production while minimizing creation of 210At, which is problematic because of its 138.4-day half life alpha-particle emitting daughter, 210Po. For most intended clinical applications, alpha particle beam energy of about 29 MeV offers the best compromise between maximizing yield and providing 211At with sufficient radionuclidic purity for clinical use. Clinically relevant levels of 211At have been produced at several institutions using both internal and external cyclotron targets

  19. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  20. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  1. Main: PPD202 [AT Atlas

    Lifescience Database Archive (English)

    Full Text Available PPD202 PPD2 Overexpression of membrane protein by high-density culture that uses Es...aduate School of Pharmaceutical Sciences, Kyoto University J. Mol. Biol. (1996) 8757792 PPD202.csml ...

  2. Labelling prospects of astatine-211 with immunoglobulins (IgG): some general considerations

    International Nuclear Information System (INIS)

    The tumour therapeutic potential of the short lived alpha emitting radiohalogen 211At has been already been well recognised in the field of radioimmuno therapy. There is no evidence as such to show that astatine itself is a tumour seeking isotope. Therefore it has to be tagged to tumour seeking compound such as a drug or a protein preferably an antibody (IgG). In this communication, the labelling parameters which are required to be investigated for obtaining a stable product which could be useful as radioimmuno therapeutic agent, are described. (author). 6 refs

  3. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron anity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photodetachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral linewidth of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in o-line tests by the clear observation of the photodetachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148 [1].

  4. Extraction of 211At-astatine from hydrochloric acid solutions by means of TOPO, TBP, and triphenylphosphine

    International Nuclear Information System (INIS)

    The extraction behaviour of astatine was studied under defined conditions from hydrochloride acid solutions (cHCl>0.1 M or 1 and 2M). Therefore other effects like adsorption, reduction or hydrolysis can be excluded. The present work describes the extraction with tri- n- octylphosphinoxide (TOPO), tri- n-butylphosphate (TBP) and tri-phenylphosphine in chloroform. (orig.)

  5. No-carrier-added astatination of N-succinimidyl-3-(tri-n-butylstannyl) benzoate (ATE) via electrophilic destannylation

    International Nuclear Information System (INIS)

    The no-carrier-added synthesis of N-succinimidyl 3-[211At]astato-benzoate from N-succinimidyl 3-(tri-n-butylstannyl)benzoate (ATE) is described. The nature of the solvent in which the 211At was isolated from the target was an important factor influencing both the radiochemical yields and the nature of the incorporated astatine activity. (orig.)

  6. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    211At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At- to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At- anions, but first of all because of the kinetic inertness of low spin rhodium(III) d6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh3+. The experiments related to optimization of the reaction conditions were performed with the 131I, basing on a chemical similarity of I- to At-. The experiments with 211At were then carried out under the conditions found optimal for I-. The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211At-Rh(16-S4-diol) complex

  7. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  8. Unexpected Behavior of the Heaviest Halogen Astatine in the Nucleophilic Substitution of Aryliodonium Salts.

    Science.gov (United States)

    Guérard, François; Lee, Yong-Sok; Baidoo, Kwamena; Gestin, Jean-François; Brechbiel, Martin W

    2016-08-22

    Aryliodonium salts have become precursors of choice for the synthesis of (18) F-labeled tracers for nuclear imaging. However, little is known on the reactivity of these compounds with heavy halides, that is, radioiodide and astatide, at the radiotracer scale. In the first comparative study of radiohalogenation of aryliodonium salts with (125) I(-) and (211) At(-) , initial experiments on a model compound highlight the higher reactivity of astatide compared to iodide, which could not be anticipated from the trends previously observed within the halogen series. Kinetic studies indicate a significant difference in activation energy (Ea =23.5 and 17.1 kcal mol(-1) with (125) I(-) and (211) At(-) , respectively). Quantum chemical calculations suggest that astatination occurs via the monomeric form of an iodonium complex whereas iodination occurs via a heterodimeric iodonium intermediate. The good to excellent regioselectivity of halogenation and high yields achieved with diversely substituted aryliodonium salts indicate that this class of compounds is a promising alternative to the stannane chemistry currently used for heavy radiohalogen labeling of tracers in nuclear medicine. PMID:27305065

  9. 45 CFR 170.202 - [Reserved

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false 170.202 Section 170.202 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH INFORMATION TECHNOLOGY HEALTH INFORMATION TECHNOLOGY STANDARDS... TECHNOLOGY Standards and Implementation Specifications for Health Information Technology § 170.202...

  10. 7 CFR 20.2 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Administration. 20.2 Section 20.2 Agriculture Office of the Secretary of Agriculture EXPORT SALES REPORTING REQUIREMENTS § 20.2 Administration. The regulations of this part will be administered by the Foreign Agricultural Service (FAS) under the...

  11. 30 CFR 202.352 - Minimum royalty.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Minimum royalty. 202.352 Section 202.352 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT ROYALTIES Geothermal Resources § 202.352 Minimum royalty. In no event shall the lessee's annual...

  12. 40 CFR 240.202-1 - Requirement.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirement. 240.202-1 Section 240.202-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE THERMAL PROCESSING OF SOLID WASTES Requirements and Recommended Procedures § 240.202-1...

  13. 48 CFR 9903.202 - Disclosure requirements.

    Science.gov (United States)

    2010-10-01

    ... ACCOUNTING STANDARDS CONTRACT COVERAGE CAS Program Requirements 9903.202 Disclosure requirements. ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Disclosure requirements. 9903.202 Section 9903.202 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS...

  14. 42 CFR 418.202 - Covered services.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Covered services. 418.202 Section 418.202 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICARE PROGRAM HOSPICE CARE Covered Services § 418.202 Covered services. All services must be...

  15. 24 CFR 585.202 - Award limits.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Award limits. 585.202 Section 585.202 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued... DEVELOPMENT COMMUNITY FACILITIES YOUTHBUILD PROGRAM Youthbuild Planning Grants § 585.202 Award limits....

  16. 40 CFR 211.202 - Effective date.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Effective date. 211.202 Section 211.202 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS PRODUCT NOISE LABELING Hearing Protective Devices § 211.202 Effective date. Manufacturers of...

  17. 20 CFR 202.4 - Control.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Control. 202.4 Section 202.4 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT EMPLOYERS UNDER THE ACT § 202.4 Control. A company or person is controlled by one or more carriers, whenever there exists in...

  18. 40 CFR 61.202 - Standard.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Standard. 61.202 Section 61.202... EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS National Emission Standards for Radon Emissions From Phosphogypsum Stacks § 61.202 Standard. Each person who generates phosphogypsum shall place all phosphogypsum...

  19. 49 CFR 384.202 - Test standards.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Test standards. 384.202 Section 384.202... COMMERCIAL DRIVER'S LICENSE PROGRAM Minimum Standards for Substantial Compliance by States § 384.202 Test standards. No State shall authorize a person to operate a CMV unless such person passes a knowledge...

  20. 20 CFR 202.13 - Electric railways.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Electric railways. 202.13 Section 202.13 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT EMPLOYERS UNDER THE ACT § 202.13 Electric railways. (a) The Deputy General Counsel will require the submission...

  1. 5 CFR 715.202 - Resignation.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Resignation. 715.202 Section 715.202...) NONDISCIPLINARY SEPARATIONS, DEMOTIONS, AND FURLOUGHS Voluntary Separations § 715.202 Resignation. (a) General. An employee is free to resign at any time, to set the effective date of his resignation, and to have...

  2. 19 CFR 202.6 - Reports.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Reports. 202.6 Section 202.6 Customs Duties UNITED... PRODUCTION § 202.6 Reports. After the completion of its investigation, the Commission will incorporate its findings in a report, and the report will be transmitted to the President....

  3. 23 CFR 500.202 - TMS definitions.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false TMS definitions. 500.202 Section 500.202 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION TRANSPORTATION INFRASTRUCTURE MANAGEMENT MANAGEMENT AND MONITORING SYSTEMS Traffic Monitoring System § 500.202 TMS definitions. Unless...

  4. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  5. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  6. Dicty_cDB: SSB202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSB202 (Link to dictyBase) - - - Contig-U10253-1 SSB202E (Link... to Original site) - - - - - - SSB202E 465 Show SSB202 Library SS (Link to library) Clone ID SSB202 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSB2-A/SSB202Q.Seq.d/ Representative seq. ID SSB20...2E (Link to Original site) Representative DNA sequence >SSB202 (SSB202Q) /CSM/SS/SSB2-A/SSB202Q.Seq.d/ CATAA...98. 5. 2 Translated Amino Acid sequence *iyni*YINKMSSEDGIKKLLDAERTAQKIVADARQDRVQKLKKAVEEAEKEIKEFREKK DKEYKEXESKYLGASS

  7. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  8. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  9. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  10. 48 CFR 2024.202 - Policy.

    Science.gov (United States)

    2010-10-01

    ... PROTECTION OF PRIVACY AND FREEDOM OF INFORMATION Freedom of Information Act 2024.202 Policy. The provisions at 10 CFR part 9, subpart A, Freedom of Information Act Regulations, are applicable to the... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Policy. 2024.202...

  11. 48 CFR 2824.202 - Policy.

    Science.gov (United States)

    2010-10-01

    ... OF PRIVACY AND FREEDOM OF INFORMATION Freedom of Information Act 2824.202 Policy. Procedures for processing Freedom of Information Act requests are set forth in Departmental regulations and 28 CFR part 16. ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Policy. 2824.202...

  12. 23 CFR 620.202 - Applicability.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Applicability. 620.202 Section 620.202 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS ENGINEERING... governed by the requirements of 23 CFR part 710....

  13. 48 CFR 47.202 - Presolicitation planning.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Presolicitation planning. 47.202 Section 47.202 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT... Presolicitation planning. Contracting officers shall inform activities that plan to acquire transportation...

  14. 5 CFR 179.202 - Scope.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Scope. 179.202 Section 179.202 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS... implementing the Federal Claims Collection Act (31 U.S.C. 3711 et seq., 4 CFR parts 101-105, 38 CFR 1.900...

  15. 41 CFR 101-29.202 - Standard.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Standard. 101-29.202...-Definitions § 101-29.202 Standard. A standard is a document that establishes engineering and technical.... Standards may also establish requirements for selection, application, and design criteria so as to...

  16. 42 CFR 414.202 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Definitions. 414.202 Section 414.202 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICARE PROGRAM PAYMENT FOR PART B MEDICAL AND OTHER HEALTH SERVICES Payment for Durable Medical Equipment...

  17. 40 CFR 6.202 - Interagency cooperation.

    Science.gov (United States)

    2010-07-01

    ... EPA's NEPA Environmental Review Procedures § 6.202 Interagency cooperation. (a) Consistent with 40 CFR... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Interagency cooperation. 6.202 Section... cooperation with federal agencies, state and local governments, and federally-recognized Indian tribes...

  18. 48 CFR 22.202 - Contract clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Contract clause. 22.202 Section 22.202 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SOCIOECONOMIC... employment of convict labor; (b) The supplies or services are to be purchased from Federal Prison...

  19. 7 CFR 25.202 - Strategic plan.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Strategic plan. 25.202 Section 25.202 Agriculture Office of the Secretary of Agriculture RURAL EMPOWERMENT ZONES AND ENTERPRISE COMMUNITIES Nomination... should also set goals and performance benchmarks for measuring progress and establish a framework...

  20. 48 CFR 30.202-6 - Responsibilities.

    Science.gov (United States)

    2010-10-01

    ... Statements are submitted. (Also see 48 CFR 9903.201-3 and 9903.202 (FAR appendix).) (b) The contracting... obtaining submission of the required Disclosure Statement (see 48 CFR 9903.202-2). In this event, the... as soon as possible after the award. (c) The cognizant auditor is responsible for conducting...

  1. 48 CFR 5.202 - Exceptions.

    Science.gov (United States)

    2010-10-01

    ... electronically; or (14) The proposed contract action is made under conditions described in 6.302-3 with respect... § 5.202, see the List of CFR Sections Affected, which appears in the Finding Aids section of the... PUBLICIZING CONTRACT ACTIONS Synopses of Proposed Contract Actions 5.202 Exceptions. The contracting...

  2. 40 CFR 600.202-77 - Definitions.

    Science.gov (United States)

    2010-07-01

    ....202-77 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-Procedures for Calculating Fuel Economy Values § 600.202-77 Definitions....

  3. 48 CFR 32.202-1 - Policy.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Policy. 32.202-1 Section 32.202-1 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING... liquidation provisions when required by 32.206(e). (c) Difference from non-commercial financing....

  4. 37 CFR 202.17 - Renewals

    Science.gov (United States)

    2010-07-01

    ... CFR 202.20 and 202.21, the Copyright Office, at its discretion, may, upon receipt of an acceptable... existed in its original term of copyright was in compliance with the 1909 copyright law, 17 U.S.C. 1, et... regulations found at 37 CFR 201.2. (g) Application for renewal registration for a work registered in...

  5. 5 CFR 850.202 - Survivor elections.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Survivor elections. 850.202 Section 850... (CONTINUED) RETIREMENT SYSTEMS MODERNIZATION Applications for Benefits; Elections § 850.202 Survivor elections. (a) A survivor election under subsection (j) or (k) of section 8339, or under section 8416,...

  6. 48 CFR 45.202 - Evaluation procedures.

    Science.gov (United States)

    2010-10-01

    ... offeror's property management plans, methods, practices, or procedures for accounting for property are... MANAGEMENT GOVERNMENT PROPERTY Solicitation and Evaluation Procedures 45.202 Evaluation procedures. (a) The contracting officer shall consider any potentially unfair competitive advantage that may result from...

  7. 30 CFR 20.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... MINING PRODUCTS ELECTRIC MINE LAMPS OTHER THAN STANDARD CAP LAMPS § 20.2 Definitions. (a) Adequate.... Official notification in writing from MSHA to a responsible organization, stating that upon...

  8. 42 CFR 447.202 - Audits.

    Science.gov (United States)

    2010-10-01

    ... ASSISTANCE PROGRAMS PAYMENTS FOR SERVICES Payment Methods: General Provisions § 447.202 Audits. The Medicaid agency must assure appropriate audit of records if payment is based on costs of services or on a fee...

  9. 40 CFR 246.202-1 - Requirement.

    Science.gov (United States)

    2010-07-01

    ...-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES SOURCE SEPARATION FOR MATERIALS RECOVERY GUIDELINES Requirements and Recommended Procedures § 246.202-1 Requirement. Any commercial establishment generating 10 or more tons of waste corrugated containers per month...

  10. 48 CFR 16.202-2 - Application.

    Science.gov (United States)

    2010-10-01

    ... AND CONTRACT TYPES TYPES OF CONTRACTS Fixed-Price Contracts 16.202-2 Application. A firm-fixed-price contract is suitable for acquiring commercial items (see parts 2 and 12) or for acquiring other supplies...

  11. Stability and in vivo behavior of Rh[16aneS4-diol]211At complex: A potential precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Introduction: The heavy halogen 211At is of great interest for targeted radiotherapy because it decays by the emission of short-range, high-energy α-particles. However, many astatine compounds that have been synthesized are unstable in vivo, providing motivation for seeking other 211At labeling strategies. One relatively unexplored approach is to utilize prosthetic groups based on astatinated rhodium (III) complex stabilized with a tetrathioether macrocyclic ligand – Rh[16aneS4-diol]211At. The purpose of the current study was to evaluate the in vitro and in vivo stability of this complex in comparison to its iodine analog – Rh[16aneS4-diol]131I. Methods: Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I complexes were synthesized and purified by HPLC. The stability of both complexes was evaluated in vitro by incubation in phosphate-buffered saline (PBS) and human serum at different temperatures. The in vivo behavior of the two radiohalogenated complexes was assessed by a paired-label biodistribution study in normal Balb/c mice. Results: Both complexes were synthesized in high yield and purity. Almost no degradation was observed for Rh[16aneS4-diol]131I in PBS over a 72 h incubation. The astatinated analog exhibited good stability in PBS over 14 h. A slow decline in the percentage of intact complex was observed for both tracers in human serum. In the biodistribution study, retention of 211At in most tissues was higher than that of 131I at all time points, especially in spleen and lungs. Renal clearance of Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I predominated, with 84.1 ± 2.3% and 94.6 ± 0.9% of injected dose excreted via the urine at 4 h. Conclusions: The Rh[16aneS4-diol]211At complex might be useful for constructing prosthetic groups for the astatination of biomolecules and further studies are planned to evaluate this possibility

  12. Dicty_cDB: SSG202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iyyyfiiip*isvlifffnnslrikrsgtslkk *fsasisy*rym*ss*fslkfgkl*tkeepm*ppipankqianvligliglvfaillpik apaippvkpalhincfgvtvypyrl*THFILSS...SS (Link to library) SSG202 (Link to dictyBase) - G01217 DDB0189352 Contig-U10594-1 | Contig-U15572-1 SS...G202P (Link to Original site) SSG202F 592 SSG202Z 223 SSG202P 815 - - Show SSG202 Library SS... (Link to library) Clone ID SSG202 (Link to dictyBase) Atlas ID - NBRP ID G01217 dictyBase ID DDB018935...cdb.biol.tsukuba.ac.jp/CSM/SS/SSG2-A/SSG202Q.Seq.d/ Representative seq. ID SSG202P (Link to Original site) R

  13. Measurements of 202Tl in vivo

    International Nuclear Information System (INIS)

    In this paper measurements in vivo of the 440-keV γ-ray emitted by 202Tl (physical half-life 12.2 days) are reported. This isotope is a contaminant commonly present at a level of about 1% in cyclotron-produced 201Tl (physical half-life 3.0 days), which is injected as thallous chloride for nuclear cardiology studies. The observed effective half-life of thallium-202 falls within the range reported by other workers in a study of 201Tl retention by four patients over a period of two weeks. The important aspect of our data is that no additional component in the retention curve was observed for a period five times longer. The distribution of 202Tl in the body was determined by making profile scans with a slit-collimated detector. In general, 202Tl was observed in skeletal muscle and the viscera. No changes in the distribution were noted between scans made on days 3 and 21 post-injection. The excretion rate of 201Tl and the ratio of 202Tl to 201Tl were determined by analyzing 24-hour urine and fecal samples for γ-ray activity with a Ge(Li) detector in a standardized geometry. On day 15 post-injection, the urinary excretion was 1.5% of the body content, while the fecal excretion was 3.9%. The total, 5.4%, was in excellent agreement with the excretion rate of 5.6%/day predicted by the whole-body retention curve obtained for 202Tl.However, previous workers had assumed that fecal excretion is negligible. Our findings refute this assumption and imply that the radiation dose from 201Th received by the intestinal tract may be underestimated, and the dose to the bladder over-estimated, even though the whole-body dose may not be affected

  14. 31 CFR 202.6 - Collateral security.

    Science.gov (United States)

    2010-07-01

    ... collateral security are addressed in 31 CFR part 380. For a current list of acceptable classes of securities and instruments described in 31 CFR part 380 and their valuations, see the Bureau of the Public Debt's... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Collateral security. 202.6...

  15. 19 CFR 351.202 - Petition requirements.

    Science.gov (United States)

    2010-04-01

    ... to the Commission's regulations concerning the contents of petitions, currently 19 CFR 207.11. (b... DUTIES Antidumping and Countervailing Duty Procedures § 351.202 Petition requirements. (a) Introduction... merchandise is from a country that the Secretary has found to be a nonmarket economy country,...

  16. 45 CFR 46.202 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... means a neonate after delivery that, although living, is not viable. (f) Pregnancy encompasses the period of time from implantation until delivery. A woman shall be assumed to be pregnant if she exhibits... Protections for Pregnant Women, Human Fetuses and Neonates Involved in Research § 46.202 Definitions....

  17. 7 CFR 760.202 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... that are consumed by humans, or ornamental fish propagated and reared in an aquatic medium by a... Fish Program § 760.202 Definitions. The following definitions apply to this subpart and to the... assistance for livestock or emergency loss assistance for farm-raised fish or honeybees. Aquatic...

  18. 48 CFR 825.202 - Exceptions.

    Science.gov (United States)

    2010-10-01

    ... PROGRAMS FOREIGN ACQUISITION Buy American Act-Construction Materials 825.202 Exceptions. (a) When a... documentation, to the Director, Office of Construction and Facilities Management, through the DSPE. (3) If the... Civilian Agency Acquisition Council (CAAC) for possible addition to the list of non-available articles...

  19. 5 CFR 720.202 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... been determined. It includes both innovative internal and external recruitment actions. It is also...) AFFIRMATIVE EMPLOYMENT PROGRAMS Federal Equal Opportunity Recruitment Program § 720.202 Definitions. For the... any other reliable statistical study. (e) Recruitment means the total process by which the...

  20. 5 CFR 842.202 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... EMPLOYEES RETIREMENT SYSTEM-BASIC ANNUITY Eligibility § 842.202 Definitions. In this subpart— Commuting area has the same meaning given that term in § 351.203 of this chapter. Minimum retirement age means an age based on an individual's year of birth, as follows: Year of Birth Minimum Retirement Age Before 1948...

  1. Tank 241-C-202: Tank characterization plan

    Energy Technology Data Exchange (ETDEWEB)

    Schreiber, R.D.

    1995-03-06

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, and WHC 222-S Laboratory. Scope of this plan is to provide guidance for sampling and analysis of samples for tank 241-C-202.

  2. Tank 241-U-202 tank characterization plan

    Energy Technology Data Exchange (ETDEWEB)

    Schreiber, R.D.

    1995-02-21

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, and WHC 222-S Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples for tank 241-U-202.

  3. 37 CFR 202.12 - Restored copyrights.

    Science.gov (United States)

    2010-07-01

    ... seek an alternative deposit under special relief (37 CFR 202.20(d)). In such a case, the applicant... payable in United States dollars, and must be imprinted with American Banking Association routing numbers... restored work. In descending order of preference, the deposit should be: (A) The work as first...

  4. 42 CFR 59.202 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR FAMILY PLANNING SERVICES Grants for Family Planning Service Training § 59.202 Definitions. As used in this subpart: (a) Act means... development, the purpose of which is to promote and improve the delivery of family planning services....

  5. 41 CFR 109-50.202 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... DISPOSAL AUTHORITIES 50.2-Math and Science Equipment Gift Program § 109-50.202 Definitions. As used in this... Centers, and Project Offices staffed by Federal employees. Education-related and Federal research... 74 (See 41 CFR 101-43.4801(d)), and other related equipment, which is deemed appropriate for use...

  6. 48 CFR 50.202 - Authorities.

    Science.gov (United States)

    2010-10-01

    ... EXTRAORDINARY CONTRACTUAL ACTIONS AND THE SAFETY ACT Support Anti-terrorism by Fostering Effective Technologies Act of 2002 50.202 Authorities. The following authorities apply: (a) Support Anti-terrorism by Fostering Effective Technologies Act of 2002 (SAFETY Act), 6 U.S.C. 441-444. (b) Executive Order 13286...

  7. 17 CFR 202.8 - Small entity compliance guides.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Small entity compliance guides. 202.8 Section 202.8 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION INFORMAL AND OTHER PROCEDURES § 202.8 Small entity compliance guides. The following small entity compliance guides are available to the public from...

  8. 41 CFR 109-38.202-50 - Security.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Security. 109-38.202-50 Section 109-38.202-50 Public Contracts and Property Management Federal Property Management Regulations....202-50 Security. Unissued license tags shall be stored in a locked drawer, cabinet, or storage...

  9. 40 CFR 246.202-5 - Recommended procedures: Transportation.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended procedures: Transportation. 246.202-5 Section 246.202-5 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... § 246.202-5 Recommended procedures: Transportation. Transportation to market may be supplied by...

  10. 40 CFR 246.202-3 - Recommended procedures: Market study.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended procedures: Market study. 246.202-3 Section 246.202-3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... § 246.202-3 Recommended procedures: Market study. An investigation of markets should be made by...

  11. 9 CFR 202.3 - Institution of proceedings.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Institution of proceedings. 202.3 Section 202.3 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS... PACKERS AND STOCKYARDS ACT Rules of Practice Applicable to Rate Proceedings § 202.3 Institution...

  12. 7 CFR 202.3 - Institution of proceedings.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Institution of proceedings. 202.3 Section 202.3... RULES OF PRACTICE General § 202.3 Institution of proceedings. Any person having information of any... application requesting the institution of such proceedings as may be authorized under the Act....

  13. 48 CFR 1.202 - Agency compliance with the FAR.

    Science.gov (United States)

    2010-10-01

    ... FAR. 1.202 Section 1.202 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL FEDERAL ACQUISITION REGULATIONS SYSTEM Administration 1.202 Agency compliance with the FAR. Agency compliance with the FAR (see 1.304) is the responsibility of the Secretary of Defense (for the...

  14. 48 CFR 14.202-8 - Electronic bids.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Electronic bids. 14.202-8 Section 14.202-8 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 14.202-8 Electronic bids. In accordance with subpart 4.5, contracting officers...

  15. 48 CFR 9903.202-6 - Adequacy of Disclosure Statement.

    Science.gov (United States)

    2010-10-01

    ... COST ACCOUNTING STANDARDS CONTRACT COVERAGE CAS Program Requirements 9903.202-6 Adequacy of Disclosure... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Adequacy of Disclosure Statement. 9903.202-6 Section 9903.202-6 Federal Acquisition Regulations System COST ACCOUNTING...

  16. 48 CFR 9903.202-5 - Filing Disclosure Statements.

    Science.gov (United States)

    2010-10-01

    ... COST ACCOUNTING STANDARDS CONTRACT COVERAGE CAS Program Requirements 9903.202-5 Filing Disclosure... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Filing Disclosure Statements. 9903.202-5 Section 9903.202-5 Federal Acquisition Regulations System COST ACCOUNTING...

  17. 48 CFR 9903.202-8 - Subcontractor Disclosure Statements.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Subcontractor Disclosure Statements. 9903.202-8 Section 9903.202-8 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS... COST ACCOUNTING STANDARDS CONTRACT COVERAGE CAS Program Requirements 9903.202-8...

  18. 27 CFR 31.202 - Possession of refilled liquor bottles.

    Science.gov (United States)

    2010-04-01

    ... liquor bottles. 31.202 Section 31.202 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS ALCOHOL BEVERAGE DEALERS Reuse and Possession of Used Liquor Bottles § 31.202 Possession of refilled liquor bottles. No person who sells, or offers for...

  19. 5 CFR 582.202 - Service of legal process.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Service of legal process. 582.202 Section 582.202 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS COMMERCIAL GARNISHMENT OF FEDERAL EMPLOYEES' PAY Service of Legal Process § 582.202 Service of legal process. (a)...

  20. 20 CFR 202.15 - Railway labor organizations.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Railway labor organizations. 202.15 Section 202.15 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT EMPLOYERS UNDER THE ACT § 202.15 Railway labor organizations. Railway labor organizations, national in...

  1. 46 CFR 177.202 - Plans and information required.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Plans and information required. 177.202 Section 177.202... TONS) CONSTRUCTION AND ARRANGEMENT Plans § 177.202 Plans and information required. (a) Except as provided in paragraph (c) of this section and § 177.210 of this part, the owner of a vessel...

  2. 5 CFR 362.202 - Announcement, nomination, and selection.

    Science.gov (United States)

    2010-01-01

    ... for, as well as a clear interest in and commitment to, leadership in the analysis and management of.... 362.202 Section 362.202 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PRESIDENTIAL MANAGEMENT FELLOWS PROGRAM Program Administration § 362.202 Announcement,...

  3. 36 CFR 905.735-202 - Gifts, entertainment, and favors.

    Science.gov (United States)

    2010-07-01

    ..., entertainment, and favors. Pursuant to paragraph (b) of 5 CFR 735.202, the following exceptions to the... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Gifts, entertainment, and favors. 905.735-202 Section 905.735-202 Parks, Forests, and Public Property PENNSYLVANIA...

  4. 7 CFR 1260.202 - Books and records.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and records. 1260.202 Section 1260.202 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... Promotion and Research Order Reports, Books and Records § 1260.202 Books and records. Each person subject...

  5. 4 CFR 202.2 - Authority to affix seal.

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false Authority to affix seal. 202.2 Section 202.2 Accounts RECOVERY ACCOUNTABILITY AND TRANSPARENCY BOARD OFFICIAL SEAL § 202.2 Authority to affix seal. (a) The following officials of the Board are authorized to affix the official seal (including reproductions)...

  6. 4 CFR 202.3 - Prohibitions against misuse of seal.

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false Prohibitions against misuse of seal. 202.3 Section 202.3 Accounts RECOVERY ACCOUNTABILITY AND TRANSPARENCY BOARD OFFICIAL SEAL § 202.3 Prohibitions against misuse of seal. (a) Falsely making, forging, counterfeiting, mutilating, or altering the Board seal...

  7. 48 CFR 232.202-4 - Security for Government financing.

    Science.gov (United States)

    2010-10-01

    ... financing. 232.202-4 Section 232.202-4 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Commercial Item Purchase Financing 232.202-4 Security for Government financing. (a)(2) When determining whether an...

  8. 48 CFR 432.202-4 - Security for Government financing.

    Science.gov (United States)

    2010-10-01

    ... financing. 432.202-4 Section 432.202-4 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Commercial Item Purchase Financing 432.202-4 Security for Government financing. Prior to determining that an offeror's financial condition is...

  9. 48 CFR 32.202-4 - Security for Government financing.

    Science.gov (United States)

    2010-10-01

    ... financing. 32.202-4 Section 32.202-4 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Commercial Item Purchase Financing 32.202-4 Security for Government financing. (a) Policy. (1) 10 U.S.C. 2307(f) and 41 U.S.C. 255(f) require...

  10. 50 CFR 223.202 - Steller sea lion.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Steller sea lion. 223.202 Section 223.202... Threatened Marine and Anadromous Species § 223.202 Steller sea lion. (a) General prohibitions. The... the eastern population of Steller sea lions: (1) No discharge of firearms. Except as provided...

  11. 5 CFR 870.202 - Basic insurance amount (BIA).

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Basic insurance amount (BIA). 870.202 Section 870.202 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL EMPLOYEES' GROUP LIFE INSURANCE PROGRAM Types and Amount of Insurance § 870.202 Basic insurance amount (BIA). (a)(1)...

  12. 48 CFR 214.202-5 - Descriptive literature.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Descriptive literature. 214.202-5 Section 214.202-5 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... 214.202-5 Descriptive literature. (c) Requirements of invitation for bids. When brand name or...

  13. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D., Scott

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  14. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    International Nuclear Information System (INIS)

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET α-emitter astatine-211 (211At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 (123I), 340-fold for technetium-99m pertechnetate (99mTcO4-) and 60-fold for 211At. Cellular 211At accumulation was found to be dependent on extracellular Na+ ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and 99mTcO4- uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated 211At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and 211At were rapidly (apparent t1/2 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times (123I), 25 times (99mTcO4-) and 10 times (211At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of 123I and 211At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for 123I, 5.2 h for 211At) and preliminary dosimetric calculations indicate high tumour absorbed doses (3.5 Gy/MBqtumour for 131I and 50.3 Gy/MBqtumour for 211At). In

  15. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    Energy Technology Data Exchange (ETDEWEB)

    Petrich, T.; Helmeke, H.-J.; Meyer, G.J.; Knapp, W.H.; Poetter, E. [Department of Nuclear Medicine, Medizinische Hochschule Hannover (Germany)

    2002-07-01

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET {alpha}-emitter astatine-211 ({sup 211}At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 ({sup 123}I), 340-fold for technetium-99m pertechnetate ({sup 99m}TcO{sub 4}{sup -}) and 60-fold for {sup 211}At. Cellular {sup 211}At accumulation was found to be dependent on extracellular Na{sup +} ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and {sup 99m}TcO{sub 4}{sup -} uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated {sup 211}At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and {sup 211}At were rapidly (apparent t{sub 1/2} 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times ({sup 123}I), 25 times ({sup 99m}TcO{sub 4}{sup -}) and 10 times ({sup 211}At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of {sup 123}I and {sup 211}At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for {sup 123}I, 5.2 h for {sup 211}At) and

  16. 48 CFR 14.202-1 - Bidding time.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Bidding time. 14.202-1... AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 14.202-1 Bidding time. (a) Policy. A reasonable time for prospective bidders to prepare and submit bids shall be allowed in all invitations,...

  17. 20 CFR 345.202 - Consolidated employer records.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Consolidated employer records. 345.202... INSURANCE ACT EMPLOYERS' CONTRIBUTIONS AND CONTRIBUTION REPORTS Individual Employer Records § 345.202 Consolidated employer records. (a) Establishing a consolidated employer record. Two or more employers that...

  18. 20 CFR 202.11 - Termination of employer status.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Termination of employer status. 202.11... EMPLOYERS UNDER THE ACT § 202.11 Termination of employer status. The employer status of any company or... existence of an employer status....

  19. 5 CFR 250.202 - Office of Personnel Management responsibilities.

    Science.gov (United States)

    2010-01-01

    ... Governmentwide leadership and direction in the strategic management of the Federal workforce. (b) To execute this... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Office of Personnel Management responsibilities. 250.202 Section 250.202 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL...

  20. 48 CFR 30.202-5 - Filing disclosure statements.

    Science.gov (United States)

    2010-10-01

    ... GENERAL CONTRACTING REQUIREMENTS COST ACCOUNTING STANDARDS ADMINISTRATION CAS Program Requirements 30.202-5 Filing disclosure statements. See 48 CFR 9903.202-5 (FAR appendix). ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Filing...

  1. 10 CFR 63.202 - Definitions for Subpart K.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Definitions for Subpart K. 63.202 Section 63.202 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN A GEOLOGIC... Definitions for Subpart K. General environment means everywhere outside the Yucca Mountain site, the...

  2. 41 CFR 105-50.202-3 - Training.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Training. 105-50.202-3....202-3 Training. (a) This training consists of the type which GSA is authorized by law to conduct for Federal personnel and others or which is similar to such training. (b) Descriptions of the...

  3. 20 CFR 416.202 - Who may get SSI benefits.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Who may get SSI benefits. 416.202 Section 416..., BLIND, AND DISABLED Eligibility General § 416.202 Who may get SSI benefits. You are eligible for SSI... treatment was available or 36 months of SSI benefits on the basis of disability where drug addiction...

  4. 12 CFR 202.7 - Rules concerning extensions of credit.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Rules concerning extensions of credit. 202.7... EQUAL CREDIT OPPORTUNITY ACT (REGULATION B) § 202.7 Rules concerning extensions of credit. (a) Individual accounts. A creditor shall not refuse to grant an individual account to a creditworthy...

  5. 48 CFR 15.202 - Advisory multi-step process.

    Science.gov (United States)

    2010-10-01

    ... offerors to submit information that allows the Government to advise the offerors about their potential to... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Advisory multi-step process. 15.202 Section 15.202 Federal Acquisition Regulations System FEDERAL ACQUISITION...

  6. 40 CFR 266.202 - Definition of solid waste.

    Science.gov (United States)

    2010-07-01

    ... disposal as defined in 40 CFR 261.2(c)(1), or burning for energy recovery as defined in 40 CFR 261.2(c)(2... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Definition of solid waste. 266.202 Section 266.202 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID...

  7. 31 CFR 202.7 - Maintenance of balances within authorizations.

    Science.gov (United States)

    2010-07-01

    ... directed to the Cash Management Policy and Planning Division, Federal Finance, Financial Management Service... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Maintenance of balances within authorizations. 202.7 Section 202.7 Money and Finance: Treasury Regulations Relating to Money and...

  8. 21 CFR 202.1 - Prescription-drug advertisements.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Prescription-drug advertisements. 202.1 Section...) DRUGS: GENERAL PRESCRIPTION DRUG ADVERTISING § 202.1 Prescription-drug advertisements. (a)(1) The... ingredients in the advertisement shall be the same as the order of listing of ingredients on the label of...

  9. 7 CFR 1437.202 - Determining payments for prevented planting.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Determining payments for prevented planting. 1437.202... ASSISTANCE PROGRAM Determining Coverage for Prevented Planted Acreage § 1437.202 Determining payments for prevented planting. (a) Subject to limitations, availability of funds, and specific provisions dealing...

  10. 12 CFR 1806.202 - Estimated award amounts.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Estimated award amounts. 1806.202 Section 1806... BANK ENTERPRISE AWARD PROGRAM Awards § 1806.202 Estimated award amounts. (a) General. An Applicant shall calculate and submit to the Fund an estimated award amount as part of the Bank Enterprise...

  11. 31 CFR 598.202 - Blocking of assets.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Blocking of assets. 598.202 Section... FOREIGN ASSETS CONTROL, DEPARTMENT OF THE TREASURY FOREIGN NARCOTICS KINGPIN SANCTIONS REGULATIONS Prohibitions § 598.202 Blocking of assets. Except to the extent provided in regulations, orders,...

  12. 48 CFR 26.202-2 - Evaluation preference.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Evaluation preference. 26.202-2 Section 26.202-2 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION... Evaluation preference. The contracting officer may use an evaluation preference, when authorized in...

  13. 5 CFR 891.202 - Change of election.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Change of election. 891.202 Section 891... (CONTINUED) RETIRED FEDERAL EMPLOYEES HEALTH BENEFITS Election and Change of Election § 891.202 Change of election. (a) When used in this section, “month” includes the 4-week period for which a retired...

  14. 12 CFR 202.8 - Special purpose credit programs.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Special purpose credit programs. 202.8 Section... CREDIT OPPORTUNITY ACT (REGULATION B) § 202.8 Special purpose credit programs. (a) Standards for programs... to extend special purpose credit to applicants who meet eligibility requirements under the...

  15. 12 CFR 202.10 - Furnishing of credit information.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Furnishing of credit information. 202.10... EQUAL CREDIT OPPORTUNITY ACT (REGULATION B) § 202.10 Furnishing of credit information. (a) Designation of accounts. A creditor that furnishes credit information shall designate: (1) Any new account...

  16. 49 CFR 571.202 - Standard No. 202; Head restraints; Applicable at the manufacturers option until September 1, 2009.

    Science.gov (United States)

    2010-10-01

    ... incorporation by reference of this material in accordance with 5 U.S.C. 552(a) and 1 CFR Part 51. A copy of ECE... SAE Aerospace-Automotive Drawing Standards, sec. 2.3.6, P.E1.01, September 1963. (5) Establish the... the manufacturers option until September 1, 2009. 571.202 Section 571.202 Transportation...

  17. 48 CFR 319.202-2 - Locating small business sources.

    Science.gov (United States)

    2010-10-01

    ... small business concerns that can compete for the proposed requirement—see FAR 19.202, 10.001(2)(v), and... North American Industry Classification System (NAICs) code. This will assist the Government...

  18. Durable donor engraftment after radioimmunotherapy using α-emitter astatine-211-labeled anti-CD45 antibody for conditioning in allogeneic hematopoietic cell transplantation.

    Science.gov (United States)

    Chen, Yun; Kornblit, Brian; Hamlin, Donald K; Sale, George E; Santos, Erlinda B; Wilbur, D Scott; Storer, Barry E; Storb, Rainer; Sandmaier, Brenda M

    2012-02-01

    To reduce toxicity associated with external γ-beam radiation, we investigated radioimmunotherapy with an anti-CD45 mAb labeled with the α-emitter, astatine-211 ((211)At), as a conditioning regimen in dog leukocyte antigen-identical hematopoietic cell transplantation (HCT). Dose-finding studies in 6 dogs treated with 100 to 618 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) without HCT rescue demonstrated dose-dependent myelosuppression with subsequent autologous recovery, and transient liver toxicity in dogs treated with (211)At doses less than or equal to 405 μCi/kg. Higher doses of (211)At induced clinical liver failure. Subsequently, 8 dogs were conditioned with 155 to 625 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) before HCT with dog leukocyte antigen-identical bone marrow followed by a short course of cyclosporine and mycophenolate mofetil immunosuppression. Neutropenia (1-146 cells/μL), lymphopenia (0-270 cells/μL), and thrombocytopenia (1500-6560 platelets/μL) with prompt recovery was observed. Seven dogs had long-term donor mononuclear cell chimerism (19%-58%), whereas 1 dog treated with the lowest (211)At dose (155 μCi/kg) had low donor mononuclear cell chimerism (5%). At the end of follow-up (18-53 weeks), only transient liver toxicity and no renal toxicity had been observed. In conclusion, conditioning with (211)At-labeled anti-CD45 mAb is safe and efficacious and provides a platform for future clinical trials of nonmyeloablative transplantation with radioimmunotherapy-based conditioning. PMID:22134165

  19. 47 CFR 202.2 - Criteria and guidance.

    Science.gov (United States)

    2010-10-01

    ... EMERGENCY PREPAREDNESS PLANNING AND EXECUTION § 202.2 Criteria and guidance. NS/EP planning in government... telecommunications systems and networks during wartime or non-wartime emergencies is of the utmost importance. This can best be accomplished by centralized policy development, planning, and broad direction....

  20. 48 CFR 30.202-8 - Subcontractor disclosure statements.

    Science.gov (United States)

    2010-10-01

    ... subcontractor's Disclosure Statement must be made in accordance with 48 CFR 9903.202-2 (FAR appendix). ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Subcontractor disclosure... GENERAL CONTRACTING REQUIREMENTS COST ACCOUNTING STANDARDS ADMINISTRATION CAS Program Requirements...

  1. 48 CFR 430.202-8 - Subcontractor Disclosure Statements.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Subcontractor Disclosure... GENERAL CONTRACTING REQUIREMENTS COST ACCOUNTING STANDARDS ADMINISTRATION CAS Program Requirements 430.202-8 Subcontractor Disclosure Statements. (a) The Secretary, without the power to redelegate,...

  2. 41 CFR 51-9.202 - Accounting of disclosures.

    Science.gov (United States)

    2010-07-01

    ... RULES 9.2-Disclosure of Records § 51-9.202 Accounting of disclosures. (a) Except for disclosures made pursuant to paragraphs (a) and (b) of § 51-9.201 of this part, an accurate accounting of each disclosure... is longer. The accounting will include the date, nature, and purpose of each disclosure, and the...

  3. 40 CFR 1065.202 - Data updating, recording, and control.

    Science.gov (United States)

    2010-07-01

    ..., and control. Your test system must be able to update data, record data and control systems related to... control systems that can record at the specified minimum frequencies, as follows: Table 1 of § 1065.202... N/A 1 Hz. § 1065.520, § 1065.530, § 1065.550 Batch concentrations of raw or dilute analyzers N/A...

  4. 48 CFR 19.202-2 - Locating small business sources.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Locating small business... SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 19.202-2 Locating small business sources. The contracting officer must, to the extent practicable, encourage maximum participation by small...

  5. 48 CFR 2919.202-2 - Locating small business sources.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Locating small business... SOCIOECONOMIC PROGRAMS SMALL BUSINESS AND SMALL DISADVANTAGED BUSINESS CONCERNS Policies 2919.202-2 Locating small business sources. Any procurement conducted on an unrestricted basis will include solicitations...

  6. 24 CFR 570.202 - Eligible rehabilitation and preservation activities.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Eligible rehabilitation and... Activities § 570.202 Eligible rehabilitation and preservation activities. (a) Types of buildings and improvements eligible for rehabilitation assistance. CDBG funds may be used to finance the rehabilitation...

  7. 27 CFR 555.202 - Classes of explosive materials.

    Science.gov (United States)

    2010-04-01

    ... as UN0333, UN0334, or UN0335 by the U.S. Department of Transportation regulations at 49 CFR 172.101... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Classes of explosive..., FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Storage § 555.202...

  8. 30 CFR 202.350 - Scope and definitions.

    Science.gov (United States)

    2010-07-01

    ... ROYALTIES Geothermal Resources § 202.350 Scope and definitions. (a) This subpart is applicable to all geothermal resources produced from Federal geothermal leases issued pursuant to the Geothermal Steam Act of 1970, as amended (30 U.S.C. 1001 et seq.). (b) The definitions in 30 CFR 206.351 are applicable to...

  9. 22 CFR 1203.735-202 - Gifts, entertainment, and favors.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Gifts, entertainment, and favors. 1203.735-202..., entertainment, and favors. (a) Acceptance prohibited. Except as provided in paragraphs (b), (c), and (d) of this..., entertainment, loan, or any other thing of monetary value, from a person who: (1) Has, or is seeking to...

  10. 33 CFR 183.202 - Flotation and certification requirements.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Flotation and certification... SECURITY (CONTINUED) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Flotation Requirements for Outboard Boats Rated for Engines of More Than 2 Horsepower General § 183.202 Flotation and...

  11. 48 CFR 819.202-71 - Additional contracting officer responsibilities.

    Science.gov (United States)

    2010-10-01

    ... OF VETERANS AFFAIRS SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 819.202-71 Additional..., contracting officers must perform the following functions in support of the small business program: (a) Make maximum use of small business source lists. (b) Assure that small business firms are identified...

  12. 48 CFR 514.202-5 - Descriptive literature.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Descriptive literature... CONTRACTING METHODS AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 514.202-5 Descriptive literature... FAR 52.211-6 satisfies the requirement for descriptive literature....

  13. 48 CFR 14.202-5 - Descriptive literature.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Descriptive literature. 14... CONTRACTING METHODS AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 14.202-5 Descriptive literature. (a) Policy. Contracting officers must not require bidders to furnish descriptive literature unless it...

  14. 14 CFR 221.202 - The filing of tariffs and amendments to tariffs.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false The filing of tariffs and amendments to tariffs. 221.202 Section 221.202 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Electronically Filed Tariffs § 221.202...

  15. 37 CFR 202.24 - Deposit of published electronic works available only online.

    Science.gov (United States)

    2010-07-01

    ... electronic works available only online. 202.24 Section 202.24 Patents, Trademarks, and Copyrights COPYRIGHT... COPYRIGHT § 202.24 Deposit of published electronic works available only online. (a) Pursuant to authority... or a phonorecord of an electronic work published in the United States and available only online...

  16. Znf202 Affects High Density Lipoprotein Cholesterol Levels and Promotes Hepatosteatosis in Hyperlipidemic Mice

    NARCIS (Netherlands)

    Vrins, C.L.J.; Out, R.; Santbrink, P. van; Zee, A. van der; Mahmoudi, T.; Groenendijk, M.; Havekes, L.M.; Berkel, T.J.C. van; Dijk, K.W. van; Biessen, E.A.L.

    2013-01-01

    Background: The zinc finger protein Znf202 is a transcriptional suppressor of lipid related genes and has been linked to hypoalphalipoproteinemia. A functional role of Znf202 in lipid metabolism in vivo still remains to be established. Methodology and Principal Findings: We generated mouse Znf202 ex

  17. 24 CFR 100.202 - General prohibitions against discrimination because of handicap.

    Science.gov (United States)

    2010-04-01

    ... discrimination because of handicap. 100.202 Section 100.202 Housing and Urban Development Regulations Relating to... Against Discrimination Because of Handicap § 100.202 General prohibitions against discrimination because of handicap. (a) It shall be unlawful to discriminate in the sale or rental, or to otherwise...

  18. 49 CFR 1544.202 - Persons and property onboard an all-cargo aircraft.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Persons and property onboard an all-cargo aircraft. 1544.202 Section 1544.202 Transportation Other Regulations Relating to Transportation (Continued... SECURITY: AIR CARRIERS AND COMMERCIAL OPERATORS Operations § 1544.202 Persons and property onboard an...

  19. 49 CFR 1546.202 - Persons and property onboard the aircraft.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Persons and property onboard the aircraft. 1546.202 Section 1546.202 Transportation Other Regulations Relating to Transportation (Continued... CARRIER SECURITY Operations § 1546.202 Persons and property onboard the aircraft. Each foreign air...

  20. 20 CFR 202.5 - Company or person under common control.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Company or person under common control. 202.5 Section 202.5 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT EMPLOYERS UNDER THE ACT § 202.5 Company or person under common control. A company or person is under...

  1. 48 CFR 312.202(d) - Market research and description of agency need.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Market research and description of agency need. 312.202(d) Section 312.202(d) Federal Acquisition Regulations System HEALTH AND... for the Acquisition of Commercial Items 312.202(d) Market research and description of agency...

  2. Dicty_cDB: SHF202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHF202 (Link to dictyBase) - - - Contig-U11277-1 - (Link to Original site) ... 9 3 AJ242743 |AJ242743.1 Schizosaccharomyces pombe tpp 1+ gene for trehalose-6P phosphatase, exon 1. 52 0. ... hizosaccharomyces pombe phosphatidate phosphatase (TPP ) mRNA, partial cds. 52 0.013 1 AB013395 |AB013395. ...

  3. 47 CFR 73.202 - Table of Allotments.

    Science.gov (United States)

    2010-10-01

    ... affecting § 73.202 see the List of CFR Sections Affected, which appears in the Finding Aids section of the... 295A Ash Fork 259A Bagdad 269C3 Chino Valley 223A Ehrenberg 286C2 First Mesa 247C Fredonia 278C1 Grand... 224C2 Brackettville 234A Bruni 293A Buffalo 278A Buffalo Gap 227A Burnet *240A Camp Wood 271A...

  4. Alternative Evaluation for the REDOX (202-S) Plutonium Loadout Hood

    Energy Technology Data Exchange (ETDEWEB)

    N. R. Kerr

    1999-09-20

    Located in the 200 Areas is the inactive 202-S Reduction Oxidation (REDOX) Facility, which is managed by the Bechtel Hanford, Inc. Surveillance/Maintenance and Transition project. This facility is contaminated from nuclear material processes related to nuclear material separation from Hanford Site facility operations. This alternative evaluation report describes the alternatives and selection criteria based on the necessary protective requirements to maintain the REDOX Plutonium Loadout Hood in a safe and stable condition awaiting a final waste response action.

  5. Dicty_cDB: SLD202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *cr*wfrqyct*sr*wn*nhcrggi*th*rws*rnlgeeilk viln*n*ksttkng*trrkkkvdarrk*kktiakkqrktran*nlynctrsstiytqtw* lct....25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AU052364 ) Dictyost...elium discoideum slug cDNA, clone SLD202. 381 e-145 2 ( AU033382 ) Dictyostelium ...discoideum slug cDNA, clone SLA703. 381 e-145 2 ( AU053416 ) Dictyostelium discoideum slug cDNA, clone SLI61...1. 381 e-145 2 ( AU052435 ) Dictyostelium discoideum slug cDNA, clone SLD314. 381 e-145 2 ( AU052525 ) Dicty

  6. 17 CFR 202.11 - Public Company Accounting Oversight Board budget approval process.

    Science.gov (United States)

    2010-04-01

    ... AND EXCHANGE COMMISSION INFORMAL AND OTHER PROCEDURES § 202.11 Public Company Accounting Oversight... section and assumptions underlying PCAOB estimates, including work years, program outputs,...

  7. Znf202 affects high density lipoprotein cholesterol levels and promotes hepatosteatosis in hyperlipidemic mice.

    Directory of Open Access Journals (Sweden)

    Carlos L J Vrins

    Full Text Available BACKGROUND: The zinc finger protein Znf202 is a transcriptional suppressor of lipid related genes and has been linked to hypoalphalipoproteinemia. A functional role of Znf202 in lipid metabolism in vivo still remains to be established. METHODOLOGY AND PRINCIPAL FINDINGS: We generated mouse Znf202 expression vectors, the functionality of which was established in several in vitro systems. Next, effects of adenoviral znf202 overexpression in vivo were determined in normo- as well as hyperlipidemic mouse models. Znf202 overexpression in mouse hepatoma cells mhAT3F2 resulted in downregulation of members of the Apoe/c1/c2 and Apoa1/c3/a4 gene cluster. The repressive activity of Znf202 was firmly confirmed in an apoE reporter assay and Znf202 responsive elements within the ApoE promoter were identified. Adenoviral Znf202 transfer to Ldlr-/- mice resulted in downregulation of apoe, apoc1, apoa1, and apoc3 within 24 h after gene transfer. Interestingly, key genes in bile flux (abcg5/8 and bsep and in bile acid synthesis (cyp7a1 were also downregulated. At 5 days post-infection, the expression of the aforementioned genes was normalized, but mice had developed severe hepatosteatosis accompanied by hypercholesterolemia and hypoalphalipoproteinemia. A much milder phenotype was observed in wildtype mice after 5 days of hepatic Znf202 overexpression. Interestingly and similar to Ldl-/- mice, HDL-cholesterol levels in wildtype mice were lowered after hepatic Znf202 overexpression. CONCLUSION/SIGNIFICANCE: Znf202 overexpression in vivo reveals an important role of this transcriptional regulator in liver lipid homeostasis, while firmly establishing the proposed key role in the control of HDL levels.

  8. 高热惊厥202例%Clinical Analysis of 202 Cases of Children with Febrile Convulsion

    Institute of Scientific and Technical Information of China (English)

    钟少珊; 马云翔; 陈凯珍

    2006-01-01

    目的研究高热惊厥(FC)患儿的临床特征及预后,以减少癫癎和智力低下的发生.方法回顾分析202例FC患儿的临床资料,包括发病年龄特征、与发热的关系、惊厥类型、基础疾病、治疗、惊厥发作次数及复发、家族史.结果 202例中首次发作年龄6个月~5岁占90.1%,其中1~3岁占61.9%;79.2%首次发作体温≥38.5 ℃;多为阵挛性惊厥,96.5%惊厥持续《15 min.其基础疾病以急性上呼吸道感染为主,大多预后良好,仅有少数转为癫癎.结论 FC多发生于6个月~5岁患儿,预后多良好,其防治在于控制惊厥,积极降温,必要时预防性使用抗惊厥药物.

  9. E202A、B换热器安全性分析%The Analysis of the Safe Reliability of the E202A,B Heat Exchanger

    Institute of Scientific and Technical Information of China (English)

    王心吟; 邵清华; 路永明

    2001-01-01

    This paper analyzed the results of multiple testing of the E202A,B Heat Exchanger whose running time has exceeded the time limit,and calculated the strength of the shell,seal fitting and tube plate.On the basis of these,the remaining lifespan of the E202A,B Heat Exchanger was assessed at three years.%本文对超期运行的E202A、B换热器的多方面的检测结果进行了分析,并校核了壳体、封头和管板的强度,在此基础上估算出了E202A、B换热器的剩余使用寿命为三年。

  10. 7 CFR 330.202 - Consideration of applications for permits to move plant pests.

    Science.gov (United States)

    2010-01-01

    ... plant pests. 330.202 Section 330.202 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests §...

  11. 30 CFR 243.202 - When will MMS monitor my financial solvency?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false When will MMS monitor my financial solvency? 243.202 Section 243.202 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT...

  12. 24 CFR 982.202 - How applicants are selected: General requirements.

    Science.gov (United States)

    2010-04-01

    ... but not limited to 24 CFR part 5, subpart L, protection for victims of domestic violence, dating... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false How applicants are selected: General requirements. 982.202 Section 982.202 Housing and Urban Development Regulations Relating...

  13. Building Housing for the Low-Income Elderly: Cost Containment in the Section 202 Program.

    Science.gov (United States)

    Turner, Margery Austin

    1985-01-01

    Assessed cost containment and modest design requirements for the Section 202 Direct Loan Program using projects in five Housing and Urban Development (HUD) field offices. Concluded that project design changes and amenities may be undermining Section 202 as a housing production program. (NRB)

  14. 30 CFR 210.202 - How do I submit sales summaries?

    Science.gov (United States)

    2010-07-01

    ... for these submissions. (2) If you submit sales summaries by paper copy, mail them to one of the... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I submit sales summaries? 210.202... MANAGEMENT FORMS AND REPORTS Production and Royalty Reports-Solid Minerals § 210.202 How do I submit...

  15. Znf202 Affects High Density Lipoprotein Cholesterol Levels and Promotes Hepatosteatosis in Hyperlipidemic Mice

    NARCIS (Netherlands)

    C.L.J. Vrins (Carlos L.J.); R. Out (Ruud); P. van Santbrink (Peter); A. van der Zee (Anneke); T. Mahmoudi (Tokameh); M. Groenendijk (Martine); L.M. Havekes (Louis); Th.J.C. van Berkel (Theo); J.A.P. Willems van Dijk (Ko); E.A.L. Biessen (Erik)

    2013-01-01

    textabstractBackground: The zinc finger protein Znf202 is a transcriptional suppressor of lipid related genes and has been linked to hypoalphalipoproteinemia. A functional role of Znf202 in lipid metabolism in vivo still remains to be established. Methodology and Principal Findings: We generated mou

  16. 20 CFR 202.10 - Commencement of employer status of receiver or trustee, etc.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Commencement of employer status of receiver or trustee, etc. 202.10 Section 202.10 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS... receiver or trustee, etc. A receiver, trustee, or other individual or body, judicial or otherwise, in...

  17. 13 CFR 127.202 - What are the requirements for control of an EDWOSB or WOSB?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the requirements for control of an EDWOSB or WOSB? 127.202 Section 127.202 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION WOMEN-OWNED SMALL BUSINESS FEDERAL CONTRACT ASSISTANCE PROCEDURES Eligibility Requirements...

  18. 41 CFR 50-202.3 - Learners, student learners, apprentices, and handicapped workers.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Learners, student learners, apprentices, and handicapped workers. 50-202.3 Section 50-202.3 Public Contracts and Property... handicapped workers. Learners, student learners, apprentices, and handicapped workers may be employed at...

  19. MicroRNA-202 inhibits tumor progression by targeting LAMA1 in esophageal squamous cell carcinoma.

    Science.gov (United States)

    Meng, Xiangrui; Chen, Xiaoqi; Lu, Peng; Ma, Wang; Yue, Dongli; Song, Lijie; Fan, Qingxia

    2016-05-13

    Esophageal squamous cell carcinoma (ESCC) is one of the most aggressive malignancies in the gastrointestinal tract. Emerging studies have indicated that microRNAs (miRNAs) are strongly implicated in the development and progression of ESCC. Here, we focused on the function and the underlying molecular mechanism of miR-202 in ESCC. The results showed that miR-202 was significantly down-regulated in ESCC tissues and cell lines. Overexpression of miR-202 in ECa-109 and KYSE-510 cells markedly suppressed cell proliferation and cell migration, and induced cell apoptosis. Furthermore, laminin α1 (LAMA1) expression was frequently positive in ESCC tissues and inversely correlated with miR-202 expression. Then we demonstrated that miR-202 targeted 3'-untranslated region (UTR) of LAMA1 and inhibited its protein expression. Additionally, LAMA1 overexpression rescued the proliferation inhibition and cell apoptosis elevation induced by miR-202. MiR-202 also inhibited the protein expression of p-FAK and p-Akt, which were all reversed by LAMA1 overexpression. Taken together, these findings suggest that miR-202 may function as a novel tumor suppressor in ESCC by repressing cell proliferation and migration, and its biological effects may attribute the inhibition of LAMA1-mediated FAK-PI3K-Akt signaling. PMID:27045085

  20. 21 CFR 20.2 - Production of records by Food and Drug Administration employees.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Production of records by Food and Drug Administration employees. 20.2 Section 20.2 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND... records by Food and Drug Administration employees. (a) Any request for records of the Food and...

  1. 75 FR 16820 - Delegated Processing for Certain 202 Supportive Housing for the Elderly Projects

    Science.gov (United States)

    2010-04-02

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT Delegated Processing for Certain 202 Supportive Housing for the Elderly Projects... 202 Supportive Housing for the Elderly projects. OMB Approval Number: 2502-New. Form Numbers:...

  2. 20 CFR 25.202 - How is the Special Schedule applied for Japanese seamen?

    Science.gov (United States)

    2010-04-01

    ... accordance with regulations promulgated, contained in 20 CFR parts 1-399, edition revised as of January 1... Japanese seamen? 25.202 Section 25.202 Employees' Benefits OFFICE OF WORKERS' COMPENSATION PROGRAMS... How is the Special Schedule applied for Japanese seamen? (a) The special schedule of...

  3. Treatment of cultured glioma cells with the EGFR-TKI gefitinib (''Iressa'', ZD1839) increases the uptake of astatinated EGF despite the absence of gefitinib-mediated growth inhibition

    International Nuclear Information System (INIS)

    The EGFR-TKI (epidermal growth factor receptor tyrosine kinase inhibitor) gefitinib (''Iressa'', ZD1839), a reversible growth inhibitor of EGFR-expressing tumour cells, has been shown to enhance the antitumour effect of ionising radiation, and also to increase the uptake of radioiodinated EGF. Thus, combination of gefitinib treatment and radionuclide targeting is an interesting option for therapy of brain tumours that are difficult to treat with conventional methods. The aim of this study was to evaluate how pre-treatment with gefitinib affects binding of astatinated EGF (211At-EGF) to cultured glioma U343 cells, which express high levels of EGFR. The growth of U343 cells in the presence of gefitinib was investigated, and it was found that gefitinib does not significantly inhibit the growth of these cells. Nevertheless, the uptake of 211At-EGF in U343 cells was markedly increased (up to 3.5 times) in cells pre-treated with gefitinib (1 μM). This indicates that a combination of gefitinib treatment and radionuclide targeting to EGFR might be a useful therapeutic modality, even for patients who do not respond to treatment with gefitinib alone. (orig.)

  4. 30 CFR 202.551 - How do I determine the volume of production for which I must pay royalty if my lease is not in an...

    Science.gov (United States)

    2010-07-01

    ... (AFA)? 202.551 Section 202.551 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT ROYALTIES Gas Production From Indian Leases § 202.551 How do...

  5. 202例鼻骨骨折临床分析%Clinal analysis of 202 nasal bone fractures cases

    Institute of Scientific and Technical Information of China (English)

    钟振华; 范西惠; 练状; 程泽星; 庄远岭

    2014-01-01

    目的:探讨鼻骨骨折患者的性别、年龄、病因、诊断及治疗时机.方法:回顾性分析202例鼻骨骨折患者的临床资料.结果:202例患者中,男163例(80.7%),女39例(19.3%);52例患者受伤与饮酒有关,且均为男性.致伤原因:斗殴94例(46.5%),摔伤43例(21.3%),交通事故39例(19.3%),工作意外伤害13例(6.5%),运动伤害12例(5.9%),其他伤害1例(0.5%).季节分布:春季54例(26.7%),夏季42例(20.8%),秋季58例(28.7%),冬季48例(23.8%).应用鼻骨X线检查诊断鼻骨骨折的阳性率为79.7%,而CT检查诊断的阳性率为100%.结论:斗殴是鼻骨骨折发生的主要原因,男性占绝大多数,高发年龄20~29岁.CT检查在鼻骨骨折中的诊断有重要意义.

  6. 22 CFR 202.6 - Application for reimbursement of freight charges.

    Science.gov (United States)

    2010-04-01

    ... International Development, Attention: Banking and Finance Division, Office of Financial Management, Washington... SUPPLIES BY VOLUNTARY NON-PROFIT RELIEF AGENCIES § 202.6 Application for reimbursement of freight...

  7. 20 CFR 725.202 - Miner defined; condition of entitlement, miner.

    Science.gov (United States)

    2010-04-01

    ... establishing that he or she: (i) Has pneumoconiosis (see § 718.202), and (ii) The pneumoconiosis arose out of... pneumoconiosis contributes to the total disability (see § 718.204(c)); and (3) Has filed a claim for benefits...

  8. Influence of Gas Flow Rate on the Deposition Rate on Stainless Steel 202 Substrates

    Directory of Open Access Journals (Sweden)

    M.A. Chowdhury

    2012-12-01

    Full Text Available Solid thin films have been deposited on stainless steel 202 (SS 202 substrates at different flow rates of natural gas using a hot filament thermal chemical vapor deposition (CVD reactor. In the experiments, the variations of thin film deposition rate with the variation of gas flow rate have been investigated. The effects of gap between activation heater and substrate on the deposition rate have also been observed. Results show that deposition rate on SS 202 increases with the increase in gas flow rate within the observed range. It is also found that deposition rate increases with the decrease in gap between activation heater and substrate. In addition, friction coefficient and wear rate of SS 202 sliding against SS 304 under different sliding velocities are also investigated before and after deposition. The experimental results reveal that improved friction coefficient and wear rate is obtained after deposition than that of before deposition.

  9. Sinaloense-202, nueva variedad de sorgo para el estado de Sinaloa Sinaloense-202, new sorghum cultivar for the State of Sinaloa

    Directory of Open Access Journals (Sweden)

    Luis Alberto Hernández Espinal

    2010-12-01

    Full Text Available La nueva variedad de sorgo Sinaloense-202 fue desarrollado en el Campo Experimental Valle de Culiacán del Instituto Nacional de Investigaciones Forestales Agrícolas y Pecuarias y registrado con el número 2204-SOG-528-090209/C en el Catálogo de Variedades Factibles de Certificación de México. Esta variedad se adapta a las áreas productoras de sorgo para el estado de Sinaloa. Sinaloense-202 es una variedad de grano crema y se recomienda para condiciones de riego y temporal. El rendimiento promedio de la variedad es de 3 210 kg ha-1 de grano y 28 608 kg ha-1 de forraje verde, supera en promedio 8% y 18.1% respectivamente; el rendimiento de híbridos comerciales de compañías privadas, que se cultivan en la región bajo las mismas condiciones. Sinaloense-202 tiene mejor calidad bromatológica que los híbridos comerciales en el forraje, con un 8.3% de proteína y 59% de digestibilidad, supera en promedio 1.1% y 10% respectivamente, a los híbridos comerciales. Es tolerante a enfermedades que se presentan en la región, como son: ergot (Claviceps african, antracnosis (Colletotrichum graminícola, tizón de la panoja (Fusarium moniliforme y pudrición carbonosa del tallo (Macrophomina phaseolina.The new sorghum variety Sinaloense-202 was developed in the Culiacán Valley Experiment Station of the National Forestry, Agriculture and Livestock Research Institute and was registered with the number 2204-SOG-528-090209/C in the Catalogue of Feasible Varieties of Certification in México. This variety is adapted to sorghum-producing areas in State of Sinaloa, Mexico. The variety Sinaloense-202 has cream grain and is recommended either for irrigation and rainfall areas. The average yield of the variety is 3 210 kg ha-1 of grain and 28 608 kg ha-1 of green forage, which is 8% and 18.1%respectively; higher than the grain and fresh forage yield of commercial hybrids from private companies cultivated in the region. Sinaloense-202 has better bromatologic

  10. 202-S Hexone Facility supplemental information to the Hanford Facility Contingency Plan

    International Nuclear Information System (INIS)

    This document is a unit-specific contingency plan for the 202-S Hexone Facility and is intended to be used as a supplement to the Hanford Facility Contingency Plan. This unit-specific plan is to be used to demonstrate compliance with the contingency plan requirements of WAC 173-303 for certain Resource Conservation and Recovery Act of 1976 (RCRA) waste management units. The 202-S Hexone Facility is not used to process radioactive or nonradioactive hazardous material. Radioactive, dangerous waste material is contained in two underground storage tanks, 276-S-141 and 276-S-142. These tanks do not present a significant hazard to adjacent facilities, personnel, or the environment. Currently, dangerous waste management activities are not being applied at the tanks. It is unlikely that any incidents presenting hazards to public health or the environment would occur at the 202-S Hexone Facility

  11. Functional promoter variant in zinc finger protein 202 predicts severe atherosclerosis and ischemic heart disease

    DEFF Research Database (Denmark)

    Frikke-Schmidt, R.; Nordestgaard, Børge; Grande, Peer;

    2008-01-01

    involved in vascular maintenance and lipid metabolism. Methods We first determined genotype association for 9 ZNF202 SNPs with severe atherosclerosis ( ankle brachial index >0.7 vs. <= 0.7) in a cross-sectional study of 5,355 individuals from the Danish general population. We then determined genotype...... association with IHD in 10,431 individuals from the Danish general population, the CCHS ( Copenhagen City Heart Study), including 1,511 incident IHD events during 28 years of follow-up. Results were verified in 2 independent case-control studies including, respectively, 942 and 1,549 cases with IHD and 8......,998 controls. Finally, we determined whether g. -660A>G altered transcriptional activity of the ZNF202 promoter in vitro. Results Cross-sectionally, ZNF202 g. -660 GG versus AA homozygosity predicted an odds ratio for severe atherosclerosis of 2.01 ( 95% confidence interval [CI]: 1.34 to 3.01). Prospectively...

  12. Formation of a "Cluster Molecule" (C20)2 and its thermal stability

    OpenAIRE

    Podlivaev, A. I.; Openov, L. A.

    2006-01-01

    The possible formation of a "cluster molecule" (C20)2 from two single C20 fullerenes is studied by the tight-binding method. Several (C20)2 isomers in which C20 fullerenes are bound by strong covalent forces and retain their identity are found; actually, these C20 fullerenes play the role of "atoms" in the "cluster molecule". The so-called open-[2+2] isomer has a minimum energy. Its formation path and thermal stability at T = 2000 - 4000 K are analyzed in detail. This isomer loses its molecul...

  13. 31 CFR 535.202 - Transactions with respect to securities registered or inscribed in the name of Iran.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Transactions with respect to securities registered or inscribed in the name of Iran. 535.202 Section 535.202 Money and Finance: Treasury... registered or inscribed in the name of Iran. Unless authorized by a license expressly referring to...

  14. Activation analysis of thallium in urine using the 203Tl(n,2n) 202Tl reaction

    International Nuclear Information System (INIS)

    The method developed by the authors of thallium determination in human urine, based on the 203Tl(n,2n)202Tl reaction followed by chemical separation and measurement of the produced 202Tl by gamma spectrometry, is described. Its application in some cases of intoxication by thallium is reported. The advantages and limitations of the described technique are discussed. (author)

  15. 18 CFR 1304.202 - General sediment and erosion control provisions.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false General sediment and... OTHER ALTERATIONS TVA-Owned Residential Access Shoreland § 1304.202 General sediment and erosion control provisions. (a) During construction activities, TVA shall require that appropriate erosion and...

  16. 76 FR 53115 - Expansion of Foreign-Trade Zone 202; Los Angeles, CA

    Science.gov (United States)

    2011-08-25

    ... inviting public comment has been given in the Federal Register (75 FR 47536-47537, 08/06/2010) and the... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF COMMERCE Foreign-Trade Zones Board Expansion of Foreign-Trade Zone 202; Los Angeles, CA Pursuant to its...

  17. 76 FR 86 - Expansion/Reorganization of Foreign-Trade Zone 202, Los Angeles, CA

    Science.gov (United States)

    2011-01-03

    ..., filed 12/11/2009); Whereas, notice inviting public comment has been given in the Federal Register (74 FR... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF COMMERCE Foreign-Trade Zones Board Expansion/Reorganization of Foreign-Trade Zone 202, Los Angeles, CA Pursuant...

  18. 29 CFR 2704.202 - Contents of application-where the applicant has prevailed.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Contents of application-where the applicant has prevailed... Information Required From Applicants § 2704.202 Contents of application—where the applicant has prevailed. (a) An application for an award under § 2704.105(a) shall show that the applicant has prevailed in...

  19. 45-Day safety screen results for tank 241-U-202, push mode, cores 75 and 78

    International Nuclear Information System (INIS)

    This document is a report of the analytical results for samples collected from the radioactive wastes in Tank 241-U-202 at the Hanford Reservation. Core samples were collected from the solid wastes in the tank and underwent safety screening analyses including differential scanning calorimetry, thermogravimetric analysis, and total alpha analysis. Results indicate that no safety screening notification limits were exceeded

  20. 12 CFR 202.15 - Incentives for self-testing and self-correction.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Incentives for self-testing and self-correction... RESERVE SYSTEM EQUAL CREDIT OPPORTUNITY ACT (REGULATION B) § 202.15 Incentives for self-testing and self-correction. (a) General rules—(1) Voluntary self-testing and correction. The report or results of a...

  1. 7 CFR 767.202 - Real estate inventory property located in special hazard areas.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Real estate inventory property located in special...) FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE SPECIAL PROGRAMS INVENTORY PROPERTY MANAGEMENT Real Estate Property With Important Resources or Located in Special Hazard Areas § 767.202 Real...

  2. 49 CFR 172.202 - Description of hazardous material on shipping papers.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Description of hazardous material on shipping... INFORMATION, TRAINING REQUIREMENTS, AND SECURITY PLANS Shipping Papers § 172.202 Description of hazardous material on shipping papers. (a) The shipping description of a hazardous material on the shipping...

  3. 48 CFR 1019.202-70-8 - Protégé firms.

    Science.gov (United States)

    2010-10-01

    ... SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 1019.202-70-8 Protégé firms. (a) For selection as a protégé, a firm must be: (1) A small business, women-owned small business, small disadvantaged business, small business owned and controlled by service disabled veterans, or qualified HUBZone small...

  4. 9 CFR 113.202 - Canine Hepatitis and Canine Adenovirus Type 2 Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Canine Hepatitis and Canine Adenovirus...; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.202 Canine Hepatitis and Canine Adenovirus Type 2 Vaccine, Killed Virus. Canine Hepatitis and Canine Adenovirus Type 2 Vaccine, Killed...

  5. 48 CFR 32.202-3 - Conducting market research about financing terms.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Conducting market research... 32.202-3 Conducting market research about financing terms. Contract financing may be a subject included in the market research conducted in accordance with part 10. If market research for...

  6. 48 CFR 12.202 - Market research and description of agency need.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Market research and... Commercial Items 12.202 Market research and description of agency need. (a) Market research (see 10.001) is... standards issued by the Architectural and Transportation Barriers Compliance Board at 36 CFR part 1194...

  7. Men’s Suits Retail Sales in Top 22 BJ Department Stores Worth CNY202 million

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Beijing Aug.-Sales value of men’s suits in Beijing 22 mid-to-high range department stores in Aug. was CNY14.9342 million, according to Beijing Commercial Information Consultation Center. Accumulated sales value in Jan. Aug. was CNY202 million, 14.93% lower than the corresponding period last year.

  8. Characteristics of cesium accumulation in the filamentous soil bacterium Streptomyces sp. K202

    International Nuclear Information System (INIS)

    A filamentous soil bacterium, strain K202, was isolated from soil where an edible mushroom (Boletopsis leucomelas) was growing and identified as belonging to the genus Streptomyces on the basis of its morphological characteristics and the presence of LL-2, 6-diaminopimelic acid. We studied the existence states of Cs and its migration from extracellular to intracellular fluid in the mycelia of Streptomyces sp. K202. The results indicated that Cs accumulated in the cells through at least 2 steps: in the first step, Cs+ was immediately and non-specifically adsorbed on the negatively charged cell surface, and in the second step, this adsorbed Cs+ was taken up into the cytoplasm, and a part of the Cs entering the cytoplasm was taken up by an energy-dependent transport system(s). Further, we confirmed that a part of the Cs+ was taken up into the mycelia competitively with K+, because K+ uptake into the intact mycelia of the strain was significantly inhibited by the presence of Cs+ in the culture media. This suggested that part of the Cs is transported by the potassium transport system. Moreover, 133Cs-NMR spectra and SEM-EDX spectra of the mycelia that accumulated Cs showed the presence of at least 2 intracellular Cs states: Cs+ trapped by intercellular materials such as polyphosphate and Cs+ present in a cytoplasmic pool. - Research highlights: → Cs was taken up into the cells of Streptomyces sp. K202 via 2 steps. → The existence states of Cs accumulated in strain K202 were at least 2 types. → The localized Cs in the cells would be trapped by granules such as polyphosphate. → The localized Cs in the cells might involve in Cs detoxification of strain K202.

  9. 18 CFR 382.202 - Annual charges under the Natural Gas Act and Natural Gas Policy Act of 1978 and related statutes.

    Science.gov (United States)

    2010-04-01

    ... the Natural Gas Act and Natural Gas Policy Act of 1978 and related statutes. 382.202 Section 382.202... GENERAL RULES ANNUAL CHARGES Annual Charges § 382.202 Annual charges under the Natural Gas Act and Natural Gas Policy Act of 1978 and related statutes. The adjusted costs of administration of the natural...

  10. 75 FR 47536 - Foreign-Trade Zone 202-Los Angeles, CA; Application for Expansion

    Science.gov (United States)

    2010-08-06

    ...). It was formally filed on July 30, 2010. FTZ 202 was approved on July 14, 1994 (Board Order 693, 59 FR 37464, 7/22/94), and expanded or reorganized on August 26, 1996 (Board Order 842, 61 FR 46763, 9/5/96), on July 9, 1999 (Board Order 1043, 64 FR 38887, 7 20 99), on April 30, 2004 (Board Order 1331, 69...

  11. "Pornographic content related to presentation of violence" - art. 202 § 3 of the Criminal Code (Poland)

    OpenAIRE

    Rosicki, Remigiusz

    2012-01-01

    The legal issue related to the so-called hard-core pornography (pornography using and presenting violence) has been generally presented on the example of the Polish Criminal Code. Of particular importance is art. 202, § 3, which defines criminal penalties for distribution, production, recording, importing, storage and possession of "hard pornography" (the text is limited to the analysis of pornography using and presenting violence).

  12. Evolutionary patterns of volatile terpene emissions across 202 tropical tree species

    OpenAIRE

    Courtois, Elodie A.; Dexter, Kyle G; Paine, Charles Eliot Timothy; Stien, Didier; Engel, Julien; Baraloto, Christopher; Chave, Jérôme

    2015-01-01

    International audience Plant responses to natural enemies include formation of secondary metabolites acting as direct or indirect defenses. Volatile terpenes represent one of the most diverse groups of secondary metabolites. We aimed to explore evolutionary patterns of volatile terpene emission. We measured the composition of damage-induced volatile terpenes from 202 Amazonian tree species, spanning the angiosperm phylogeny. Volatile terpenes were extracted with solid-phase micro extractio...

  13. 78 FR 64144 - 30-Day Notice of Proposed Information Collection: Section 202 Supportive Housing for the Elderly...

    Science.gov (United States)

    2013-10-25

    ... the Elderly Application Submission Requirements AGENCY: Office of the Chief Information Officer, HUD... Title of Information Collection: Section 202 Supportive Housing for the Elderly Application Submission... in determining applicant eligibility and ability to develop housing for the elderly within...

  14. Vapor and gas sampling of single-shell tank 241-C-202 using the in situ vapor sampling system

    International Nuclear Information System (INIS)

    The Vapor Issue Resolution Program tasked the Vapor Team (VT) to collect representative headspace samples from Hanford Site single-shell tank (SST) 241-C-202. This document presents In Situ Vapor Sampling System (ISVS) data resulting from the June 25, 1996 sampling of SST 241-C-202. Analytical results will be presented in separate reports issued by the Pacific Northwest National Laboratory (PNNL) which supplied and analyzed the sample media

  15. Vapor and gas sampling of single-shell tank 241-B-202 using the in situ vapor sampling system

    International Nuclear Information System (INIS)

    The Vapor Issue Resolution Program tasked the Vapor Team (VT) to collect representative headspace samples from Hanford Site single-shell tank (SST) 241-B-202. This document presents In Situ Vapor Sampling System (ISVS) data resulting from the July 18, 1996 sampling of SST 241-B-202. Analytical results will be presented in separate reports issued by the Pacific Northwest National Laboratory (PNNL) which supplied and analyzed the sample media

  16. Astatination of closo-dodecaborate(2-) anion

    Czech Academy of Sciences Publication Activity Database

    Orlova, A.; Lebeda, Ondřej; Tolmachev, V.; Lundquist, H.; Carlsson, J.; Sjöberg, S.

    Cambridge : The Royal Society of Chemistry , 2000 - (Davidson, M.; Hughes, A.; Marder, T.; Wade , K.), s. 144-147 [Conference "Contemporary Boron Chemistry ". Durham (GB), 11.07.1999-15.07.1999] Institutional research plan: CEZ:AV0Z1048901 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  17. SOX9 regulates microRNA miR-202-5p/3p expression during mouse testis differentiation

    DEFF Research Database (Denmark)

    Wainwright, Elanor N; Jorgensen, Joan S; Kim, Youngha; Truong, Vy; Bagheri-Fam, Stefan; Davidson, Tara; Svingen, Terje; Fernandez-Valverde, Selene L; McClelland, Kathryn S; Taft, Ryan J; Harley, Vincent R; Koopman, Peter; Wilhelm, Dagmar

    2013-01-01

    differentiation. These microRNAs are expressed in a sexually dimorphic pattern as the primordial XY gonad differentiates into a testis, with strong expression in Sertoli cells. In vivo, ectopic expression of pri-miR-202 in XX gonads did not result in molecular changes to the ovarian determination pathway...... promoter that is sufficient to drive expression in XY but not XX fetal gonads ex vivo. Mutation of SOX9 and SF1 binding sites reduced ex vivo transactivation of the pri-miR-202 promoter, demonstrating that pri-miR-202 may be a direct transcriptional target of SOX9/SF1 during testis differentiation. Our....... Expression of the primary transcript of miR-202-5p/3p remained low in XY gonads in a conditional Sox9-null mouse model, suggesting that pri-miR-202 transcription is downstream of SOX9, a transcription factor that is both necessary and sufficient for male sex determination. We identified the pri-miR-202...

  18. PIC10F202-Ohjelman testausympäristön suunnittelu ja toteutus

    OpenAIRE

    Riekki, Teemu

    2011-01-01

    Työn aiheena oli suunnitella ja toteuttaa testausympäristö PIC10F202-prosessorille Kajaanin ammattikorkeakoulun elektroniikkakerhon ja mikroprosessoritekniikan opetuksen käyttöön. Aikaisemmin ohjelmia on kirjoitettu 8051-perheen prosessoreille ja nykyään on tullut tarvetta tehdä konekielisiä ohjelmia myös muille prosessoreille. Testausympäristö sisälsi piirilevyn ja ohjelmointilaitteiston. Ohjelmointikielenä käytettiin Microchipin PIC-prosessoreiden konekieltä. Testausympäristöllä oli...

  19. LPIC-2 Linux Professional Institute Certification Study Guide Exams 201 and 202

    CERN Document Server

    Smith, Roderick W

    2011-01-01

    The first book to cover the LPIC-2 certification Linux allows developers to update source code freely, making it an excellent, low-cost, secure alternative to alternate, more expensive operating systems. It is for this reason that the demand for IT professionals to have an LPI certification is so strong. This study guide provides unparalleled coverage of the LPIC-2 objectives for exams 201 and 202. Clear and concise coverage examines all Linux administration topics while practical, real-world examples enhance your learning process. On the CD, you'll find the Sybex Test Engine, electronic flash

  20. Observing and Reducing IFUs: INTEGRAL and PMAS -- Properties of the Ionized Gas in HH 202

    CERN Document Server

    López-Martín, L

    2014-01-01

    The reduction of integral field spectroscopy (IFS) data requires several stages and many repetitive operations to convert raw data into, typically, a large number of spectra. Instead there are several semiautomatic data reduction tools and here we present this data reduction process using some of the Image Reduction and Analysis Facility (IRAF) tasks devoted to reduce spectroscopic data. After explaining the whole process, we illustrate the power of this instrumental technique with some results obtained for the object HH202 in the Orion Nebula (Mesa-Delgado et al., 2009).

  1. Properties of the ionized gas in HH202. I: Results from integral field spectroscopy with PMAS

    CERN Document Server

    Mesa-Delgado, A; Esteban, C; García-Rojas, J; Luridiana, V

    2008-01-01

    We present results from integral field spectroscopy with the Potsdam multi-Aperture Spectrograph of the head of the Herbig-Haro object HH 202 with a spatial sampling of 1"x1". We have obtained maps of different emission lines, physical conditions --such as electron temperature and density-- and ionic abundances from recombination and collisionally excited lines. We present the first map of the Balmer temperature and of the temperature fluctuation parameter, t^2. We have calculated the t^2 in the plane of the sky, which is substantially smaller than that determined along the line of sight. We have mapped the abundance discrepancy factor of O^{2+}, ADF(O^{2+}), finding its maximum value at the HH 202-S position. We have explored the relations between the ADF(O^{2+}) and the electron density, the Balmer and [O III] temperatures, the ionization degree as well as the t^2 parameter. We do not find clear correlations between these properties and the results seem to support that the ADF and t^2 are independent phenom...

  2. OPTIMIZATION OF PROCESSING PARAMETERS IN ELECTROCHEMICAL MACHINING OF AISI 202 USING RESPONSE SURFACE METHODOLOGY

    Directory of Open Access Journals (Sweden)

    V. SATHIYAMOORTHY

    2015-06-01

    Full Text Available This paper attempts to optimize the predominated machining parameters in Electro Chemical Machining (ECM of AISI 202 Austenitic stainless steel using Response Surface Methodology (RSM. The chosen material has been used in railway rolling stock. The selected influencing parameters are applied voltage, electrolyte discharge rate with three levels and tool feed rate with four levels. Thirty six experiments were conducted through design of experiments and central composite design in RSM was applied to identify the optimum conditions which turn into the best Material Removal Rate (MRR and Surface roughness (SR. The experimental analyses reveal that applied voltage of 16 V, tool feed rate of 0.54 mm/min and electrolyte discharge rate of 10 L/min would be the optimum values in ECM of AISI 202 under the selected conditions. For checking the optimality of the developed equation, MRR of 298.276 mm3/min and surface roughness Ra of 2.05 µm were predicted at applied voltage of 12.5 V, tool feed rate of 0.54 mm/min and electrolyte discharge rate of 11.8 L/min with composite desirability of 98.05%. Confirmatory tests showed that the actual performance at the optimum conditions were 291.351 mm3/min and 2.17 µm. The deviation from the predicted performance is less than 6% which proves the composite desirability of the developed models for MRR and surface roughness.

  3. Effect of contact interface configuration on electronic transport in (C20)2-based molecular junctions

    International Nuclear Information System (INIS)

    Using first-principles calculations, we study the electronic transport properties in Au-(C20)2-Au molecular junctions with different contact interface configurations: point contact and bond contact. We observe that the transmission through the bond contact is considerably higher than that of point contact. Furthermore, the I–V characteristics are rather different. For the bond contact, we get a metallic behavior followed by a varistor-type behavior. While as for the point contact, the current increases very slowly in a nonlinear way and is one order of magnitude smaller than that of bond contact. We attribute these obvious differences to the distinct contact configurations. -- Highlights: ► The I–V properties of (C20)2 molecular devices are affected by contact configuration. ► As for the bond contact, metallic behavior in the low bias is observed. ► Varistor-type behavior and nonlinear I–V characteristic in the high bias are found. ► As for the point contact, the Landauer conductance greatly decreases. ► The current is one order of magnitude smaller than that of bond contact.

  4. 7 CFR 202.44 - Proceedings under section 305(b) to determine whether foreign alfalfa or red clover seed is not...

    Science.gov (United States)

    2010-01-01

    ... foreign alfalfa or red clover seed is not adapted for general agricultural use in the United States. 202...) FEDERAL SEED ACT FEDERAL SEED ACT RULES OF PRACTICE Rules Applicable to Other Proceedings § 202.44 Proceedings under section 305(b) to determine whether foreign alfalfa or red clover seed is not adapted...

  5. Fabry-perot kinematics of hh 202-204 in the orion nebula: are they part of a big bipolar outflow?

    Directory of Open Access Journals (Sweden)

    M. Rosado

    2002-01-01

    Full Text Available Se presenta un estudio cinem atico de los objetos HH 202, 203 y 204 usando mapas de velocidad Fabry-Perot en H y [N II]. En el caso de HH 202 se encuentran nebulosidades que podr an estar asociadas a este objeto o bien, dada sus altas velocidades (superiores a 100 km s

  6. 77 FR 64493 - Office of the Secretary of the Air Force Acceptance of Group Application Under Public Law 95-202...

    Science.gov (United States)

    2012-10-22

    ... Department of the Air Force Office of the Secretary of the Air Force Acceptance of Group Application Under Public Law 95-202 and Department of Defense Directive (DODD) 1000.20 AGENCY: The United States Air Force, DOD. ACTION: Notice. SUMMARY: Under the provisions of Section 401, Public Law 95-202 and DoD...

  7. 78 FR 9038 - Office of the Secretary of the Air Force Acceptance of Group Application Under Public Law 95-202...

    Science.gov (United States)

    2013-02-07

    ... Department of the Air Force Office of the Secretary of the Air Force Acceptance of Group Application Under Public Law 95-202 and Department of Defense Directive (DODD) 1000.20: U.S. and Foreign Employees of Air America, Inc. Under the provisions of Section 401, Public Law 95-202 and DoD Directive 1000.20,...

  8. The fast trigger scintillator for the JETSET experiment (PS202/LEAR)

    International Nuclear Information System (INIS)

    In the present thesis the trigger detector of the JETSET experiment (PS202) at the LEAR/CERN consisting of scintillation counters is presented. After giving a start signal in a second stage of the trigger electronics the determination of the position of the traversed points of the reaction products is performed with the information of the scintillation detector. A third following trigger stage shall study the position informations given by the second stage under kinematical points of view. The present diploma thesis deals especially with the first two trigger stages. As basic conditions the components of a scintillation counter are treated and calibration and testing possibilities presented. For this belongs a fast light pulser with green or blue LED. Results of the studies which scintillator and light-guide materials are most suitable for the JETSET experiment are presented. (orig./HSI)

  9. Basal Cell Carcinomas in Gorlin Syndrome: A Review of 202 Patients

    Directory of Open Access Journals (Sweden)

    Elizabeth A. Jones

    2011-01-01

    Full Text Available Gorlin syndrome (Naevoid Basal Cell Carcinoma Syndrome is a rare autosomal dominant syndrome caused by mutations in the PTCH gene with a birth incidence of approximately 1 in 19,000. Patients develop multiple basal cell carcinomas of the skin frequently in early life and also have a predisposition to additional malignancies such as medulloblastoma. Gorlin Syndrome patients also have developmental defects such as bifid ribs and other complications such as jaw keratocysts. We studied the incidence and frequency of basal cell carcinomas in 202 Gorlin syndrome patients from 62 families and compared this to their gender and mutation type. Our data suggests that the incidence of basal cell carcinomas is equal between males and females and the mutation type cannot be used to predict disease burden.

  10. Surveillance and Maintenance Plan for the 202-S Reduction Oxidation (REDOX) Facility

    International Nuclear Information System (INIS)

    This document provides a plan for implementing surveillance and maintenance (S and M) activities to ensure the 202-S Reduction Oxidation (REDOX) Facility is maintained in a safe, environmentally secure, and cost effective manner until subsequent closure during the final disposition phase of decommissioning. Specific objectives of the S and M program are to ensure adequate confinement of hazardous substances, to provide physical safety and security controls, to maintain the facilities in a manner that will minimize potential hazards to the public and workers, to provide adequate frequency of inspections to identify potential hazards, to maintain selected systems or equipment that will be essential for decommissioning activities in a shutdown but standby or operational mode, if economically justified, and to provide a mechanism for the identification and compliance with applicable environmental, safety and health, and safeguard and security requirements

  11. Properties of the ionized gas in HH202 - I. Results from integral field spectroscopy with PMAS

    Science.gov (United States)

    Mesa-Delgado, A.; López-Martín, L.; Esteban, C.; García-Rojas, J.; Luridiana, V.

    2009-04-01

    We present results from integral field spectroscopy with the Potsdam Multi-Aperture Spectrograph of the head of the Herbig-Haro (HH) object HH202 with a spatial sampling of 1 × 1arcsec2. We have obtained maps of different emission lines, physical conditions - such as electron temperature and density - and ionic abundances from recombination and collisionally excited lines. We present the first map of the Balmer temperature and of the temperature fluctuation parameter, t2. We have calculated the t2 in the plane of the sky, which is substantially smaller than that determined along the line of sight. We have mapped the abundance discrepancy factor (ADF) of O2+, ADF(O2+), finding its maximum value at the HH202-S position. We have explored the relations between the ADF(O2+) and the electron density, the Balmer and [OIII] temperatures, the ionization degree as well as the t2 parameter. We do not find clear correlations between these properties and the results seem to support that the ADF and t2 are independent phenomena. We have found a weak negative correlation between the O2+ abundance determined from recombination lines and the temperature, which is the expected behaviour in an ionized nebula, hence it seems that there is no evidence for the presence of supermetal-rich droplets in HII regions. Based on observations collected at the Centro Astronómico Hispano Alemán (CAHA) at Calar Alto, operated jointly by the Max-Planck Institut für Astronomie and the Instituto de Astrofísica de Andalucía (CSIC). E-mail: amd@iac.es

  12. 42 CFR 495.202 - Identification of qualifying MA organizations, MA-EPs and MA-affiliated eligible hospitals.

    Science.gov (United States)

    2010-10-01

    ... STANDARDS FOR THE ELECTRONIC HEALTH RECORD TECHNOLOGY INCENTIVE PROGRAM Requirements Specific to Medicare Advantage (MA) Organizations § 495.202 Identification of qualifying MA organizations, MA-EPs and MA...) are not meaningful users of certified EHR technology. (b) Identification of qualifying MA EPs...

  13. An abundance of rare functional variants in 202 drug target genes sequenced in 14.002 people

    DEFF Research Database (Denmark)

    Nelson, Matthew R.; Wegmann, Daniel; Ehm, Margaret G.;

    2012-01-01

    Rare genetic variants contribute to complex disease risk; however, the abundance of rare variants in human populations remains unknown. We explored this spectrum of variation by sequencing 202 genes encoding drug targets in 14,002 individuals. We find rare variants are abundant (1 every 17 bases)...

  14. 9 CFR 93.202 - Inspection of certain aircraft and other means of conveyance and shipping containers thereon...

    Science.gov (United States)

    2010-01-01

    ... other means of conveyance and shipping containers thereon; unloading, cleaning, and disinfection...; REQUIREMENTS FOR MEANS OF CONVEYANCE AND SHIPPING CONTAINERS Poultry § 93.202 Inspection of certain aircraft and other means of conveyance and shipping containers thereon; unloading, cleaning, and...

  15. Search for Charged Higgs Bosons in $e^{+} e^{-}$ Collisions at $\\sqrt{s}$=189-202 GeV

    CERN Document Server

    Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alderweireld, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Almehed, S; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Bellunato, T F; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brodzicka, J; Brückman, P; Brunet, J M; Bugge, L; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Carimalo, C; Castro, N; Cavallo, F R; Chapkin, M M; Charpentier, P; Checchia, P; Chierici, R; Shlyapnikov, P; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, F; Costa, M J; Crawley, B; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Dalmau, J; Da Silva, T; Da Silva, W; Della Ricca, G; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; De Paula, L S; Di Ciaccio, Lucia; Di Simone, A; Doroba, K; Drees, J; Dris, M; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, Michael; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J A; Gandelman, M; García, C; Gavillet, P; Gazis, E N; Gelé, D; Geralis, T; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hahn, F; Hahn, S; Hallgren, A; Hamacher, K; Hamilton, K; Hansen, J; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Herr, H; Holmgren, S O; Holt, P J; Houlden, M A; Hultqvist, K; Jackson, J N; Jalocha, P; Jarlskog, C; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E K; Johansson, P D; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Katsoufis, E C; Keränen, R; Kernel, G; Kersevan, Borut P; Kiiskinen, A P; King, B T; Kjaer, N J; Kluit, P M; Kokkinias, P; Kourkoumelis, C; Kuznetsov, O; Krumshtein, Z; Kucharczyk, M; Kurowska, J; Laforge, B; Lamsa, J; Leder, Gerhard; Ledroit, F; Leinonen, L; Leitner, R; Lemonne, J; Lenzen, Georg; Lepeltier, V; Lesiak, T; Liebig, W; Liko, D; Lipniacka, A; Lopes, J H; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, F; Mazzucato, M; McNulty, R; Meroni, C; Meyer, W T; Migliore, E; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L M; Murray, W; Muryn, B; Myatt, Gerald; Myklebust, T; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Némécek, S; Nicolaidou, R; Niezurawski, P; Nikolenko, M; Nygren, A; Oblakowska-Mucha, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Palacios, J P; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V F; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Rames, J; Ramler, L; Read, A; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Richard, F; Rídky, J; Ripp-Baudot, I; Rodríguez, D; Romero, A; Ronchese, P; Rosenberg, E I; Roudeau, Patrick; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Savoy-Navarro, Aurore; Schwanda, C; Schwering, B; Schwickerath, U; Segar, A; Sekulin, R L; Siebel, M; Sissakian, A N; Smadja, G; Smirnova, O G; Sokolov, A; Sopczak, André; Sosnowski, R; Spassoff, Tz; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Terranova, F; Timmermans, J; Tinti, N; Tkatchev, L G; Tobin, M; Todorovova, S; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Ullaland, O; Uvarov, V; Valenti, G; van Dam, P; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I B; Vegni, G; Veloso, F; Venus, W A; Verbeure, F; Verdier, P; Verzi, V; Vilanova, D; Vitale, L; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G R; Winter, M; Witek, M; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zimin, N I; Zinchenko, A I; Zoller, P; Zupan, M

    2002-01-01

    A search for pair-produced charged Higgs bosons was performed in the high energy data collected by the DELPHI detector at LEP II at centre-of-mass energies from 189~GeV to 202~GeV\\@. The three different final states, $\\tau \

  16. 20 CFR 703.202 - Identification of significant gaps in State guaranty fund coverage for LHWCA obligations.

    Science.gov (United States)

    2010-04-01

    ... RELATED STATUTES INSURANCE REGULATIONS Insurance Carrier Security Deposit Requirements § 703.202... guaranty fund secures the insurance carrier's LHWCA obligations in that State. When evaluating State...) Ocean marine exclusions; (5) Employer size and viability provisions; and (6) Financial strength of...

  17. 42 CFR 413.202 - Organ procurement organization (OPO) cost for kidneys sent to foreign countries or transplanted...

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Organ procurement organization (OPO) cost for...-Stage Renal Disease (ESRD) Services and Organ Procurement Costs § 413.202 Organ procurement organization... sent to foreign transplant centers or transplanted in patients other than Medicare beneficiaries....

  18. Evolutionary patterns of volatile terpene emissions across 202 tropical tree species.

    Science.gov (United States)

    Courtois, Elodie A; Dexter, Kyle G; Paine, Charles Eliot Timothy; Stien, Didier; Engel, Julien; Baraloto, Christopher; Chave, Jérôme

    2016-05-01

    Plant responses to natural enemies include formation of secondary metabolites acting as direct or indirect defenses. Volatile terpenes represent one of the most diverse groups of secondary metabolites. We aimed to explore evolutionary patterns of volatile terpene emission. We measured the composition of damage-induced volatile terpenes from 202 Amazonian tree species, spanning the angiosperm phylogeny. Volatile terpenes were extracted with solid-phase micro extraction and desorbed in a gas chromatography-mass spectrometry for compound identification. The chemical diversity of the terpene blend showed a strong phylogenetic signal as closely related species emitted a similar number of compounds. Closely related species also tended to have compositionally similar blends, although this relationship was weak. Meanwhile, the ability to emit a given compound showed no significant phylogenetic signal for 200 of 286 compounds, indicating a high rate of diversification in terpene synthesis and/or great variability in their expression. Three lineages (Magnoliales, Laurales, and Sapindales) showed exceptionally high rates of terpene diversification. Of the 70 compounds found in >10% of their species, 69 displayed significant correlated evolution with at least one other compound. These results provide insights into the complex evolutionary history of volatile terpenes in angiosperms, while highlighting the need for further research into this important class of compounds. PMID:27069586

  19. Headspace vapor characterization of Hanford waste tank 241-B-202: Results from samples collected on 7/18/96

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, B.L.; Evans, J.C.; Pool, K.H.; Olsen, K.B.; Fruchter, J.S.; Silvers, K.L.

    1997-01-01

    This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-B-202 (Tank B-202) at the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank farm operations. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNNL). A summary of the inorganic analytes, permanent gases, and total non-methane organic compounds is listed in a table. Detailed descriptions of the analytical results appear in the appendices.

  20. Headspace vapor characterization of Hanford waste Tank 241-C-202: Results from samples collected on 06/25/96

    Energy Technology Data Exchange (ETDEWEB)

    Pool, K.H.; Evans, J.C.; Thomas, B.L.; Olsen, K.B.; Fruchter, J.S.; Silvers, K.L.

    1997-01-01

    This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-C-202 (Tank C-202) at the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank farm operations. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNNL). Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Analyte concentrations were based on analytical results and, where appropriate, on sample volumes provided by WHC. A summary of the inorganic analytes, permanent gases, and total non-methane organic compounds is listed in a table. Detailed descriptions of the analytical results appear in the appendices.

  1. Headspace vapor characterization of Hanford waste tank 241-B-202: Results from samples collected on 7/18/96

    International Nuclear Information System (INIS)

    This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-B-202 (Tank B-202) at the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank farm operations. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNNL). A summary of the inorganic analytes, permanent gases, and total non-methane organic compounds is listed in a table. Detailed descriptions of the analytical results appear in the appendices

  2. 29 CFR 778.202 - Premium pay for hours in excess of a daily or weekly standard.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Premium pay for hours in excess of a daily or weekly... Overtime § 778.202 Premium pay for hours in excess of a daily or weekly standard. (a) Hours in excess of 8... the number of hours in the workweek specified in section 7(a) of the Act as the weekly maximum,...

  3. Fabry-Perot Kinematics of HH 202, 203-204 in the Orion Nebula Are they part of a Big Bipolar Outflow?

    CERN Document Server

    Rosado, M; Arias, L; Le Coarer, E; Rosado, Margarita; Fuente, Eduardo de la; Arias, Lorena

    2001-01-01

    We present a kinematic study of the Herbig-Haro objects HH 202, 203 and 204 using Halpha and [NII] Fabry-Perot velocity maps. For HH 202 we find new features that could belong to this HH object or that perhaps are associated with an outflow different from HH 202. Because of its high velocity (up to 100 km/seg) this outflow probably can be a HH flow not catalogued previously. Large internal motions are found in the fainter regions of HH 203-204, as well as evidence of transverse density gradients. We show that the apex of HH 204 is the zone of maximum velocity in agreement with bow shock models. From our studies, we find kinematic evidence that suggests that HH 203-204 and HH 202 are part of a single and large (approx 0.55 pc) HH flow.

  4. In vivo/ex vivo targeting of Langerhans cells after topical application of the immune response modifier TMX-202: confocal Raman microscopy and histology analysis

    Science.gov (United States)

    Darvin, Maxim E.; Thiede, Gisela; Ascencio, Saul Mujica; Schanzer, Sabine; Richter, Heike; Vinzón, Sabrina E.; Hasche, Daniel; Rösl, Frank; May, Roberto; Hazot, Yohan; Tamarkin, Dov; Lademann, Juergen

    2016-05-01

    The increased ability of TMX-202 (derivative of imiquimod) to penetrate the intact stratum corneum (SC) and the follicular orifices of porcine ear skin was shown ex vivo using confocal Raman microscopy and laser scanning microscopy. Moreover, to assess whether TMX-202 is able to reach the immune cells, Langerhans cells extracted from pretreated human skin were investigated ex vivo using confocal Raman microscopy combined with multivariate statistical methods. Tracking the Raman peak of dimethyl sulfoxide centered at 690 cm-1, the absorption of TMX-202 containing formulation by Langerhans cells was shown. To answer the question whether the TMX-202 active ingredient is able to reach Langerhans cells, the attraction of immune cells to TMX-202 containing formulation treated skin was measured in the in vivo rodent model Mastomys coucha. The results show that TMX-202 active ingredient is able to reach Langerhans cells after penetrating through the intact skin and subsequently attract immune cells. Both the intercellular/transcellular as well as the follicular pathways allow the penetration through the intact barrier of the SC.

  5. A rapid improved method for Gamma-Spectrometry determination of Thallium-202 impurities, in [Thallium 201]labelled radiopharmaceuticals

    International Nuclear Information System (INIS)

    Since the late 1970s, the readily commercially available univalent cation [201Tl]Tl (t1/2 = 72.912 h) in very high specific activity No Carrier Added form, is a radionuclide of widespread diffusion, for use in infarction radiodiagnostic and several other cardiovascular and even cerebral Nuclear Medicine investigations by γ-camera and SPECT1-10), even if its whole body excretion half-life can be considered as long ∼ 10 days. 201Tl decays by EC (100 %) and emits a principal γ-ray at 167.437 keV (10.0 %) greatly Internally Converted (IC) by the K, L, M, N shells of Hg). Actually, this emission is a doublet, having a small component at 165.887 keV (0.155 %). Thus in the analysis of the γ-spectra, a total emission intensity of 10.0 + 0.155 (10.155 %) should be used. These energies are just in the range suitable for γ-camera and SPECT imaging, as well as for use as a radiotracer to follow the fate of different inorganic and organo-metallic chemical forms of thallium, in short- and medium-term metallo-toxicological studies on both cell cultures and laboratory animals. In this last case, also the longer-lived 202Tl (t1/2 = 12.23 d, EC+ β+ = 100%) can be efficiently used for medium-term experiments). On the contrary, the presence of 202Tl is unavoidable in 201Tl radiopharmaceuticals: it leads not only to increased radiation dose to patients, medical and paramedical personnel and the general public, but the medium energy γ-rays emitted by 202Tl (439.56, 520.13 and 959.7 keV)) contribute to increased signal to noise ratios and to the degradation of the contrast of SPECT images

  6. Search for Excited Leptons in $e^+ e^-$ Interactions at $\\sqrt{s}$=192 - 202 GeV

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, L; Balandras, A; Baldew, S V; Todorova-Nová, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Cucciarelli, S; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Van Dierendonck, D N; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; Durán, I; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ewers, A; Extermann, Pierre; Fabre, M; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Hu, Y; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Käfer, D; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Kopp, A; Koutsenko, V F; Kräber, M H; Krämer, R W; Krenz, W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Levchenko, P M; Li Chuan; Likhoded, S A; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Lugnier, L; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mans, J; Marian, G; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Moulik, T; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nisati, A; Nowak, H; Ofierzynski, R A; Organtini, G; Oulianov, A; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Paramatti, R; Park, H K; Park, I H; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Prokofiev, D O; Prokofev, D; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Rodin, J; Roe, B P; Romero, L; Rosca, A; Rosier-Lees, S; Roth, S; Rosenbleck, C; Rubio, Juan Antonio; Ruggiero, G; Rykaczewski, H; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Sanders, M P; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schopper, Herwig Franz; Schotanus, D J; Schwering, G; Sciacca, C; Seganti, A; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S V; Suter, H; Swain, J D; Szillási, Z; Sztaricskai, T; Tang, X W; Tauscher, Ludwig; Taylor, L; Tellili, B; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, M; Wang, X L; Wang, Z M; Weber, A; Weber, M; Wienemann, P; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, A; Zilizi, G; Zimmermann, B; Zöller, M

    2001-01-01

    Excited leptons are searched for using the L3 detector at LEP. The data collected at centre-of-mass energies in the range from 192 up to 202 GeV correspond to a total luminosity of 233 $\\rm pb^{-1}$. No evidence of either pair production of excited leptons, nor of single production is found. From the searches for pair produced excited leptons, lower mass limits close to the kinematic limit are set. From the searches for singly produced excited leptons, upper limits on their couplings are derived in the mass range up to 200 GeV.

  7. Study of Z Boson Pair Production in $e^+ e^-$ Interactions at $\\sqrt{s}$ = 192-202 GeV

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, L; Balandras, A; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colino, N; Conventi, F; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Cucciarelli, S; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Pietra, M; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Van Dierendonck, D N; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; Durán, I; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Extermann, Pierre; Fabre, M; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Hu, Y; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Kopp, A; Koutsenko, V F; Kräber, M H; Krämer, R W; Krenz, W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Levchenko, P M; Li Chuan; Likhoded, S A; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Lugnier, L; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mans, J; Marian, G; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Moulik, T; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nisati, A; Nowak, H; Ofierzynski, R A; Organtini, G; Oulianov, A; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Paramatti, R; Park, H K; Park, I H; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Prokofiev, D O; Prokofev, D; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Rodin, J; Roe, B P; Romero, L; Rosca, A; Rosier-Lees, S; Rubio, Juan Antonio; Ruggiero, G; Rykaczewski, H; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schopper, Herwig Franz; Schotanus, D J; Schwering, G; Sciacca, C; Seganti, A; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Suter, H; Swain, J D; Szillási, Z; Sztaricskai, T; Tang, X W; Tauscher, Ludwig; Taylor, L; Tellili, B; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, M; Wang, X L; Wang, Z M; Weber, A; Weber, M; Wienemann, P; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, A; Zilizi, G; Zimmermann, B; Zöller, M

    2001-01-01

    The cross section for the production of Z boson pairs is measured using the data collected by the L3 detector at LEP in 1999 in $\\rm e^+e^-$ collisions at centre--of--mass energies ranging from 192 GeV up to 202 GeV. Events in all the visible final states are selected, measuring the cross section of this process. The special case of final states containing b quarks is also investigated. All results are in agreement with the Standard Model predictions.

  8. Does Law no. 202/2010 Ensure the Acceleration of the Civil Matters’ Settlement?

    Directory of Open Access Journals (Sweden)

    Alexandrina ZAHARIA

    2011-03-01

    Full Text Available In this paper we are trying to offer those practicing law a theoretical and practical approach of some dispositions in Law 202/ October 25, 2010 regarding some measures to accelerate the adjudication of matters, known as the Law on the Small Justice Reform, that amended and completed the Code of Civil Procedure. The law on accelerating justice was adopted only three months and 11 days after the New Code of Civil procedure was published. This law is important due to the content of some dispositions regarding certain institutions of civil procedural law, that have the role intended by the Romanian legislator, to accelerate the determination of matters, institutions that are not found in the New Code. The reform (change in the Romanian civil trials took into consideration the respect of some principles such as the access to justice, equality of the parties in civil lawsuits, the right to due and fair trial as well as the fact that any reform has to guarantee that the judicial system is efficient, answers the necessity of transparency and democracy. Still, the application of the new dispositions of civil procedure, beginning with Law no. 59/1993 and until the coming into force of law on accelerating the determination of matters, namely the past 17 years, the amendments brought to the Code of Civil procedure have not always been beneficial for the Romanian litigant by the fact that they determined different interpretations leading thus to a non unitary judicial practice even within the same institution. The present law is not safe either from critics that some theoreticians and practitioners of law have expressed, being interested in accomplishing the purpose the Romanian legislator has set in that law. In this paper, the authors aim at analyzing the impact of the abovementioned law, regarding the material competence of the tribunal in trials and the requests regarding claims with the object of payment up to 2000 lei; adjudicating the objection to

  9. Progressive paralysis associated with diffuse astrocyte anaplasia in delta 202 mice homozygous for a transgene encoding the SV40 T antigen.

    Science.gov (United States)

    López-Revilla, Rubén; Soto-Zárate, Carlos; Ridaura, Cecilia; Chávez-Dueñas, Lucía; Paul, Dieter

    2004-03-01

    A convenient transgenic astrocytoma model in delta202 mice, homozygous for a construct encoding the early region of the SV40 virus genome, is described. In the offspring of crosses between delta202 mice heterozygous for the transgene nearly 60% were transgenic; one third of these developed progressive paralysis starting in the hindlimbs at approximately 35 days of age and died at 90 +/- 30 days of age. In affected mice proliferating-non-neuronal cells immunostained with antibodies to the GFAP, an astrocyte marker, whose number increased with age were found in the white matter of the brain, cerebellum and spinal cord, and progressive degeneration and necrosis of spinal motoneurons was observed that-may explain the paralysis. The early onset and reproducible time course of the neurological disease suggest that homozygous delta202 mice, whose proliferating astrocytes appear to damage spinal motoneurons, are a useful model to study astrocyte differentiation, function and tumorigenesis. PMID:15068170

  10. Association of G6PD202A,376G with lower haemoglobin concentration but not increased haemolysis in patients with sickle cell anaemia

    OpenAIRE

    Nouraie, Mehdi; Reading, Noel S.; Campbell, Andrew; Minniti, Caterina P.; Rana, Sohail R.; Luchtman-Jones, Lori; Kato, Gregory J.; Gladwin, Mark; Castro, Oswaldo L.; Prchal, Josef T.; Gordeuk, Victor R

    2010-01-01

    The genetic bases of the highly variable degrees of anaemia and haemolysis in persons with Hb SS are not fully known, but several studies have indicated that G6PD deficiency is not a factor. The G6PD202A and G6PD376G alleles and α-thalassaemia were determined by molecular genetic testing in 261 children and adolescents with Hb SS in a multicentre study. G6PD202A,376G (G6PD A-) was defined as hemizygosity for both alleles in males and homozygosity in females. Among the participants 41% were re...

  11. 45-day safety screen results and final report for tank 241-C-202, auger samples 95-Aug-026 and 95-Aug-027

    International Nuclear Information System (INIS)

    Two auger samples from tank 241-C-202 (C-202) were received at the 222-S Laboratories and underwent safety screening analysis, consisting of differential scanning calorimetry (DSC), thermogravimetric analysis (TGA), and total alpha activity. Two samples were submitted for energetics determination by DSC. Within the triplicate analyses of each sample, one of the results for energetics exceeded the notification limit. The sample and duplicate analyses for both augers exceeded the notification limit for TGA. As required by the Tank Characterization Plan, the appropriate notifications were made within 24 hours of official confirmation that the limits were violated

  12. 201-Tl production studies by 203-Tl(p,3n)201-Pb and 202-Hg(p,2n) nuclear reactions

    Energy Technology Data Exchange (ETDEWEB)

    Birattari, C.; Bonardi, M.; Salomone, A. (Milan Univ. (Italy). Ist. di Fisica)

    Thallium 201 has been produced in the Milan university AVF cyclotron by a /sup 203/Tl(p,3n)/sup 201/Pb and /sup 202/Hg(p,2n) nuclear reactions. /sup 201/Tl//sup 201/Pb were separated radiochemically by the preparation of thallium as thallous iodide after complexation of the lead with EDTA. /sup 202/Hg and /sup 201/Tl were separated by washing the target and holder, to which the radiothallium adheres with 3HCl and adding NaOH. Quality control is by radiochromatography.

  13. CT fluoroscopy-guided percutaneous vertebroplasty in spinal malignancy: technical results, PMMA leakages, and complications in 202 patients

    Energy Technology Data Exchange (ETDEWEB)

    Trumm, Christoph G.; Pahl, Anne; Zech, Christoph J.; Stahl, Robert; Paprottka, Philipp M.; Sandner, Torleif A.; Reiser, Maximilian F. [Klinikum der Ludwig-Maximilians-Universitaet Muenchen-Grosshadern, Department of Clinical Radiology, Munich (Germany); Helmberger, Thomas K. [Klinikum Bogenhausen, Institute for Diagnostic and Interventional Radiology and Nuclear Medicine, Muenchen (Germany); Jakobs, Tobias F. [Krankenhaus Barmherzige Brueder Muenchen, Department of Radiology, Muenchen (Germany); Hoffmann, Ralf-Thorsten [Universitaetsklinikum Carl Gustav Carus Dresden, Department and Policlinics of Diagnostic Radiology, Dresden (Germany)

    2012-11-15

    To retrospectively evaluate the incidence and clinical impact of local polymethylmethacrylate (PMMA) leaks and pulmonary cement embolisms occurring under CT fluoroscopy-guided vertebroplasty of symptomatic malignant vertebral osteolyses. From December 2001 to June 2009, 202 cancer patients (116 women, 86 men; age 63.2 {+-} 8.6 years) with painful malignant vertebral osteolyses underwent vertebroplasty, with or without vertebral compression fracture. A total of 331 vertebrae were treated in 231 sessions under CT fluoroscopy guidance (120kV; 10-25mA; single slice, 4-, 16-, and 128-row CT). In the pre-vertebroplasty CT, the following items were assessed: osteolytic destruction (0, {<=}25, {<=}50, {<=}75, or {<=}100%) of vertebral cross-sectional area, posterior wall, and circumference; presence of perivertebral and degree of epidural (no, mild, moderate) soft tissue involvement. Local PMMA leaks were analyzed using the post-vertebroplasty CT. Pulmonary cement embolisms were evaluated in all patients having undergone radiography (CR; n = 53) or CT (n = 88) of the chest after vertebroplasty due to their underlying disease. Patient charts were reviewed regarding adverse events. Of 331 treated vertebrae, 32, 20.2, and 15.7% showed more than 50% osteolytic involvement of the vertebral cross-sectional area, posterior wall, and circumference, respectively. Mild or moderate epidural involvement was seen in 13.0 and 8.4%. Local PMMA leakage rate was 58.6% (194 of 331 vertebrae). Pulmonary cement embolisms (segmental, n = 10; central, n = 1) were seen after 7.8% of the procedures with follow-up imaging of the chest. No major complications occurred within a 30-day period after vertebroplasty. Vertebroplasty of spinal malignancy can be safely performed under CT fluoroscopy guidance even in patients with substantial osteolytic involvement. In our patient collective, PMMA leaks and pulmonary cement embolisms visualized in post-procedural radiography and CT images had no clinical

  14. CT fluoroscopy-guided percutaneous vertebroplasty in spinal malignancy: technical results, PMMA leakages, and complications in 202 patients

    International Nuclear Information System (INIS)

    To retrospectively evaluate the incidence and clinical impact of local polymethylmethacrylate (PMMA) leaks and pulmonary cement embolisms occurring under CT fluoroscopy-guided vertebroplasty of symptomatic malignant vertebral osteolyses. From December 2001 to June 2009, 202 cancer patients (116 women, 86 men; age 63.2 ± 8.6 years) with painful malignant vertebral osteolyses underwent vertebroplasty, with or without vertebral compression fracture. A total of 331 vertebrae were treated in 231 sessions under CT fluoroscopy guidance (120kV; 10-25mA; single slice, 4-, 16-, and 128-row CT). In the pre-vertebroplasty CT, the following items were assessed: osteolytic destruction (0, ≤25, ≤50, ≤75, or ≤100%) of vertebral cross-sectional area, posterior wall, and circumference; presence of perivertebral and degree of epidural (no, mild, moderate) soft tissue involvement. Local PMMA leaks were analyzed using the post-vertebroplasty CT. Pulmonary cement embolisms were evaluated in all patients having undergone radiography (CR; n = 53) or CT (n = 88) of the chest after vertebroplasty due to their underlying disease. Patient charts were reviewed regarding adverse events. Of 331 treated vertebrae, 32, 20.2, and 15.7% showed more than 50% osteolytic involvement of the vertebral cross-sectional area, posterior wall, and circumference, respectively. Mild or moderate epidural involvement was seen in 13.0 and 8.4%. Local PMMA leakage rate was 58.6% (194 of 331 vertebrae). Pulmonary cement embolisms (segmental, n = 10; central, n = 1) were seen after 7.8% of the procedures with follow-up imaging of the chest. No major complications occurred within a 30-day period after vertebroplasty. Vertebroplasty of spinal malignancy can be safely performed under CT fluoroscopy guidance even in patients with substantial osteolytic involvement. In our patient collective, PMMA leaks and pulmonary cement embolisms visualized in post-procedural radiography and CT images had no clinical impact

  15. Quality of Life in Patients With Brain Metastases Using the EORTC QLQ-BN20+2 and QLQ-C15-PAL

    International Nuclear Information System (INIS)

    Purpose: The 20-item European Organisation for Research and Treatment of Cancer Quality of Life Questionnaire–Brain Neoplasm (QLQ-BN20) is a validated quality-of-life (QOL) questionnaire for patients with primary brain tumors. The European Organisation for Research and Treatment of Cancer Quality of Life Questionnaire–Core 15 Palliative (QLQ-C15-PAL) core palliative questionnaire is a 15-item version of the core 30-item QLQ-C30 and was developed to decrease the burden on patients with advanced cancer. The combination of the QLQ-BN20 and QLQ-C30 to assess QOL may be too burdensome for patients. The primary aim of this study was to assess QOL in patients before and after treatment for brain metastases using the QLQ-BN20+2 and QLQ-C15-PAL, a version of the QLQ-BN20 questionnaire with 2 additional questions assessing cognitive functioning that were not addressed in the QLQ-C15-PAL. Methods and Materials: Patients with brain metastases completed the QLQ-C15-PAL and QLQ-BN20+2 questionnaires to assess QOL before and 1 month after radiation. Linear regression analysis was used to assess changes in QOL scores over time, as well as to explore associations between the QLQ-BN20+2 and QLQ-C15-PAL scales, patient demographics, and clinical variables. Spearman correlation assessed associations between the QLQ-BN20+2 and QLQ-C15-PAL scales. Results: Among 108 patients, the majority (55%) received whole-brain radiotherapy only, with 65% of patients completing follow-up at 1 month after treatment. The most prominent symptoms at baseline were future uncertainty (QLQ-BN20+2) and fatigue (QLQ-C15-PAL). After treatment, significant improvement was seen for the QLQ-C15-PAL insomnia scale, as well as the QLQ-BN20+2 scales of future uncertainty, visual disorder, and concentration difficulty. Baseline Karnofsky Performance Status was negatively correlated to QLQ-BN20+2 motor dysfunction but positively related to QLQ-C15-PAL physical functioning and QLQ-BN20+2 cognitive functioning at

  16. Quality of Life in Patients With Brain Metastases Using the EORTC QLQ-BN20+2 and QLQ-C15-PAL

    Energy Technology Data Exchange (ETDEWEB)

    Caissie, Amanda; Nguyen, Janet; Chen, Emily; Zhang Liying [Rapid Response Radiotherapy Program, Odette Cancer Centre, Sunnybrook Health Sciences Centre, University of Toronto, Toronto, Ontario (Canada); Sahgal, Arjun [Rapid Response Radiotherapy Program, Odette Cancer Centre, Sunnybrook Health Sciences Centre, University of Toronto, Toronto, Ontario (Canada); Department of Radiation Oncology, Princess Margaret Hospital, University of Toronto, Toronto, Ontario (Canada); Clemons, Mark [Department of Medical Oncology, Ottawa Hospital Cancer Centre, Ottawa, Ontario (Canada); Kerba, Marc [Department of Radiation Oncology, Tom Baker Cancer Centre, Calgary, Alberta (Canada); Arnalot, Palmira Foro [Parc de Salut Mar Hospital de l' Esperanca, Barcelona (Spain); Danjoux, Cyril; Tsao, May; Barnes, Elizabeth; Holden, Lori [Rapid Response Radiotherapy Program, Odette Cancer Centre, Sunnybrook Health Sciences Centre, University of Toronto, Toronto, Ontario (Canada); Danielson, Brita [Department of Radiation Oncology, Cross Cancer Institute, Edmonton, Alberta (Canada); Chow, Edward, E-mail: edward.chow@sunnybrook.ca [Rapid Response Radiotherapy Program, Odette Cancer Centre, Sunnybrook Health Sciences Centre, University of Toronto, Toronto, Ontario (Canada)

    2012-07-15

    Purpose: The 20-item European Organisation for Research and Treatment of Cancer Quality of Life Questionnaire-Brain Neoplasm (QLQ-BN20) is a validated quality-of-life (QOL) questionnaire for patients with primary brain tumors. The European Organisation for Research and Treatment of Cancer Quality of Life Questionnaire-Core 15 Palliative (QLQ-C15-PAL) core palliative questionnaire is a 15-item version of the core 30-item QLQ-C30 and was developed to decrease the burden on patients with advanced cancer. The combination of the QLQ-BN20 and QLQ-C30 to assess QOL may be too burdensome for patients. The primary aim of this study was to assess QOL in patients before and after treatment for brain metastases using the QLQ-BN20+2 and QLQ-C15-PAL, a version of the QLQ-BN20 questionnaire with 2 additional questions assessing cognitive functioning that were not addressed in the QLQ-C15-PAL. Methods and Materials: Patients with brain metastases completed the QLQ-C15-PAL and QLQ-BN20+2 questionnaires to assess QOL before and 1 month after radiation. Linear regression analysis was used to assess changes in QOL scores over time, as well as to explore associations between the QLQ-BN20+2 and QLQ-C15-PAL scales, patient demographics, and clinical variables. Spearman correlation assessed associations between the QLQ-BN20+2 and QLQ-C15-PAL scales. Results: Among 108 patients, the majority (55%) received whole-brain radiotherapy only, with 65% of patients completing follow-up at 1 month after treatment. The most prominent symptoms at baseline were future uncertainty (QLQ-BN20+2) and fatigue (QLQ-C15-PAL). After treatment, significant improvement was seen for the QLQ-C15-PAL insomnia scale, as well as the QLQ-BN20+2 scales of future uncertainty, visual disorder, and concentration difficulty. Baseline Karnofsky Performance Status was negatively correlated to QLQ-BN20+2 motor dysfunction but positively related to QLQ-C15-PAL physical functioning and QLQ-BN20+2 cognitive functioning at

  17. Process for producing astatine-211 for radiopharmaceutical use

    International Nuclear Information System (INIS)

    A one-step chemical manipulation is described in combination with a distillation and collection process for producing At-211 comprising; a. providing a target of irradiated Bismuth coated to a predetermined thickness of a backing member, b. providing a vapor-producing still operably connected with a condenser that has a water cooled condensate collector formed of a dry silica gel mesh maintained at a temperature above the freezing point of water, and providing an effluent gas filter that is operably connected to receive effluent gas from the condenser, c. heating the target in the still at a temperature in the range of about 6300-6800C for a time period in the range of 50 to 80 minutes, to evole At-211 vapor from the target, c. providing a dry carrier gas having an oxygen concentration that is sufficient to form Bi/sub 2/O/sub 3/ thereby to essentially preclude vaporization of Bi metal, passing the carrier gas through the still to carry the At-211 vapor to the condenser, and to carry effluent from the condenser to the effluent gas filter, e. eluting At-211 from the condensate collector of the condenser with a controlled volume of eluent containing predetermined solvents that are compatible with a given desired radiopharmaceutical procedure, and f. collecting the At-211 in the controlled volume of eluent for use in the given radiopharmaceutical procedure

  18. Study on Removal Technique of Nitrogen Oxides by H202 Oxidation-Alkali Liquor Absorption%H202氧化——碱液吸收脱除NOx的工艺研究

    Institute of Scientific and Technical Information of China (English)

    朱兆友; 徐超; 高秀; 牛志芳

    2011-01-01

    Removal of nitrogen oxides by H2 O2 oxidation-alkali liquor absorption was proposed according to the feature of low oxidation degree and intermittent discharge of NOx waste gas from pharmaceutic industries.The effects of H202 mass fraction, H202 spray density, oxidation time on NOx oxidation degree and the effects of NOx oxidation degree, alkalinity on the absorption rate of NOx were investigated. The results showed that NOx oxidation degree could reach 67. 2% under the optimum conditions as follows: the temperature was 25℃,the gas flow rate was 8 m3 · h-1 , the NOx initial concentration was 5000~6000 mg ·m-3 , the H2O2 mass fraction was 2.5%, the oxidation time was 13 s, the H2O2 spray density was 15 m3 · m-2 · h-1. The alkali absorption experiment indicated that when NOx oxidation'degree was 50% and alkalinity was 30 g · L-1 ,the absorption rate of NOx could reach 96.1%.%针对制药行业NOx废气氧化度低、间歇排放的特点,提出了H2O2氧化--碱液吸收脱除NOx的方法.考察了H2O2质量分数、喷淋密度、氧化时间对NOx氧化度的影响以及氧化度、碱度对NOx吸收率的影响.结果表明,当温度为25℃、气体流量为8m3·h-1,NOx进口浓度为5000-6000mg·m-3,H2O2质量分数为2.5%,氧化时间为13s,H2O2喷淋密度为15m3·m-2·h-1时,NOx氧化度最高,达到67.2%;当NOx氧化度为50%、碱度为30g·L-1时,NOx吸收率最高,达到96.1%.

  19. Decay of 202Pb* formed in 48Ca+154Sm reaction using the dynamical cluster-decay model

    International Nuclear Information System (INIS)

    The decay of compound nucleus 202Pb*, formed in entrance channel reaction 48Ca+154Sm at different incident energies, is studied by using the dynamical cluster-decay model (DCM) where all decay products are calculated as emissions of preformed clusters through the interaction barriers. The calculated results show an excellent agreement with experimental data for the fusion-evaporation residue cross-section σER together with the fusion-fission cross-section σFF (taken as a sum of the energetically favored symmetric ACN*/2 ± 20 and near symmetric A=65–75 plus complementary fragments), and the competing, non-compound-nucleus quasi-fission cross-section σQF where the entrance channel is considered not to lose its identity (and hence with preformation factor P0=1). The interesting feature of this study is that the three decay processes (ER, FF and QF) are quite comparable at low energies, ER being the most dominant, whereas at higher energies FF becomes most probable followed by ER and QF. The prediction of two fission windows, the symmetric fission (SF) and the near symmetric fission (nSF) whose contribution is more at lower incident energies, suggests the presence of a fine structure effect in the fusion-fission of 202Pb*. This result is attributed to the shell effects (magic shells) playing effective role in the fragment preformation yields for 48Ca+154Sm reaction at lower excitation energies, giving rise to shoulders, to an otherwise Gaussian FF mass distribution, responsible for the QF process. As a further verification of this result, absence of "shoulders" (hence, the QF component) in the decay of 192Pb* due to 48Ca+144Sm reaction is also shown to be given by the calculations, in agreement with experiments. The only parameter of the model is the neck-length ΔR which shows that the ER occurs first, having the largest values of ΔR, and the FF and QF processes occur almost simultaneously at lower incident energies but the FF takes over QF at higher incident

  20. Carrier redistribution between different potential sites in semipolar (202¯1) InGaN quantum wells studied by near-field photoluminescence

    KAUST Repository

    Marcinkevičius, S.

    2014-09-15

    © 2014 AIP Publishing LLC. Scanning near-field photoluminescence (PL) spectroscopy at different excitation powers was applied to study nanoscale properties of carrier localization and recombination in semipolar (202¯1) InGaN quantum wells (QWs) emitting in violet, blue, and green-yellow spectral regions. With increased excitation power, an untypical PL peak energy shift to lower energies was observed. The shift was attributed to carrier density dependent carrier redistribution between nm-scale sites of different potentials. Near-field PL scans showed that in (202¯1) QWs the in-plane carrier diffusion is modest, and the recombination properties are uniform, which is advantageous for photonic applications.

  1. Thr202Ala in thyA Is a Marker for the Latin American Mediterranean Lineage of the Mycobacterium tuberculosis Complex Rather than Para-Aminosalicylic Acid Resistance

    KAUST Repository

    Feuerriegel, S.

    2010-08-30

    Single nucleotide polymorphisms (SNPs) involved in the development of resistance represent powerful markers for the rapid detection of first- and second-line resistance in clinical Mycobacterium tuberculosis complex (MTBC) isolates. However, the association between particular mutations and phenotypic resistance is not always clear-cut, and phylogenetic SNPs have been misclassified as resistance markers in the past. In the present study, we investigated the utility of a specific polymorphism in thyA (Thr202Ala) as a marker for resistance to para-aminosalicyclic acid (PAS). Sixty-three PAS-susceptible MTBC strains comprising all major phylogenetic lineages, reference strain H37Rv, and 135 multidrug-resistant (MDR) strains from Germany (comprising 8 PAS-resistant isolates) were investigated for the presence of Thr202Ala. In both strain collections, the Thr202Ala SNP was found exclusively in strains of the Latin American Mediterranean (LAM) lineage irrespective of PAS resistance. Furthermore, PAS MICs (0.5 mg/liter) for selected LAM strains (all containing the SNP) and non-LAM strains (not containing the SNP), as well as the results of growth curve analyses performed in liquid 7H9 medium in the presence of increasing PAS concentrations (0 to 2.0 mg/liter), were identical. In conclusion, our data demonstrate that the Thr202Ala polymorphism in thyA is not a valid marker for PAS resistance but, instead, represents a phylogenetic marker for the LAM lineage of the M. tuberculosis complex. These findings challenge some of the previous understanding of PAS resistance and, as a consequence, warrant further in-depth investigations of the genetic variation in PAS-resistant clinical isolates and spontaneous mutants.

  2. Search for the Standard Model Higgs boson in $e^+ e^-$ collisions at $\\sqrt{s}$ up to 202 GeV

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, L; Balandras, A; Baldew, S V; Todorova-Nová, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Cucciarelli, S; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Van Dierendonck, D N; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ewers, A; Extermann, Pierre; Fabre, M; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Hu, Y; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Käfer, D; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Kopp, A; Koutsenko, V F; Kräber, M H; Krämer, R W; Krenz, W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Levchenko, P M; Li Chuan; Likhoded, S A; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Lugnier, L; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mans, J; Marian, G; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Moulik, T; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nisati, A; Nowak, H; Ofierzynski, R A; Organtini, G; Oulianov, A; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Paramatti, R; Park, H K; Park, I H; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Prokofiev, D O; Prokofev, D; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Rodin, J; Roe, B P; Romero, L; Rosca, A; Rosier-Lees, S; Roth, S; Rosenbleck, C; Roux, B; Rubio, Juan Antonio; Ruggiero, G; Rykaczewski, H; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Sanders, M P; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schopper, Herwig Franz; Schotanus, D J; Schwering, G; Sciacca, C; Seganti, A; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S V; Suter, H; Swain, J D; Szillási, Z; Sztaricskai, T; Tang, X W; Tauscher, Ludwig; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, M; Wang, X L; Wang, Z M; Weber, A; Weber, M; Wienemann, P; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, A; Zilizi, G; Zimmermann, B; Zöller, M

    2001-01-01

    The Standard Model Higgs boson is searched for in 233.2 pb-1 of data collected by the L3 detector at centre of mass energies from 192 GeV to 202 GeV. These data are consistent with the expectations of Standard Model processes and no evidence of a Higgs signal is observed. A lower limit on the mass of the Standard Model Higgs boson of 107.0 GeV is set at the 95% confidence level.

  3. Influence of heat treatment on the structure and core IgE-binding epitopes of rAra h 2.02.

    Science.gov (United States)

    Cai, Qin; Zhang, Wen-Ju; Zhu, Qing-Qing; Chen, Qin

    2016-07-01

    The rAra h 2.02 was studied to determine the influence of heat treatment on its structure and core IgE-binding epitopes. The results of SDS-PAGE, Western blotting, MALDI-TOF-MS, and atomic force microscopy showed that the structure of rAra h 2.02 was altered after boiling (100°C) or autoclaving (121°C) for 20min. Furthermore, some of the protein may be aggregated. Results of circular dichroism spectroscopy showed that the α-helices content was reduced, while β-turns and random coils were increased by 81% and 27%, respectively, after autoclaving. Antibodies of three core IgE-binding epitopes were used to determine the binding capacity of rAra h 2.02 after thermal processing by indirect ELISA. The results showed that the binding capacities of the three core IgE-binding epitopes were changed after different heat treatments. PMID:26920311

  4. Selection and Identification of Critical Amino Acids in Epitope 187-202 ofPen a1%Pen a1抗原表位187-202关键氨基酸的筛选和鉴定

    Institute of Scientific and Technical Information of China (English)

    牟慧; 高美须; 潘家荣; 支玉香; 赵杰; 刘超超; 李树锦; 赵鑫

    2014-01-01

    Objective Pen a1 is the major allergen in shrimp, and the sensitization mechanism is related with epitopes. The epitope (187-202) of Pen a1 was chosen as the research material, the amino acids’ frequency of occurrence and their conservative property were analyzed, the mutants were synthesized and the IgE capacity of the mutants were analyzed. The critical amino acids of the epitope of Pen a1 were screened out in order to study the shrimp sensitization mechanism and provide a theoretical basis for desensitization.[Method] The amino acid composition and frequency of occurrence in Pen a1, all epitopes and the studied epitope were analyzed using MEGA5, and the amino acids with the highest frequency were chosen. And then the amino acids of tropomyosin in all the allergenic foods in SDAP were also investigated, and the high conservative amino acids were chosen. The common amino acids in the results of both methods were considered to be the potential critical amino acids. Then these amino acids were substituted by alanine, the wild-type peptide and the mutant peptides were then synthesized with solid phase synthesis method. The tested serum was prepared by immuning New Zealand rabbits with wild-type peptide. The capacity of IgE-binding between the wild-type peptide and the mutants were compared with iELISA and competitive Dot-blot methods. The mutant peptides whose capacity of IgE-binding showed a dramatic decline were selected, and the replaced amino acids of the peptides were recognized as the critical amino acids.[Result] The amino acids of glutamic acid (E), leucine (L), arginine (R), glutamine (Q), valine (V), serine (S), aspartic acid (D) were found with higher frequency occurrence in epitope than inPen a1, and were considered as the active amino acids. E, V, L in epitope (187-202) were found with higher frequency occurrence, and were inferred to be the potential critical amino acids of studied epitope. The multiple sequence alignment of tropomyosin from

  5. Comment: 202 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available Database Center for Life Science) licensed under CC Attribution2.1 Japan 撮影:仲里猛留(ライフサイエンス統合データベースセンター) Photo...: Takeru Nakazato (Database Center for Life Science) すみません。JPEGであげようとしてしまった。 PNGで。 nakazato 2008/12/22 09:56:50 2010/01/14 20:12:21 ...

  6. Accounting 202, 302.

    Science.gov (United States)

    Manitoba Dept. of Education, Winnipeg.

    This teaching guide consists of guidelines for conducting two secondary-level introductory accounting courses. Intended for vocational business education students, the courses are designed to introduce financial principles and practices important to personal and business life, to promote development of clerical and bookkeeping skills sufficient…

  7. Z Boson Pair Production in e^+ e^- Collisions at √s between 183 and 202, GeV with the OPAL detector at LEP

    Science.gov (United States)

    Kim, Dae Hwan; Strom, David

    2000-05-01

    A study of Z boson pair production in e^+ e^- annihilation at center-of-mass energies between 183, GeV and 202, GeV is reported. Final states containing only leptons, (l l l l and l l ν ν), quark and lepton pairs, (qq l l, qq ν ν) and the all-hadronic final state (qqqq) are considered. In all states with at least one Z boson decaying hadronically, q barq and b barb final states are considered separately using lifetime and event-shape tags, thereby improving the cross-section measurement. Limits on anomalous ZZγ and ZZZ couplings are derived.

  8. Evidence for a narrow NN-bar state at 2.02 GEV/C2 in 6 and 9 GEV/C antiproton interactions

    International Nuclear Information System (INIS)

    Evidence for the existence of a charged narrow state of mass M approximately 2.02 GeV/c2 and width GAMMA approximately 2, decaying into NN-bar is reported. The state was observed in the reaction p-barp → psub(fast)n-barπ+π-π- at 6 GeV/c and in p-barp → π+sub(fast)p-barnπ+π- at 9 GeV/c in a triggered bubble chamber experiment at the SLAC Hybrid Facility. (author)

  9. ApoA-I mutations, L202P and K131del, in HDL from heterozygotes with low HDL-C

    OpenAIRE

    Ljunggren, Stefan; Levels, Johannes H. M.; Turkina, Maria V.; Sundberg, Sofie; Bochem, Andrea E.; Hovingh, Kees; Holleboom, Adriaan G; Lindahl, Mats; Kuivenhoven, Jan Albert; Karlsson, Helen

    2014-01-01

    PURPOSE: Mutations in apolipoprotein A-I (apoA-I) may affect plasma high-density lipoprotein (HDL) cholesterol levels and the risk for cardiovascular disease but little is known about the presence and effects of circulating apoA-I variants. This study investigates whether the apoA-I mutations, apoA-I(L202P) and apoA-I(K131del) , are present on plasma HDL particles derived from heterozygote carriers and whether this is associated to changes in HDL protein composition. EXPERIMENTAL DESIGN: Plas...

  10. An alternate pathway to long-chain polyunsaturates: the FADS2 gene product Δ8-desaturates 20:2n-6 and 20:3n-3

    OpenAIRE

    Park, Woo Jung; Kothapalli, Kumar S. D.; Lawrence, Peter; Tyburczy, Cynthia; Brenna, J. Thomas

    2009-01-01

    The mammalian Δ6-desaturase coded by fatty acid desaturase 2 (FADS2; HSA11q12-q13.1) catalyzes the first and rate-limiting step for the biosynthesis of long-chain polyunsaturated fatty acids. FADS2 is known to act on at least five substrates, and we hypothesized that the FADS2 gene product would have Δ8-desaturase activity. Saccharomyces cerevisiae transformed with a FADS2 construct from baboon neonate liver cDNA gained the function to desaturate 11,14-eicosadienoic acid (20:2n-6) and 11,14,1...

  11. Search for Neutral Higgs Bosons of the Minimal Supersymmetric Standard Model in $e^+ e^-$ Interactions at $\\sqrt{s}$=192-202 GeV

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, L; Balandras, A; Baldew, S V; Todorova-Nová, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Cucciarelli, S; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Van Dierendonck, D N; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ewers, A; Extermann, Pierre; Fabre, M; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Hu, Y; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Käfer, D; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Kopp, A; Koutsenko, V F; Kräber, M H; Krämer, R W; Krenz, W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Levchenko, P M; Li Chuan; Likhoded, S A; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Lugnier, L; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mans, J; Marian, G; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Moulik, T; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nisati, A; Nowak, H; Ofierzynski, R A; Organtini, G; Oulianov, A; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Paramatti, R; Park, H K; Park, I H; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Prokofiev, D O; Prokofev, D; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Rodin, J; Roe, B P; Romero, L; Rosca, A; Rosier-Lees, S; Roth, S; Rosenbleck, C; Roux, B; Rubio, Juan Antonio; Ruggiero, G; Rykaczewski, H; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Sanders, M P; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schopper, Herwig Franz; Schotanus, D J; Schwering, G; Sciacca, C; Seganti, A; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S V; Suter, H; Swain, J D; Szillási, Z; Sztaricskai, T; Tang, X W; Tauscher, Ludwig; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, M; Wang, X L; Wang, Z M; Weber, A; Weber, M; Wienemann, P; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, A; Zilizi, G; Zimmermann, B; Zöller, M

    2001-01-01

    A search for the lightest neutral CP-even and the neutral CP-odd Higgs bosons of the Minimal Supersymmetric Standard Model is performed using 233.2 pb-1 of integrated luminosity collected with the L3 detector at LEP at centre-of-mass energies 192-202 GeV. No signal is observed and lower mass limits are given as a function of tan(beta) for two scalar top mixing hypotheses. For tan(beta) greater than 0.8, they are mh > 83.4 GeV and mA > 83.8 GeV at 95 % confidence level.

  12. Spectroscopic investigation of 2.02 μm emission in Ho3+/Tm3+ codoped transparent glass ceramic containing CaF2 nanocrystals

    International Nuclear Information System (INIS)

    Tm3+ and Ho3+ codoped transparent glass ceramic (GC) containing CaF2 nanocrystals were fabricated by melt-quenching and subsequent thermal treatment. X-ray diffraction and transmission electron microscopy analysis confirmed the precipitation of CaF2 nanocrystals among the glass matrix. Energy-dispersive x-ray spectroscopy results evidenced the incorporation of Tm3+ and Ho3+ into the CaF2 nanocrystals. Judd-Ofelt parameters were calculated based on the absorption spectra, the smaller Ω2 and larger Ω6 imply that Tm3+ and Ho3+ ions has entered into a symmetrical ionic crystal field. 2.02 μm emission spectral of the GC samples were recorded at room temperature with an excitation of 808 nm laser diode. The enhancement of the emission at 2.02 μm in the GC samples could be attributed to more efficient cross relaxation process of Tm3+:3H4+Tm3+:3H6→2Tm3+:3H4, and energy transfer from Tm3+ to Ho3+ benefited from the incorporation of rare earth ions into CaF2 nanocrystals.

  13. A new 202Hg isotopically enriched methylmercury spike material with SI-traceable reference values for isotope dilution measurements in biological and environmental samples

    International Nuclear Information System (INIS)

    HgO enriched in 202Hg was used for the preparation of a solution of 202Hg enriched CH3Hg. The CH3HgCl was synthesised by reaction with a Grignard reagent and a subsequent comproportionation reaction between dimethylmercury, (CH3)2Hg, and HgCl2, that was optimised to give a high yield of the product, pure from other Hg species and by-products of the synthesis reaction. To prepare the CH3HgCl for use as an IDMS spike, it was dissolved in 2 % ethanol. The spike was thereby maintained in a relatively reactive form without solution preservatives that might alter its chemical behaviour compared to incipient CH3Hg in a sample. Aliquots were sealed in quartz ampoules and a 1-year stability study was undertaken by storing a series of ampoules under different temperature conditions to all be measured on the same occasion (an isochronous study) and by retaining a portion of the solution in a closeable bottle under recommended storage conditions, with measurements at 3-month intervals. The Hg amount content in the form of CH3Hg was obtained by subtraction of the inorganic Hg amount content (determined by gas chromatography inductively coupled plasma mass spectrometry, GC-ICP-MS) from the total Hg amount content (determined by blending with IRMM-639, a natural Hg isotopic certified reference material, ICRM, and isotope dilution mass spectrometry of the digested material). Only CH3Hg and inorganic Hg were detectable in the reference material with inorganic Hg in 3Hg was identical to that of IRMM-640, an inorganic Hg ICRM prepared from the same 202Hg enriched HgO, within enlarged uncertainty statements. These processes allowed the SI-traceable certification of both the amount content of CH3Hg and its isotopic composition, accompanied by combined uncertainty statements estimated according to ISO/GUM. The final uncertainty on the Hg amount content in the form of CH3Hg (3.5 % relative, k=2) included a contribution covering for potential changes over 2 years of shelf-life. No

  14. OPTIMIZATION OF PROCESS PARAMETERS TO MINIMIZE ANGULAR DISTORTION IN GAS TUNGSTEN ARC WELDED STAINLESS STEEL 202 GRADE PLATES USING PARTICLE SWARM OPTIMIZATION

    Directory of Open Access Journals (Sweden)

    R. SUDHAKARAN

    2012-04-01

    Full Text Available This paper presents a study on optimization of process parameters using particle swarm optimization to minimize angular distortion in 202 grade stainless steel gas tungsten arc welded plates. Angular distortion is a major problem and most pronounced among different types of distortion in butt welded plates. The process control parameters chosen for the study are welding gun angle, welding speed, plate length, welding current and gas flow rate. The experiments were conducted using design of experiments technique with five factor five level central composite rotatable design with full replication technique. A mathematical model was developed correlating the process parameters with angular distortion. A source code was developed in MATLAB 7.6 to do the optimization. The optimal process parameters gave a value of 0.0305° for angular distortion which demonstrates the accuracy of the model developed. The results indicate that the optimized values for the process parameters are capable of producing weld with minimum distortion.

  15. Measurements of the Cross Sections for Open Charm and Beauty Production in $\\gamma\\gamma$ Collisions at $\\sqrt{s}$ = 189-202 GeV

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, L; Balandras, A; Baldew, S V; Todorova-Nová, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Cucciarelli, S; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Van Dierendonck, D N; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; Durán, I; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ewers, A; Extermann, Pierre; Fabre, M; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Hu, Y; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Käfer, D; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Kopp, A; Koutsenko, V F; Kräber, M H; Krämer, R W; Krenz, W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Levchenko, P M; Li Chuan; Likhoded, S A; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Lugnier, L; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mans, J; Marian, G; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Moulik, T; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nisati, A; Nowak, H; Ofierzynski, R A; Organtini, G; Oulianov, A; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Paramatti, R; Park, H K; Park, I H; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Prokofiev, D O; Prokofev, D; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Rodin, J; Roe, B P; Romero, L; Rosca, A; Rosier-Lees, S; Roth, S; Rosenbleck, C; Rubio, Juan Antonio; Ruggiero, G; Rykaczewski, H; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Sanders, M P; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schopper, Herwig Franz; Schotanus, D J; Schwering, G; Sciacca, C; Seganti, A; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S V; Suter, H; Swain, J D; Szillási, Z; Sztaricskai, T; Tang, X W; Tauscher, Ludwig; Taylor, L; Tellili, B; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, M; Wang, X L; Wang, Z M; Weber, A; Weber, M; Wienemann, P; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, A; Zilizi, G; Zimmermann, B; Zöller, M

    2001-01-01

    The production of c and b quarks in gamma-gamma collisions is studied with the L3 detector at LEP with 410 pb^-1 of data, collected at centre-of-mass energies from 189 GeV to 202 GeV. Hadronic final states containing c and b quarks are identified by detecting electrons or muons from their semileptonic decays. The cross sections sigma(e+e- -> e+e- c c~ X) and sigma(e+e- -> e+e- b b~ X) are measured and compared to next-to-leading order perturbative QCD calculations. The cross section of b production is measured in gamma-gamma collisions for the first time. It is in excess of the QCD prediction by a factor of three.

  16. Search for Charged Higgs Bosons in $e^{+}e^{-}$ Collisions at Centre-of-Mass Energies up to 202 GeV

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, L; Balandras, A; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Cucciarelli, S; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Van Dierendonck, D N; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; Durán, I; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Extermann, Pierre; Fabre, M; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Hu, Y; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Koutsenko, V F; Kräber, M H; Krämer, R W; Krenz, W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Levchenko, P M; Li Chuan; Likhoded, S A; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Lugnier, L; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mans, J; Marian, G; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Moulik, T; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nisati, A; Nowak, H; Ofierzynski, R A; Organtini, G; Oulianov, A; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Paramatti, R; Park, H K; Park, I H; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Prokofiev, D O; Prokofev, D; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Rodin, J; Roe, B P; Romero, L; Rosca, A; Rosier-Lees, S; Rubio, Juan Antonio; Ruggiero, G; Rykaczewski, H; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schopper, Herwig Franz; Schotanus, D J; Schwering, G; Sciacca, C; Seganti, A; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Suter, H; Swain, J D; Szillási, Z; Sztaricskai, T; Tang, X W; Tauscher, Ludwig; Taylor, L; Tellili, B; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, M; Wang, X L; Wang, Z M; Weber, A; Weber, M; Wienemann, P; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, A; Zilizi, G; Zimmermann, B; Zöller, M

    2000-01-01

    A search for pair-produced charged Higgs bosons is performed with the L3 detector at LEP using data collected at centre-of-mass energies between 192 and 202 GeV, corresponding to an integrated luminosity of 233.2 pb^-1. Decays into a charm and a strange quark or into a tau lepton and its neutrino are considered. The observed events are consistent with the expectations from Standard Model background processes. Including data taken at lower centre-of-mass energies, lower limits on the charged Higgs mass are derived at the 95% confidence level. They vary from 67.4 to 79.9GeV as a function of the H^+/- --> tau nu branching ratio.

  17. Discovery of a Nearby Twin of SN 1987A's Nebula around the Luminous Blue Variable HD 168625: Was Sk -69 202 an LBV?

    Science.gov (United States)

    Smith, Nathan

    2007-03-01

    Spitzer Space Telescope images of the luminous blue variable (LBV) candidate HD 168625 reveal the existence of a bipolar nebula several times larger than its previously known equatorial dust torus. The outer nebula of HD 168625 has a full extent of ~80" or 0.85 pc, and one of the lobes has a well-defined polar ring. The nebula is a near twin of the triple-ring system around SN 1987A. Because of these polar rings, and accounting for stellar/progenitor luminosity, HD 168625 is an even closer twin of SN 1987A than the B supergiant Sher 25 in NGC 3603. HD 168625's nebula was probably ejected during a giant LBV eruption and not during a red supergiant phase, so its similarity to the nebula around SN 1987A may open new possibilities for the creation of SN 1987A's rings. Namely, the hypothesis that Sk -69 202 suffered an LBV-like eruption would avert the complete surrender of single-star models for its bipolar nebula by offering an alternative to an unlikely binary merger scenario. It also hints that LBVs are the likely progenitors of some Type II supernovae, and that HD 168625's nebula is a good example of a pre-explosion environment. Based on observations made with the Spitzer Space Telescope, which is operated by the Jet Propulsion Laboratory, California Institute of Technology, under NASA contract 1407.

  18. Optimization of Process Parameters to Minimize Angular Distortion in Gas Tungsten Arc Welded Stainless Steel 202 Grade Plates Using Genetic Algorithms

    Directory of Open Access Journals (Sweden)

    Sudhakaran .R,

    2010-05-01

    Full Text Available This paper presents a study on optimization of process parameters using genetic algorithm to minimize angular distortion in 202 grade stainless steel gas tungsten arc welded plates. Angular distortion is a major problem and most pronounced among different types of distortion in butt welded plates. The extent of distortion depends onthe welding process control parameters. The important process control parameters chosen for study are gun angle (θ, welding speed (V, plate length (L, welding current (I and gas flow rate (Q. The experiments are conducted based on five factor five level central composite rotatable designs with full replication technique. A mathematical model was developed correlating the process parameters and the angular distortion. The developed model is checked for the adequacy based on ANOVA analysis and accuracy of prediction by confirmatory test. The optimization of process parameters was done using genetic algorithms (GA. A source code was developed using C language to do the optimization. The optimal process parameters gave a value of 0.000379° for angular distortion which demonstrates the accuracy and effectiveness of the model presented and program developed. The obtained results indicate that the optimized parameters are capable of producing weld with minimum distortion.

  19. From streamflow back to rainfall: hydrological model inversion using the Monte Carlo method. Test and crash-test over 202 French catchments.

    Science.gov (United States)

    Brochart, David; Andréassian, Vazken

    2015-04-01

    Precipitation is known to exhibit a high spatial variability. For this reason, raingage measurements, which only provide a local information about rainfall, may not be appropriate to estimate areal rainfall. On the other hand, catchments have the ability to aggregate rainfall over their area and route it to a unique point - the outlet - where it can be easily measured. A catchment can thus be viewed as a large raingage, with the difference that what is measured at the outlet is a complex transformation of the rainfall. In this communication, we propose to use a model of this transformation (a so-called rainfall-runoff model) and to infer rainfall from an observed streamflow using a Monte Carlo method. We apply the method to 202 catchments in France and compare the inferred rainfall with the areal raingage-based rainfall measurements. We show that the inferred rainfall accuracy directly depends on the accuracy of the rainfall-runoff model. Potential applications of this method include rainfall estimation in poorly gaged areas, correction of uncertain rainfall estimates (e.g. satellite-based rainfall estimates), as well as historical reconstitution of rainfall based on streamflow measurements.

  20. Research on the Impact of Institutional Investors on the Stock Price Volatility---Based on 2010 -2011 Data of Shanghai Stock Exchange 202 Samples%机构投资者持股对股价波动性的影响研究--基于2010-2011年沪市202个样本数据的分析

    Institute of Scientific and Technical Information of China (English)

    童元松

    2013-01-01

    Equidistant select the 202 stocks listed on the Shanghai Stock Exchange trading as samples , through Stata12 and Excel software, based on binary the classic regression method , empirical analysis suggests that with in-stitutional investors to raise shareholding ratio in late 2011, the increase range of share price is relatively high , but not significantly.There's a significant positive correlation between the shareholding balance of institutional investors and the amount of increase of individual share at the end of two years .The vast majority of rising stocks were bought by institutional investors, which ratio is less than 5%.%  等距离选取了上海证券交易所上市交易的202个股票作为样本,通过 Stata12、Excel 软件,运用二元经典回归方法,实证分析发现随着机构投资者2011年末对个股持股比例的提高,其股价涨幅相对较高,但是不算显著。两年末机构投资者持股差额(2011年末仓位-2010年末仓位)与2011年个股涨幅有显著的正相关关系,上涨的股票几乎全部是具有机构投资者增仓的,绝大多数样本增减仓的比例均不超过5%。

  1. SI-traceable measurement of methylmercury in tuna by species-specific isotope dilution with a 202Hg isotopically enriched methylmercury reference material

    International Nuclear Information System (INIS)

    The Comite Consultatif pour la Quantite de Matiere, CCQM, from the International Committee for Weights and Measures, has the tasks to co-ordinate the activities of national metrology laboratories in establishing traceability of measurements to the SI and to stimulate understanding of the concept of uncertainty and assignment of uncertainty statements to measurements. CCQM working groups develop and execute international comparisons to establish the technical basis for the mutual recognition of measurement capabilities. In 2003, IRMM, the metrology institute of the European Commission, launched CCQM pilot study 39 on the measurement of As, Se, Pb, Hg and CH3Hg in tuna. The aims were to strengthen the comparability of measurements EU member states are obliged to make under EC regulation 466/2001 (monitoring of contaminants in food) on the total element contents, and to evaluate the comparability of CH3Hg measurement with new measurement techniques. At the CCQM level, it is necessary to produce measurements for all analytes through processes with established traceability to the SI and with uncertainty statements. The IRMM contribution to CCQM-P39 for the determination of the tuna's CH3Hg amount content was based on species specific isotope dilution mass spectrometry applied as a primary method of measurement. IRMM-670, a newly developed 202Hg enriched CH3Hg isotopic reference material, was blended to the tuna sample, from which Hg species were extracted and derivatised to non-polar forms. Gas chromatography inductively coupled plasma mass spectrometry, GC-ICP-MS, was used for Hg species separation and detection of the n(200Hg)/n(202Hg) ratio in the CH3Hg of the blended material. The SI-traceable CH3Hg amount content was then obtained through comparison using an IDMS equation with the IRMM-670 reference CH3Hg amount content (including the isotopic compositions of natural Hg recommended by IUPAC, and certified for CH3Hg in IRMM-670). IRMM-639, a natural-like Hg

  2. Endovascular Treatment of Pelvic Congestion Syndrome: Visual Analog Scale (VAS) Long-Term Follow-up Clinical Evaluation in 202 Patients

    International Nuclear Information System (INIS)

    PurposeThis study was designed to evaluate the clinical outcome and patients’ satisfaction after a 5 year follow-up period for pelvic congestion syndrome (PCS) coil embolization in patients who suffered from chronic pelvic pain that initially consulted for lower limb venous insufficiency.MethodsA total of 202 patients suffering from chronic pelvic pain were recruited prospectively in a single center (mean age 43.5 years; range 27–57) where they were being treated for lower limb varices. Inclusion criteria were: lower limb varices and chronic pelvic pain (>6 months), >6 mm pelvic venous caliber in ultrasonography, and venous reflux or presence of communicating veins. Both ovarian and hypogastric veins were targeted for embolization. Pain level was assessed before and after embolotherapy and during follow-up using a visual analog scale (VAS). Technical and clinical success and recurrence of leg varices were studied. Patients completed a quality questionnaire. Clinical follow-up was performed at 1, 3, and 6 months and every year for 5 years.ResultsTechnical success was 100 %. Clinical success was achieved in 168 patients (93.85 %), with complete disappearance of symptoms in 60 patients (33.52 %). Pain score (VAS) was 7.34 ± 0.7 preprocedural versus 0.78 ± 1.2 at the end of follow-up (P < 0.0001). Complications were: groin hematoma (n = 6), coil migration (n = 4), and reaction to contrast media (n = 1). Twenty-three cases presented abdominal pain after procedure. In 24 patients (12.5 %), there was recurrence of their leg varices within the follow-up. The mean degree of patients’ satisfaction was 7.4/9.ConclusionsCoil embolization of PCS is an effective and safe procedure, with high clinical success rate and degree of satisfaction

  3. Endovascular Treatment of Pelvic Congestion Syndrome: Visual Analog Scale (VAS) Long-Term Follow-up Clinical Evaluation in 202 Patients

    Energy Technology Data Exchange (ETDEWEB)

    Laborda, Alicia, E-mail: alaborda@unizar.es; Medrano, Joaquin, E-mail: oauieao@gmail.com [University of Zaragoza, Group of Research in Minimally Invasive Techniques Research (GITMI) (Spain); Blas, Ignacio de, E-mail: deblas@unizar.es [University of Zaragoza, Edificio Hospital Veterinario, Department of Animal Pathology (Unit of Infectious Diseases and Epidemiology) (Spain); Urtiaga, Ignacio, E-mail: info@doctorurtiaga.com [Hospital Clinico Universitario ' Lozano Blesa' , Department of Vascular Surgery (Spain); Carnevale, Francisco Cesar, E-mail: fcarnevale@uol.com.br [University of Sao Paulo, Medical School, Interventional Radiology (Brazil); Gregorio, Miguel A. de, E-mail: mgregori@unizar.es [University of Zaragoza, Group of Research in Minimally Invasive Techniques Research (GITMI) (Spain)

    2013-08-01

    PurposeThis study was designed to evaluate the clinical outcome and patients' satisfaction after a 5 year follow-up period for pelvic congestion syndrome (PCS) coil embolization in patients who suffered from chronic pelvic pain that initially consulted for lower limb venous insufficiency.MethodsA total of 202 patients suffering from chronic pelvic pain were recruited prospectively in a single center (mean age 43.5 years; range 27-57) where they were being treated for lower limb varices. Inclusion criteria were: lower limb varices and chronic pelvic pain (>6 months), >6 mm pelvic venous caliber in ultrasonography, and venous reflux or presence of communicating veins. Both ovarian and hypogastric veins were targeted for embolization. Pain level was assessed before and after embolotherapy and during follow-up using a visual analog scale (VAS). Technical and clinical success and recurrence of leg varices were studied. Patients completed a quality questionnaire. Clinical follow-up was performed at 1, 3, and 6 months and every year for 5 years.ResultsTechnical success was 100 %. Clinical success was achieved in 168 patients (93.85 %), with complete disappearance of symptoms in 60 patients (33.52 %). Pain score (VAS) was 7.34 {+-} 0.7 preprocedural versus 0.78 {+-} 1.2 at the end of follow-up (P < 0.0001). Complications were: groin hematoma (n = 6), coil migration (n = 4), and reaction to contrast media (n = 1). Twenty-three cases presented abdominal pain after procedure. In 24 patients (12.5 %), there was recurrence of their leg varices within the follow-up. The mean degree of patients' satisfaction was 7.4/9.ConclusionsCoil embolization of PCS is an effective and safe procedure, with high clinical success rate and degree of satisfaction.

  4. High-temperature corrosion resistance of NiAl(Cr)-Al2O3 coating in N2+9%O2+0.2% HCl+0.08%SO2 atmosphere

    OpenAIRE

    B. Formanek; B. Szczucka-Lasota

    2010-01-01

    Purpose: The aim of this study was to determine the resistance of nickel and aluminium intermetallic phase-based coatings, modified with chromium and aluminum oxides, and to determine the hypothetical mechanism of these materials’ corrosion.Design/methodology/approach: The selected results of high temperature corrosion resistance of HVOF sprayed coatings with NiAl intermetallic phases are presented. The aggressive corrosion gas included: N2+9%O2+0.2% HCl+0.08%SO2. The temperature of cyclic co...

  5. The ordinary means of appeal in criminal law, from the perspective of the provisions of Law no. 202/2010 (“the small reform” and of the new Code of Criminal Procedure

    Directory of Open Access Journals (Sweden)

    Anca-Lelia LORINCZ

    2012-06-01

    Full Text Available Aiming to ensure the celerity of the Romanian criminal trial, the legislative changes of the present Code of Criminal Procedure through Law no. 202/2010 have impacted also the matter of appeals, leading to fewer degrees of jurisdiction in most criminal cases.The actual Romanian Code of Criminal Procedure governs, as a general rule, the triple level of jurisdiction in criminal matters, dedicating two ordinary means of attack: the appeal and the recourse; consequently to the legislative changes of the present Code of Criminal Procedure (through Law no.202/2010, only the cases that are first trialed in a court can still undergo both ordinary means of attack. Also, Law no.135/2010 regarding the new Code of Criminal Procedure brings changes with regard to ordinary means of attack, and, implicitly, with regard to the levels of jurisdiction. Thus, with the purpose of ensuring the celerity of the criminal trial and the acceleration of the settlement of the criminal cases, under the circumstances in which there will be an increase of guarantees in the criminal prosecution phase and in the first instance trial, in the matter of means of attack the new code stipulates the ordinary means of attack of appeal, fully devolutive. Regarding the recourse, this will become an extraordinary means of attack (under the name of recourse in cassation, exercised only in exceptional cases and only for reasons of illegality.

  6. Neutron Energy Spectra from Neutron Induced Fission of 235U at 0.95 MeV a of 238U at 1.35 and 2.02 MeV

    International Nuclear Information System (INIS)

    The shapes of fission neutron spectra are of interest for power reactor calculations. Recently it has been suggested that the neutron induced fission spectrum of 235U may be harder than was earlier assumed. For this reason measurements of the neutron spectra of some fissile isotopes are in progress at our laboratory. This report will present results from studies of the energy spectra of the neutrons emitted in the neutron induced fission of 235U and 238U. The measurements were performed at an incident neutron energy of 0.95 MeV for 235U and at energies of 1.35 and 2.02 MeV for 238U using time-of-flight techniques. The time-of-flight spectra were only analysed at energies higher than those of the incident neutrons and up to about 10 MeV. Corrections for neutron attenuation in the uranium samples were calculated using a Monte Carlo program. The corrected fission neutron spectra were fitted to Maxwellian temperature distributions. For 235U a temperature of 1.27 ± 0.01 MeV gives the best fit to the experimental data and for 238U the corresponding values are 1.29 ± 0.03 MeV at 1.35 MeV and 1.29 ± 0.02 MeV at 2.02 MeV

  7. Evaluation of a Wet Chemistry Method for Isolation of Cyclotron Produced [211At]Astatine

    Directory of Open Access Journals (Sweden)

    Shigeki Watanabe

    2013-09-01

    Full Text Available A “wet chemistry” approach for isolation of 211At from an irradiated bismuth target is described. The approach involves five steps: (1 dissolution of bismuth target in conc. HNO3; (2 removal of the HNO3 by distillation; (3 dissolution of residue in 8 M HCl; (4 extraction of 211At from 8 M HCl into DIPE; and (5 extraction of 211At from DIPE into NaOH. Results from 55 “optimized” 211At isolation runs gave recovery yields of approximately 78% after decay and attenuation corrections. An attenuation-corrected average of 26 ± 3 mCi in the target provided isolated (actual yields of 16 ± 3 mCi of 211At. A sixth step, used for purification of 211At from trace metals, was evaluated in seven runs. In those runs, isolated 211At was distilled under reductive conditions to provide an average 71 ± 8% recovery. RadioHPLC analyses of the isolated 211At solutions, both initial and after distillation, were obtained to examine the 211At species present. The primary species of 211At present was astatide, but astatate and unidentified species were also observed. Studies to determine the effect of bismuth attenuation on 211At were conducted to estimate an attenuation factor (~1.33 for adjustment of 211At readings in the bismuth target.

  8. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  9. Astatination of nanoparticles containing silver as possible carriers of 211At

    Czech Academy of Sciences Publication Activity Database

    Lebeda, Ondřej; Kučka, Jan; Hrubý, Martin; Koňák, Čestmír; Kozempel, Ján

    2006-01-01

    Roč. 64, - (2006), s. 201-206. ISSN 0969-8043 R&D Projects: GA AV ČR KJB4048302; GA AV ČR KJB4050408 Institutional research plan: CEZ:AV0Z1048901 Keywords : nanoparticles * 211AT * Atalpha particle therapy Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.924, year: 2006

  10. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  11. Coating of a layer of Au on Al13 : The findings of icosahedral Al@Al12Au20- and Al12Au202- fullerenes using ab initio pseudopotential calculations

    Science.gov (United States)

    Kumar, Vijay

    2009-02-01

    We report results of ab initio pseudopotential calculations on the nanocoating of gold on an icosahedral Al13 cluster and the findings of icosahedrally symmetric endohedral Al@Al12Au20- and empty cage Al12Au202- compound fullerenes formed of metal atoms. Twelve Al atoms cap the pentagonal faces of a dodecahedral Au20 cage in which each Au atom has three Al atoms and three Au atoms as nearest neighbors. Mixing of Al13 and Au20 magic clusters leads to a large heat of formation of 0.55 eV/atom and high stability of the Al@Al12Au20 compound fullerene. The binding energies of Al12Au20 and Al@Al12Au20 are 3.017 and 3.007 eV/atom, respectively, which are much larger than 2.457 eV/atom for Au32 fullerene, leading to the possibility of their high abundance.

  12. Millimeter- and submillimeter-wave surveys of Orion A emission lines in the ranges 200.7-202.3, 203.7-205.3, and 330-360 GHz

    International Nuclear Information System (INIS)

    A continuous spectral line survey of the Orion A position from 330.5 to 360.1 GHz was carried out. This survey covers nearly the entire 870 micron atmospheric window accessible from ground-based observations. Approximately 160 distinct spectral features composed of about 180 lines were detected, 29 of which could not be readily identified. In addition, Orion A from 200.7 to 202.3 GHz and from 203.7 to 205.3 GHz and 42 distinct new spectral lines were detected, including four that are unidentified at present. These data sets are the first thorough survey results in these spectral regions. The new interstellar lines in the survey bands are tabulated and displayed graphically. Moreover, the data are being made available to the Astronomical Data Center at the Goddard Space Flight Center for distribution by request to the astronomical community. 14 refs

  13. Book Review: MULTIDIMENSIONAL EQUALITIES Anne Phillips Multiculturalism without Culture Princeton, NJ and Oxford: Princeton University Press, 2007, 202 pp., ISBN 978-0-691-12944-0 Judith Squires The New Politics of Gender Equality Basingstoke and New York: Palgrave Macmillan, 2007, 206 pp., ISBN 978-0-230-00769-7

    OpenAIRE

    2008-01-01

    Book Review: MULTIDIMENSIONAL EQUALITIES Anne Phillips Multiculturalism without Culture Princeton, NJ and Oxford: Princeton University Press, 2007, 202 pp., ISBN 978-0-691-12944-0 Judith Squires The New Politics of Gender Equality Basingstoke and New York: Palgrave Macmillan, 2007, 206 pp., ISBN 978-0-230-00769-7

  14. Determination of the $e^+ e^- \\to \\gamma \\gamma(\\gamma)$ cross-section at centre-of-mass energies ranging from 189 GeV to 202 GeV

    CERN Document Server

    Abreu, P; Adye, T; Adzic, P; Albrecht, Z; Alderweireld, T; Alekseev, G D; Alemany, R; Allmendinger, T; Allport, P P; Almehed, S; Amaldi, Ugo; Amapane, N; Amato, S; Anassontzis, E G; Andersson, P; Andreazza, A; Andringa, S; Antilogus, P; Apel, W D; Arnoud, Y; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barão, F; Barbiellini, Guido; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Beillière, P; Belokopytov, Yu A; Belous, K S; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Bilenky, S M; Bizouard, M A; Bloch, D; Blom, H M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Boyko, I; Bozovic, I; Bozzo, M; Bracko, M; Branchini, P; Brenner, R A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Buschbeck, Brigitte; Buschmann, P; Cabrera, S; Caccia, M; Calvi, M; Camporesi, T; Canale, V; Carena, F; Carroll, L; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Chapkin, M M; Charpentier, P; Checchia, P; Chelkov, G A; Chierici, R; Shlyapnikov, P; Chochula, P; Chorowicz, V; Chudoba, J; Cieslik, K; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Costa, M; Crawley, H B; Crennell, D J; Crosetti, G; Cuevas-Maestro, J; Czellar, S; D'Hondt, J; Dalmau, J; Davenport, M; Da Silva, W; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Min, A; De Paula, L S; Dijkstra, H; Di Ciaccio, Lucia; Dolbeau, J; Doroba, K; Dracos, M; Drees, J; Dris, M; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Engel, J P; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, Michael; Fernández, J; Ferrer, A; Ferrer-Ribas, E; Ferro, F; Firestone, A; Flagmeyer, U; Föth, H; Fokitis, E; Fontanelli, F; Franek, B J; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gamblin, S; Gandelman, M; García, C; Gaspar, C; Gaspar, M; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Geralis, T; Ghodbane, N; Gil, I; Glege, F; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; González-Caballero, I; Gopal, Gian P; Gorn, L; Guz, Yu; Gracco, Valerio; Grahl, J; Graziani, E; Gris, P; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hahn, F; Hahn, S; Haider, S; Hajduk, Z; Hallgren, A; Hamacher, K; Hansen, J; Harris, F J; Hauler, F; Hedberg, V; Heising, S; Hernández, J J; Herquet, P; Herr, H; Higón, E; Holmgren, Sven Olof; Holt, P J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huber, M; Hughes, G J; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Jeans, D; Johansson, E K; Jönsson, P E; Joram, C; Juillot, P; Jungermann, L; Kapusta, F; Karafasoulis, K; Katsanevas, S; Katsoufis, E C; Keränen, R; Kernel, G; Kersevan, Borut P; Khokhlov, Yu A; Khomenko, B A; Khovanskii, N N; Kiiskinen, A P; King, B J; Kinvig, A; Kjaer, N J; Klapp, O; Kluit, P M; Kokkinias, P; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kriznic, E; Krumshtein, Z; Kubinec, P; Kucewicz, W; Kurowska, J; Kurvinen, K L; Lamsa, J; Lane, D W; Lapin, V; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Leinonen, L; Leisos, A; Leitner, R; Lemonne, J; Lenzen, Georg; Lepeltier, V; Lethuillier, M; Libby, J; Liebig, W; Liko, D; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; Lopes, J H; López, J M; López-Fernandez, R; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Mahon, J R; Maio, A; Malek, A; Maltezos, S; Malychev, V; Mandl, F; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martí i García, S; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, F; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; McPherson, G; Merle, E; Meroni, C; Meyer, W T; Myagkov, A; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Moch, M; Møller, R; Mönig, K; Monge, M R; Moraes, D; Morettini, P; Morton, G A; Müller, U; Münich, K; Mulders, M; Mulet-Marquis, C; Mundim, L M; Muresan, R; Murray, W J; Muryn, B; Myatt, Gerald; Myklebust, T; Naraghi, F; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Negri, P; Neufeld, N; Nicolaidou, R; Nielsen, B S; Niezurawski, P; Nikolenko, M; Nomokonov, V P; Nygren, A; Oblakowska-Mucha, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Orazi, G; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Pain, R; Paiva, R; Palacios, J; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Pavel, T; Pegoraro, M; Peralta, L; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Rames, J; Ratoff, P N; Read, A L; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Rehn, J; Reid, D; Reinertsen, P L; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Rídky, J; Rinaudo, G; Ripp-Baudot, I; Romero, A; Ronchese, P; Rosenberg, E I; Rosinsky, P; Roudeau, Patrick; Rovelli, T; Ruhlmann-Kleider, V; Ruiz, A; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sajot, G; Salt, J; Sampsonidis, D; Sannino, M; Savoy-Navarro, Aurore; Schwemling, P; Schwering, B; Schwickerath, U; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Seibert, N; Sekulin, R L; Sette, G; Shellard, R C; Siebel, M; Simard, L C; Simonetto, F; Sissakian, A N; Smadja, G; Smirnova, O G; Smith, G R; Solovyanov, O; Sopczak, André; Sosnowski, R; Spassoff, Tz; Spiriti, E; Squarcia, S; Stanescu, C; Stanitzki, M; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Terranova, F; Timmermans, J; Tinti, N; Tkatchev, L G; Tobin, M; Todorova-Nová, S; Tomé, B; Tonazzo, A; Tortora, L; Tortosa, P; Tranströmer, G; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; van Dam, P; Van den Boeck, W; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I B; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verdier, P; Verlato, M; Vertogradov, L S; Verzi, V; Vilanova, D; Vitale, L; Vlasov, E; Vodopyanov, A S; Voulgaris, G; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G R; Winter, M; Wolf, G; Yi, J; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zinchenko, A I; Zoller, P; Zumerle, G; Zupan, M

    2000-01-01

    A test of the QED process \\eeintogg(\\fot) is reported. The data analysed were collected with the DELPHI detector in 1998 and 1999 at the highest ener\\-gies achieved at LEP, reaching 202 GeV in the centre-of-mass. The total integrated luminosity amounts to 375.7 pb$^{-1}$. The differential and total cross-sections for the process $e^+e^- \\to \\gamma \\gamma$ were measured, and found to be in agreement with the QED prediction. 95\\% Confidence Level (C.L.) lower limits on the QED cut-off parameters of $\\rm \\Lambda_+ >$ 330 GeV and $\\rm \\Lambda_{-}>$ 320 GeV were derived. A 95\\% C.L. lower bound on the mass of an excited electron of 311 $\\rm GeV/c^2$ (for $\\lambda_{\\gamma}$ =1) was obtained. s-channel virtual graviton exchange was searched for, resulting in 95\\% C.L. lower limits on the string mass scale, $\\rm M_S$: $\\rm M_S > 713 \\, GeV/c^2$ ( $\\lambda=1$) and $\\rm M_S > 691 \\,GeV/c^2$ ($\\lambda = -1$).

  15. 7 CFR 202.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Act (7 CFR part 201). (l) Respondent means the party proceeded against. (m) Secretary means the... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED...

  16. 18 CFR 157.202 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... facilities. (7) Project means a unit of improvement or construction that is used and useful upon completion... appurtenant facilities, such as heaters, minor gas conditioning, treatment, odorization, and similar equipment... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Definitions....

  17. 20 CFR 202.1 - Statutory provisions.

    Science.gov (United States)

    2010-04-01

    ... transported by railroad, and any receiver, trustee, or other individual or body, judicial or otherwise, when... constitution and by-laws of such organizations. (Sec. 1 (a), 50 Stat. 307; 45 U. S. C. 228a (a)) The term... more such carriers or under common control therewith, and which operates any equipment or facility...

  18. 43 CFR 17.202 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... used in this subpart, the term: (a) The Act means the Rehabilitation Act of 1973, Public Law 93-112, as amended by the Rehabilitation Act Amendments of 1974, Public Law 93-516, and the Rehabilitation...; respiratory, including speech organs; cardiovascular; reproductive; digestive; genito-urinary; hemic...

  19. 7 CFR 400.202 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... second (bps) transmission of data utilizing 3780 (or 2780) protocol. (c) Contract, the see Agency Sales... responsible for data entry and electronic transmission of data contained on crop insurance documents. (k... the data communications protocol (standard) that is a binary synchronous communications...

  20. 10 CFR 600.202 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... ENERGY (CONTINUED) ASSISTANCE REGULATIONS FINANCIAL ASSISTANCE RULES Uniform Administrative Requirements... price of the property including the cost of modifications, attachments, accessories, or auxiliary... under the United States Housing Act of 1937) school district, special district, intrastate...

  1. 14 CFR 1251.202 - Employment criteria.

    Science.gov (United States)

    2010-01-01

    ... applicant's or employee's job skills, aptitude, or whatever other factor the test purports to measure... employment test or other selection criterion that screens out or tends to screen out handicapped persons or any class of handicapped persons unless: (1) The test score or other selection criterion, as used...

  2. 47 CFR 24.202 - Service areas.

    Science.gov (United States)

    2010-10-01

    ... 1992 Commercial Atlas & Marketing Guide, 123rd Edition, at pages 38-39 (“BTA/MTA Map”). Rand McNally organizes the 50 states and the District of Columbia into 47 MTAs and 487 BTAs. The BTA/MTA Map is available... 12th Street, SW, Washington, DC 20554. (a) The MTA service areas are based on the Rand McNally...

  3. QTL Information Table: 202 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available gp1 Morphological trait Panicle/flower grains per panicle Mixture C)Interval RIL Zhenshan 97 Min ... ment interaction for rice panicle characteristics. Yi ... Chuan Xue Bao 28, 439-446. ...

  4. 28 CFR 42.202 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... Act of 1979, Public Law 96-157, 42 U.S.C. 3701, et seq. (b) Juvenile Justice Act means title I and II of the Juvenile Justice and Delinquency Prevention Act of 1974, Public Law 93-415, as amended...

  5. 7 CFR 1430.202 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... (inclusive). Hundredweight or cwt. means 100 pounds. Marketed commercially means sold to the market to which..., or other business enterprise or other legal entity who is, or whose members are, a citizen of,...

  6. 15 CFR 2011.202 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... glucose), ti light sugar (99.2% sugar with the residual comprised of the artificial sweeteners aspartame and acesulfame K), caster sugar, golden syrup, ferdiana granella grossa, golden granulated...

  7. 18 CFR 292.202 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... Holding Company Act of 1935, 15 U.S.C. 79c(a)(3) or 79c(a)(5). (o) Utility geothermal small power... OF ENERGY REGULATIONS UNDER THE PUBLIC UTILITY REGULATORY POLICIES ACT OF 1978 REGULATIONS UNDER SECTIONS 201 AND 210 OF THE PUBLIC UTILITY REGULATORY POLICIES ACT OF 1978 WITH REGARD TO SMALL...

  8. 5 CFR 340.202 - General.

    Science.gov (United States)

    2010-01-01

    ... EMPLOYMENT (PART-TIME, SEASONAL, ON-CALL, AND INTERMITTENT) Regulatory Requirements-Part-Time Employment... hours per week. (c) Mixed Tours of Duty. The provisions of this subpart and the term “part-time career... of duty. For this purpose, a mixed tour of duty consists of annually recurring periods of...

  9. 42 CFR 57.202 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... medicine, osteopathic medicine, dentistry, pharmacy, podiatric medicine, optometry, or veterinary medicine... school of medicine, school of dentistry, school of osteopathic medicine, school of pharmacy, school...

  10. 24 CFR 202.12 - Title II.

    Science.gov (United States)

    2010-04-01

    ... MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES APPROVAL OF LENDING... this section by the originator. The responsibility of sponsors of loan correspondent mortgagees is also... actual variations in fees or cost to the mortgagee to make the mortgage loan, which shall be...

  11. 48 CFR 202.101 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... Education Activity TRICARE Management Activity Washington Headquarters Services, Acquisition and Procurement... Defense Contract Management Agency, the Defense Finance and Accounting Service, the Defense Information... Management) Naval Air Systems Command Space and Naval Warfare Systems Command Naval Facilities...

  12. 40 CFR 97.202 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... (1) of this definition is combined cycle, any associated duct burner, heat recovery steam generator, and steam turbine. Commence commercial operation means, with regard to a unit: (1) To have begun to....204 on the later of November 15, 1990 or the date the unit commences commercial operation as...

  13. 40 CFR 96.202 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... associated duct burner, heat recovery steam generator, and steam turbine. Commence commercial operation means... unit commences commercial operation as defined in paragraph (1) of this definition and that...), such date shall remain the date of commencement of commercial operation of the unit, which...

  14. 40 CFR 59.202 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... carburetor, or solvent use regulated under 40 CFR part 63, subpart T (halogenated solvent national emission... used in parts washing equipment, or any solvent use regulated under 40 CFR part 63, subpart T... asphalt, cork, linoleum, no-wax, rubber, seamless vinyl, and vinyl composite flooring. Floor polish or...

  15. 5 CFR 534.202 - Coverage.

    Science.gov (United States)

    2010-01-01

    ... this program, provided that the student-employee is a registered student at an accredited academic..., or medical or dental laboratory, will receive experience or training that is required to obtain a... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PAY UNDER OTHER SYSTEMS...

  16. 12 CFR 202.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... mechanical, electronic, or clerical error that a creditor demonstrates was not intentional and occurred... enter into a binding contract); the fact that all or part of the applicant's income derives from any... association. (y) Pertinent element of creditworthiness, in relation to a judgmental system of...

  17. 28 CFR 31.202 - Civil rights.

    Science.gov (United States)

    2010-07-01

    ... Equal Employment Opportunity Program (EEOP), if required to maintain one under 28 CFR 42.301, et seq... will: (1) Require that every applicant required to formulate an EEOP in accordance with 28 CFR 42.201...,000 or more submit a copy of its EEOP (if required to maintain one under 28 CFR 42.301, et seq.)...

  18. 14 CFR 1214.202 - Reimbursement policy.

    Science.gov (United States)

    2010-01-01

    .... The user shall reimburse NASA the standard share flight price according to the reimbursement schedule... charged on a fixed price basis; there will be no post-flight charges, except for prespecified optional services. (2) The price will be based on estimated costs. (3) The price will be held constant for...

  19. 17 CFR 229.202 - (Item 202) Description of registrant's securities.

    Science.gov (United States)

    2010-04-01

    ... take action; (vi) any classification of the Board of Directors, and the impact of such classification... extraordinary corporate transaction involving the registrant (or any of its subsidiaries), such as a...

  20. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  1. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE,CERN

    OpenAIRE

    Rothe, Sebastian

    2012-01-01

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spec...

  2. Inactivation of human osteosarcoma cells in vitro by {sup 211}At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, R.H. [Univ. of Oslo (Norway)]|[Institute for Cancer Research, Oslo (Norway); Bruland, O.S. [Institute for Cancer Research, Oslo (Norway); Hoff, P.; Alstad, J. [Univ. of Oslo (Norway); Lindmo, T. [Institute for Cancer Research, Oslo (Norway); Rofstad, E.K. [Norwegian Institute of Technology, Trondheim (Norway)

    1994-08-01

    The potential usefulness of {alpha}-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) {sup 211}At-TP-3 of different specific activities, (b) {sup 211}At-labeled bovine serum albumin (BSA), (c) free {sup 211}At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, {sup 211}At-BSA or free {sup 211}At. The D{sub o}`s were lower for free {sup 211}At than for {sup 211}At-BSA. The survival curves for {sup 211}At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to {sup 211}At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to {sup 211}At-TP-3 treatment was the antigen expression. Cell inactivation after {sup 211}At-TP-3 treatment increased substantially with increasing specific activity of the {sup 211}At-TP-3. At high specific activities, the cytotoxic effect of {sup 211}At-TP-3 was significantly higher than that of {sup 211}At-BSA. In conclusion, {sup 211}At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs.

  3. 5 CFR 2640.202 - Exemptions for interests in securities.

    Science.gov (United States)

    2010-01-01

    ... relationship to Computer Inc. other than as an investor in the company and routine purchaser of Computer Inc... part of his official duties, the employee is evaluating bids for performing computer maintenance... assigned to monitor XYZ Corporation's performance of a contract to provide computer maintenance services...

  4. 37 CFR 202.3 - Registration of copyright.

    Science.gov (United States)

    2010-07-01

    ... List of CFR Sections Affected, which appears in the Finding Aids section of the printed volume and on... in the “sound track” of the motion picture or on disks, tapes, or the like included in the kit... instructions; 4 The basic application should be filed in the class appropriate to the nature of authorship...

  5. RCT: 2.02 Communication Systems, Course #33339

    Energy Technology Data Exchange (ETDEWEB)

    Hillmer, Kurt T. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-05-01

    This unit will present an overview of communication systems at LANL. Good communication skills are essential to an RCT. RCTs should develop an ability to communicate, using both verbal and nonverbal media. These skills will ensure that important information is transmitted to the proper individuals in a clear and concise manner.

  6. Preface: phys. stat. sol. (a) 202/11

    Science.gov (United States)

    Bergonzo, Philippe; Nesládek, Milo

    2005-09-01

    The present issue of physica status solidi (a) contains a collection of 31 papers presented at the 10th International Workshop on Surface and Bulk Defects in CVD Diamond Films held in Diepenbeek-Hasselt, Belgium, 23-25 February 2005. The 10th anniversary of the meeting proved the success of the concept, which originated in 1996 with the idea of bringing together scientists who are active and innovative in the field of electronic and optical properties of thin film diamond. This year the programme contained 9 invited oral talks, 14 contributed oral talks and 34 posters. 103 Participants from 14 countries (Austria, Belgium, Czech Republic, Finland, France, Germany, Japan, Mexico, Poland, Slovak Republic, Sweden, Switzerland, UK, USA) took part in the meeting. The meeting was traditionally directed towards topics ranging from defects and their characterization as well as electrical transport in CVD diamond towards modern diamond thin film devices including bio-sensing applications. Also, diamond homoepitaxial and heteroepitaxial growth, doping, hydrogen induced surface conductivity and several other topics including defects in boron nitride materials were addressed. Intense and lively discussions were as usual part of this meeting to which the hospitality of the city of Hasselt contributed greatly.The workshop would have not been possible without the support of many people and institutions. We also acknowledge the financial support of the Scientific Research Community of the F.W.O.-Vlaanderen (Belgium) and the University of Hasselt. We also thank the editorial staff of physica status solidi, most notably Stefan Hildebrandt, for their excellent and patient work. Finally, we would like to thank Ken Haenen, whose skills for the successful organization are gratefully acknowledged.August 2005

  7. 7 CFR 202.4 - Status of applicant.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT... consideration, the Secretary or the Administrator, may upon petition in writing and upon good cause...

  8. 30 CFR 202.150 - Royalty on gas.

    Science.gov (United States)

    2010-07-01

    ... Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT ROYALTIES... in value, the royalty due shall be the value, for royalty purposes, determined pursuant to 30 CFR... wasted from an OCS lease, then the value of that gas shall be determined in accordance with 30 CFR...

  9. 50 CFR 217.202 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... leucas), harbor seals (Phoca vitulina), harbor porpoises (Phocoena phocoena), and killer whales (Orcinus orca). (c) The taking by injury or death of the species listed in paragraph (b) of this section or...

  10. 37 CFR 202.10 - Pictorial, graphic, and sculptural works.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Pictorial, graphic, and... Pictorial, graphic, and sculptural works. (a) In order to be acceptable as a pictorial, graphic, or... utility or design patent will not affect the registrability of a claim in an original work of...

  11. Dicty_cDB: SLI202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s chromosome 4 clone C0478G20 map 4p16... 46 2.0 1 ( FK254362 ) USDA-FP_190325 Asian citrus psyllid midgut (...KE EE Frame C: mlmslkklkfvckkylfkylnhlmnilhlhqmiqmkniqlilscqhlkm*lkelllntfk nkkknnnnnkkkk--- ---rkrprrrrrrkrscc*kk*llllkklkkkklll...lmpklkrcnkkwvmnlktmmtkkkk kkkkqlqlllnqkllihshllkknlkkkkkrklklkyqf*kkkkkkkkkkkkkkkkkkkk k Homology vs CSM-cDN...EEEKE EE Translated Amino Acid sequence (All Frames) Frame A: qc*cr*rs*slyaksicss...knqslllkklkkknqhqqlknqls lnhklslihsllkmmkmmttmktimmismkkilki

  12. 48 CFR 334.202 - Integrated Baseline Reviews (IBRs).

    Science.gov (United States)

    2010-10-01

    ... Integrated Baseline Reviews (IBRs). (a) An IBR normally should be conducted as a post-award activity. A pre-award IBR may be conducted only if— (1) The AP contains documentation that demonstrates the need and rationale for a pre-award IBR, including an assessment of the impact on the source selection schedule...

  13. 48 CFR 34.202 - Integrated Baseline Reviews.

    Science.gov (United States)

    2010-10-01

    ... Review (IBR). (b) The purpose of the IBR is to verify the technical content and the realism of the..., and it should formulate a plan to handle these risks. (c) The IBR is a joint assessment by the offeror... planning and baseline control. (d) The timing and conduct of the IBR shall be in accordance with...

  14. 17 CFR 202.3a - Instructions for filing fees.

    Science.gov (United States)

    2010-04-01

    ... Commission's Web site at http://www.sec.gov for the proper format. (2) Instructions for payment of fees by... through other common carriers: U.S. Bank, Government Lockbox 979081, 1005 Convention Plaza, SL-MO-C2-GL... paragraph (e). A company must update its account and other addresses using the EDGAR Web site. This...

  15. Dicty_cDB: VSK202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 34 7.3 CP000879_1573( CP000879 |pid:none) Petrotoga mobilis SJ95, complet... 34 9.6 CP001140_401( ...skvdslcfelsdkkgisksvkyfpikklt e*fn*iklfyl*ikiln Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bit...iks*ywfkyik*iici nwii**ii*irii*fsrs*sip*gr*tssyslgrw*r**cks--- ---cq**tsst*ssfitk*ity*nlhxmmtnkncnhhssil...logy vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116982 |AC116982.2 Dictyosteli...6 AE017243_622( AE017243 |pid:none) Mycoplasma hyopneumoniae J, comp... 36 2.5 AE017143_988( AE017143 |pid:none) Haemophil

  16. 5 CFR 2638.202 - Responsibilities of agency head.

    Science.gov (United States)

    2010-01-01

    ... individual to serve in an acting capacity in the absence of the primary designated agency ethics official... and implementing agency ethics programs; (6) Administer a system for periodic evaluation of the ethics... and shall exercise personal leadership in establishing, maintaining, and carrying out the...

  17. 21 CFR 202.1 - Prescription-drug advertisements.

    Science.gov (United States)

    2010-04-01

    ...) * * * (ii) Represents or suggests that a prescription drug is safer or more effective than another drug in some particular when the difference has not been demonstrated by substantial evidence. An advertisement... data or reference to published reports, represent that the drug is safer or more effective than...

  18. 43 CFR 20.202 - Ethics program responsibilities.

    Science.gov (United States)

    2010-10-01

    ... and manage the department's ethics program in accordance with 5 CFR 2638.203. (b) Each Ethics... forth in 5 CFR 2635; all supervisors are expected, therefore, to be familiar with those standards. In addition, any supervisor who grants prior approval of an employee's outside employment under 5 CFR...

  19. 24 CFR 3285.202 - Soil classifications and bearing capacity.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Soil classifications and bearing... Soil classifications and bearing capacity. The soil classification and bearing capacity of the soil must be determined before the foundation is constructed and anchored. The soil classification...

  20. 5 CFR 2610.202 - Net worth exhibit.

    Science.gov (United States)

    2010-01-01

    ... with its application a detailed exhibit showing the net worth of the applicant and any affiliates (as... portion of the exhibit and believes there are legal grounds for withholding it from disclosure may submit... served on counsel representing the Office, but need not be served on any other party to the...

  1. 42 CFR 400.202 - Definitions specific to Medicare.

    Science.gov (United States)

    2010-10-01

    ... perform other related functions. Critical access hospital (CAH) means a facility designated by HFCA as... this chapter. Provider means a hospital, a CAH, a skilled nursing facility, a comprehensive outpatient... Retirement Act of 1974 (45 U.S.C. beginning at section 231). Services means medical care or services...

  2. 20 CFR 718.202 - Determining the existence of pneumoconiosis.

    Science.gov (United States)

    2010-04-01

    ... examination given on behalf of or by the Appalachian Laboratory for Occupational Safety and Health. See 42 CFR... FEDERAL COAL MINE HEALTH AND SAFETY ACT OF 1969, AS AMENDED STANDARDS FOR DETERMINING COAL MINERS' TOTAL... radiologist's interpretation of a chest X-ray shall be accepted by the Office if the X-ray is in...

  3. 12 CFR 202.16 - Enforcement, penalties and liabilities.

    Science.gov (United States)

    2010-01-01

    ... imposed by the Act or this regulation is subject to civil liability for actual and punitive damages in... the Act or this regulation also constitute violations of other federal laws. Liability for punitive... may be appropriate, including actual and punitive damages and injunctive relief. (5) If the Board,...

  4. 12 CFR 202.5 - Rules concerning requests for information.

    Science.gov (United States)

    2010-01-01

    ... paragraph does not limit or abrogate any Federal or State law regarding privacy, privileged information... or a similar state official) to monitor or enforce compliance with the Act, this regulation, or...

  5. 46 CFR 116.202 - Plans and information required.

    Science.gov (United States)

    2010-10-01

    ... capacity of storage batteries; (viii) Rating of circuit breakers and switches, interrupting capacity of circuit breakers, and rating and setting of overcurrent devices; (ix) Electrical plant load analysis; and... cables, bus-tie cables, feeders, and branch circuit cables; (vi) Power, lighting, and...

  6. 12 CFR 202.1 - Authority, scope and purpose.

    Science.gov (United States)

    2010-01-01

    ... credit to all creditworthy applicants without regard to race, color, religion, national origin, sex... requires creditors to notify applicants of action taken on their applications; to report credit history...

  7. 12 CFR Appendix C to Part 202 - Sample Notification Forms

    Science.gov (United States)

    2010-01-01

    ..., religion, national origin, sex, marital status, age (provided the applicant has the capacity to enter into...: ___ is not of sufficient length to qualify. ___ could not be verified. Your Credit History: ___ of making... applicants on the basis of race, color, religion, national origin, sex, marital status, age (provided...

  8. Process considerations additional product concentration facilities in 202-S

    Energy Technology Data Exchange (ETDEWEB)

    Tomlinson, R.E.

    1951-10-29

    This memorandum discusses investigations concerning the coupling step required to adapt a Redox IIBP to a 234-5 feed which have indicated that a single peroxide strike from a solution 50--60 g./1. in product and about 2 M in nitric acid is adequate. Additional work is planned to demonstrate both peroxide and Pu(IV) oxalate strikes under these conditions. The present Redox PR cage product contains 10 g./1. in product and over 500 g./1. in nitric acid, and probably requires tow peroxide strikes; in addition, the operating capacity of the PR cage may be inadequate to process the throughputs desired in the Redox plant. A two stage continuous concentration process for Redox IIBP is jointly suggested by Design and Development and Chemical Development personnel, and is described in this document. This process is believed to be simple and easily operable. Acid is removed from the product solution adequately for the single peroxide strike coupling procedure. Batch size appears to be easily controllable.

  9. 12 CFR Supplement I to Part 202 - Official Staff Interpretations

    Science.gov (United States)

    2010-01-01

    ...). 4. Consideration of age in a reverse mortgage. A reverse mortgage is a home-secured loan in which... exercises its contractual right to accelerate the mortgage loan, the mortgagee may treat the mortgagor as... application to the creditor to assume the mortgage loan, the mortgagee must treat the buyer as an...

  10. 18 CFR 706.202 - Gifts, entertainment, and favors.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Gifts, entertainment..., entertainment, and favors. (a) Except as provided in paragraphs (b) and (c) of this section, an employee shall not solicit or accept, directly or indirectly, any gift, gratuity, favor, entertainment, loan, or...

  11. Preface: phys. stat. sol. (a) 202/12

    Science.gov (United States)

    Neumann, Wolfgang; Stutzmann, Martin; Hildebrandt, Stefan

    2005-09-01

    The present special issue contains a collection of Original Papers dedicated to Professor Johannes Heydenreich on the occasion of his 75th birthday.Johannes Heydenreich, born on 20 June 1930 in Plauen/Vogtland near Dresden, studied physics at the Pädagogische Hochschule Potsdam, where he obtained his first academic degree Dipl. Phys. in 1958. He received his doctoral degree at the Martin Luther University in Halle in 1961 and the Habilitation degree in 1969. Already during his studies in Potsdam, he showed an interest in electron microscopy due to the influence of his teacher and supervisor Prof. Picht, one of the pioneers in electron optics. His interests were strengthened when Johannes Heydenreich did the experimental work for his Diploma degree at the Institute for Experimental Physics of the University of Halle, where he met Prof. Heinz Bethge for the first time. This was the beginning of a fruitful and longstanding collaboration. In 1962 Johannes Heydenreich joined the team of the later Institute for Solid State Physics and Electron Microscopy of the Academy of Sciences of the GDR, in Halle, for which the basis was laid by Prof. Bethge in 1960.Heydenreich has been working as Assistant Director for many years and played a decisive role in introducing and organising the various techniques of electron microscopy in the institute.The research activities of Prof. Heydenreich covered a broad spectrum over the years. At the beginning of his career he made significant contributions in the field of electron mirror microscopy. After that, his main interests were focused on transmission electron microscopy, ranging from diffraction contrast analysis of crystal defects to high-resolution electron microscopy and image processing. His favourite field was studies of defect-induced phenomena in advanced materials. The so-called Bethge-Heydenreich, the book Electron Microscopy in Solid State Physics, published at first in a German edition in 1982 and later in a revised English edition by Elsevier in 1987, provides an excellent overview both of Heydenreich's work and of the spectrum of the Institute of Solid State Physics and Electron Micros-copy in Halle.The international reputation of this institute was the basis for the transformation of it, after the re-unification of Germany, into the Max Planck Institute of Microstructure Physics, the first institute of the Max Planck Society in the Eastern part of Germany. From the beginning, Prof. Heydenreich was on the Board of Directors and served as the Executive Director from 1993 until his retirement in 1995.During this year, the International Centre of Advanced Materials and Electron Microscopy celebrates its 30th anniversary. The Centre was founded in Halle in 1975 as a Centre of Electron Microscopy for the Eastern countries.A remarkable and time-consuming part of Heydenreich's work was associated with this centre. Young scientists from Eastern Europe were trained in the theoretical and practical aspects of electron microscopy during the annual spring and autumn meetings. All in all, Johannes Heydenreich conducted 35 of these schools! From the beginning, he was a member of the Scientific Council of the Centre, and from 1985 until his retirement he was the Director of the Centre. Nowadays, the Centre acts as a real bridge between East and West largely due to the efforts of Johannes Heydenreich.Furthermore, Johannes Heydenreich had been active as a leading member of various scientific boards for many years. He was a co-editor of several journals covering electron microscopy, solid state physics and crystallography. As a member of the Executive Committee of the European Society for Elec-tron Microscopy (CESEM) for many years, and as a member of the Executive board of the German Soci-ety for Electron Microscopy, Johannes Heydenreich has invested a great deal of time and effort in the welfare of the scientific community.Over the course of nearly three decades, Johannes Heydenreich worked as a Professor at the Universities of Halle and Leipzig. Generations of students have admired his excellent lectures with clear repre-sentation and rigorous scholarship.The scientific work of Johannes Heydenreich was honoured by his election to the Academy of Natural Scientists Leopoldina where he worked as a Secretary of Natural Science for many years. The Technical University of Chemnitz conferred an honory doctors degree on Prof. Heydenreich in recognition of his scientific work. The German Society for Electron Microscopy awarded him Honorary Membership.Wolfgang Neumann especially acknowledges with gratitude the time of inspiring collaboration in Halle.All his friends, colleagues, and students wish him many further years of good health. The Editors of physica status solidi join these wishes and add their gratefulness for his long-standing and continuous engagement as a member of the Advisory and Editorial Board of physica status solidi (a).

  12. 5 CFR 1201.202 - Authority for awards.

    Science.gov (United States)

    2010-01-01

    ... respondent is the prevailing party in an appeal under 5 U.S.C. 7701, a request to review an arbitration... appeal under 5 U.S.C. 3330a, a request to review an arbitration decision under 5 U.S.C. 7121(d), a... the case. The final decision in the proceeding on the merits may be an initial decision of a...

  13. Dicty_cDB: CHP202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available culus chromosome 7, clone RP23-311N3, complete sequence. 42 0.18 5 BQ507132 |BQ507132.2 EST614547 Generation...A clone cSTS16L8 5' sequence, mRNA sequence. 42 0.33 2 BQ507131 |BQ507131.1 EST614546 Generation of a set of

  14. 40 CFR 246.202-6 - Recommended procedures: Cost analysis.

    Science.gov (United States)

    2010-07-01

    ...) SOLID WASTES SOURCE SEPARATION FOR MATERIALS RECOVERY GUIDELINES Requirements and Recommended Procedures... Residential, Commercial and Institutional Solid Wastes (40 CFR part 243) and Thermal Processing and Land... residual solid waste have been established, an analysis should be conducted which compares the costs of...

  15. 37 CFR 202.16 - Preregistration of copyrights.

    Science.gov (United States)

    2010-07-01

    ..., motion picture, or other information relating to any sound recordings or motion pictures that are being... within one of the following classes of works: (i) Motion pictures; (ii) Sound recordings; (iii) Musical... motion pictures, such a description should include the following information to the extent known at...

  16. ALARA review for the 202-S plutonium loadout hood stabilization

    International Nuclear Information System (INIS)

    This as low as reasonably achievable (ALARA) review provides a description of the engineering and administrative controls used to manage personnel exposures, control contamination levels, and control airborne radioactivity concentrations while conducting stabilization of the Reduction-Oxidation (REDOX) Facility plutonium loadout hood and associated piping, and the isolation of the ER-8 ventilation system

  17. 47 CFR 202.3 - Plans preparation and execution.

    Science.gov (United States)

    2010-10-01

    ... responsibilities assigned by Executive Order 12333, December 4, 1981 (46 FR 59941; 3 CFR, 1981 Comp., p. 200). (ii..., plans and procedures adequate to enable a transfer of control over radio stations in the Aviation... concerning ongoing or prospective national security and emergency preparedness telecommunications programs...

  18. 48 CFR 832.202-4 - Security for Government financing.

    Science.gov (United States)

    2010-10-01

    ... exposure to financial crisis, and credit arrangements. (d) A statement of the status of all State, local... for Government financing. An offeror's financial condition may be considered adequate security to... offeror's financial condition, the contracting officer may obtain, to the extent required, the...

  19. 30 CFR 202.351 - Royalties on geothermal resources.

    Science.gov (United States)

    2010-07-01

    ..., suspends, or reduces that rate(s). Royalties are determined under 30 CFR part 206, subpart H. (2) Fees in lieu of royalties on geothermal resources are prescribed in 30 CFR part 206, subpart H. (3) Except for...,” and “Class III lease” have the same meanings prescribed in 30 CFR 206.351. (i) For Class I leases,...

  20. 48 CFR 26.202 - Local area preference.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Local area preference. 26... preference. When awarding emergency response contracts during the term of a major disaster or emergency... Relief and Emergency Assistance Act (42 U.S.C.5121, et seq.), preference shall be given, to the...

  1. 10 CFR 800.202 - Loan terms and conditions.

    Science.gov (United States)

    2010-01-01

    ... specified amounts of working capital (including amounts derived from Federal financial assistance) and maintain specified financial ratios, where in the Secretary's judgment satisfaction of such...

  2. 7 CFR 1219.202 - Exemption for organic Hass avocados.

    Science.gov (United States)

    2010-01-01

    ... avocados. (a) A producer who operates under an approved National Organic Program (NOP) (7 CFR part 205... the NOP (7 CFR part 205) and who is not a split operation shall be exempt from the payment of... CFR 205.201, but not sold, labeled, or represented as organic, shall not disqualify a producer...

  3. Dicty_cDB: SFJ202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FIFIIQILNSYFIFLYIVTFHKKKKKKKKFKXSPFXKKK--- ---PSPVRLYTGSEGSATMGM*tkdsr*rrfppdxqrlislvtnxkkxrtlsdyniqkes plplgpqn*evvckslskpltgktitle...vegsdnienvktkiqdkegippdqqrlifagk qledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitle...vegsdnienvkakiqd kegippdqqrlifagkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitle vegsdnienv...- ---PSPVRLYTGSEGSATMGM*tkdsr*rrfppdxqrlislvtnxkkxrtlsdyniqkes plplgpqn*evvckslskpltgktitle...vegsdnienvktkiqdkegippdqqrlifagk qledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitlevegsdnienvkakiqd kegi

  4. 49 CFR 571.202a - Standard No. 202a; Head restraints; Mandatory applicability begins on September 1, 2009.

    Science.gov (United States)

    2010-10-01

    ...) Establish initial reference position by applying a vertical downward load of 50 ± 1 N at the rate of 250... by reference of this material in accordance with 5 U.S.C. 552(a) and 1 CFR part 51. A copy of SAE.... 552(a) and 1 CFR part 51. A copy of SAE J826 (rev. Jul 95) may be obtained from SAE at the Society...

  5. 15 CFR 270.202 - Coordination with search and rescue efforts.

    Science.gov (United States)

    2010-01-01

    ... efforts being undertaken at the site of the building failure, including FEMA urban search and rescue teams, local emergency management agencies, and local emergency response groups. Upon arrival at a...

  6. 40 CFR 161.202 - Purposes of the registration data requirements.

    Science.gov (United States)

    2010-07-01

    ... studies. Determination of acute oral, dermal and inhalation toxicity is usually the initial step in the... expression (e.g., carcinogenicity). (3) Chronic studies. Chronic toxicity (usually conducted by feeding...

  7. 7 CFR 1710.202 - Requirement to prepare a load forecast-power supply borrowers.

    Science.gov (United States)

    2010-01-01

    ... and provide an approved load forecast in support of any request for RUS financial assistance. The... provide an approved load forecast in support of any request for RUS financial assistance. The member power... 7 Agriculture 11 2010-01-01 2010-01-01 false Requirement to prepare a load forecast-power...

  8. 48 CFR 46.202-4 - Higher-level contract quality requirements.

    Science.gov (United States)

    2010-10-01

    .... Examples of higher-level quality standards are ISO 9001, 9002, or 9003; ANSI/ISO/ASQ Q9001-2000; ANSI/ASQC... quality requirements. (a) Requiring compliance with higher-level quality standards is appropriate in... personnel, finds it is in the Government's interest to require that higher-level quality standards...

  9. FEW PRACTICAL ASPECTS AND PROBLEMS REGARDING LAW NR. 202/2010

    Directory of Open Access Journals (Sweden)

    ALEXANDRA CRISTINA JIPA

    2011-04-01

    Full Text Available We have analyzed the impact the introduction of art. 74¹ penal C. over a certain category of infractions, respectively over the economical nature infractions. Harmonization of such recent norms with the already existent legislative framework rises a series of questions and possible practical problems. Also, we have considered interesting to appreciate if such changes are sufficient or there is not a conflict between the punishments set forth by regulators for each of such infractions. Should the answer be yes, there should be considered the possible conciliation methods.

  10. AB202. Altered micro RNA expression in patients with non-obstructive azoospermia

    OpenAIRE

    Zhang, Xiansheng; Liang, Chaozhao

    2014-01-01

    Background MicroRNAs (miRNAs), a class of small non-coding RNA molecules, are indicated to play essential roles in spermatogenesis. However, little is known about the expression patterns or function of miRNAs in human testes involved in infertility. Methods In this study, the miRNA expression profiles of testes of patients with non-obstructive azoospermia (NOA) and normal controls were performed by using microarray technologies. Results Altered microRNA expression in NOA patients was found, w...

  11. 7 CFR 1205.202 - Agencies through which a referendum shall be conducted.

    Science.gov (United States)

    2010-01-01

    ...) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF...) Agricultural Marketing Service. The Administrator shall: (1) Determine the referendum period. (2) Give... be used in the referendum to FSA. The ballots: (i) shall provide for recording essential...

  12. Production equipment for radiochemical separation of 202Tl from metallic thallium proton irradiated target

    International Nuclear Information System (INIS)

    Thallium-201 finds widely application in nuclear medicine cardio diagnostics and myocardial imaging. The production device is proposed for production of thallium radiopharmaceutical - 201TlCl by quantitative separation of thallium-201 from thallium target and lead (carrier and the contaminants- 200Pb and 203Pb). The proposed equipment is created, designed and constructed in the Radiochemical laboratory of the Institute for Nuclear Research and Nuclear Energy for experimenting and production of TI pharmaceuticals with defined physical-chemical and biological characteristics. The production equipment is supplied with all necessary technical devices, reaction vessels and communications for the chemical processes, ensuring radiochemical and radioisotope purity of thallium pharmaceuticals at preliminary set technological conditions and parameters. The technological schemes allow the production to be done in inert atmosphere in gas flow (argon or nitrogen) and ensures hermetic work in a specially designed for the purpose radiation protected box. The equipment ensures high reliability, high radiochemical yield, high purity, non-pyrogenity and sterility of 201Tl radiopharmaceuticals for medical diagnostics

  13. CALIPSO Lidar L2 1 km Cloud Layer Data V2-02

    Data.gov (United States)

    National Aeronautics and Space Administration — Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observations (CALIPSO) was launched on April 28, 2006 to study the impact of clouds and aerosols on the...

  14. CALIPSO Lidar L2 5 km Cloud Profile Data V2-02

    Data.gov (United States)

    National Aeronautics and Space Administration — Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observations (CALIPSO) was launched on April 28, 2006 to study the impact of clouds and aerosols on the...

  15. CALIPSO Lidar L2 Vertical Feature Mask Data V2-02

    Data.gov (United States)

    National Aeronautics and Space Administration — Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observations (CALIPSO) was launched on April 28, 2006 to study the impact of clouds and aerosols on the...

  16. CALIPSO Lidar L2 5 km Cloud Layer Data V2-02

    Data.gov (United States)

    National Aeronautics and Space Administration — Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observations (CALIPSO) was launched on April 28, 2006 to study the impact of clouds and aerosols on the...

  17. CALIPSO Lidar L2 Aerosol Layer Data V2-02

    Data.gov (United States)

    National Aeronautics and Space Administration — Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observations (CALIPSO) was launched on April 28, 2006 to study the impact of clouds and aerosols on the...

  18. 77 FR 202 - Federal Acquisition Regulation; Updated Financial Accounting Standards Board Accounting References

    Science.gov (United States)

    2012-01-03

    ... 9000-AM00 Federal Acquisition Regulation; Updated Financial Accounting Standards Board Accounting... accounting standards owing to the Financial Accounting Standards Board's Accounting Standards Codification of..., and NASA published a proposed rule in the Federal Register at 76 FR 8989 on February 16, 2011,...

  19. 34 CFR 682.202 - Permissible charges by lenders to borrowers.

    Science.gov (United States)

    2010-07-01

    ... percent. (x) For a subsidized Stafford loan made to an undergraduate student for which the first..., and notwithstanding any provisions of State law, the lender may require that the borrower or any... preparing letters or notices or with making personal contacts with the borrower (e.g., local and...

  20. 5 CFR 412.202 - Systematic training and development of supervisors, managers, and executives.

    Science.gov (United States)

    2010-01-01

    ... and implement leadership development programs integrated with the employee development plans, programs, and strategies required by 5 CFR 410.201, and that foster a broad agency and Governmentwide... MANAGEMENT CIVIL SERVICE REGULATIONS SUPERVISORY, MANAGEMENT, AND EXECUTIVE DEVELOPMENT Succession...

  1. 17 CFR 202.12 - Policy statement concerning cooperation by individuals in its investigations and related...

    Science.gov (United States)

    2010-04-01

    ..., in the case of a violation involving a business organization, by notifying members of management not..., or the auditors of such business organization of the misconduct; (4) The efforts undertaken by the... nor are they intended to be all-inclusive or to require a specific determination in any...

  2. 7 CFR 1744.202 - Borrowers may make qualified investments without prior approval of the Administrator.

    Science.gov (United States)

    2010-01-01

    ... solid waste management systems, credit availability, and accessibility to and delivery of private and... training and employment services, health care services, educational opportunities, energy utilization...

  3. 20 CFR 202.12 - Evidence of termination of employer status.

    Science.gov (United States)

    2010-04-01

    ... determining whether a cessation of an essential characteristic, such as control or service in connection with... cessation of an essential employer characteristic occurs. The following indicate but do not delimit the type... cessation of operations; termination of contract; discharge of last employee; date upon which the right of...

  4. 24 CFR 30.45 - Multifamily and section 202 or 811 mortgagors.

    Science.gov (United States)

    2010-04-01

    ... interest (e.g., a 25% or more limited partner, 10% or more stockholder) in the ownership entity of the... limited liability company that is the mortgagor of such property or is the general partner of a limited... interest agent. An entity: (i) That has management responsibility for a project; (ii) In which...

  5. 37 CFR 202.19 - Deposit of published copies or phonorecords for the Library of Congress.

    Science.gov (United States)

    2010-07-01

    ..., packaging material, or any useful article. Globes, relief models, and similar cartographic representations... author is the owner of copyright in a published pictorial or graphic work and (A) less than five...

  6. 47 CFR 54.202 - Additional requirements for Commission designation of eligible telecommunications carriers.

    Science.gov (United States)

    2010-10-01

    ... service area. Each applicant shall demonstrate how signal quality, coverage or capacity will improve due... Internet Association's Consumer Code for Wireless Service will satisfy this requirement. Other commitments... COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES (CONTINUED) UNIVERSAL SERVICE Carriers Eligible...

  7. CALIPSO Lidar L1B Profile Data V2-02

    Data.gov (United States)

    National Aeronautics and Space Administration — Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observations (CALIPSO) was launched on April 28, 2006 to study the impact of clouds and aerosols on the...

  8. CALIPSO Imaging Infrared Radiometer L2 Data Track V2-02

    Data.gov (United States)

    National Aeronautics and Space Administration — Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observations (CALIPSO) was launched on April 28, 2006 to study the impact of clouds and aerosols on the...

  9. CALIPSO Lidar L2 1/3 km Cloud Layer Data V2-02

    Data.gov (United States)

    National Aeronautics and Space Administration — Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observations (CALIPSO) was launched on April 28, 2006 to study the impact of clouds and aerosols on the...

  10. CALIPSO Imaging Infrared Radiometer L2 Data Swath V2-02

    Data.gov (United States)

    National Aeronautics and Space Administration — Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observations (CALIPSO) was launched on April 28, 2006 to study the impact of clouds and aerosols on the...

  11. 37 CFR 202.20 - Deposit of copies and phonorecords for copyright registration.

    Science.gov (United States)

    2010-07-01

    ... and parts, a conductor's score is a “complete” copy; (vii) Motion pictures. In the case of a published... be considered as unpublished motion pictures: motion pictures that consist of television transmission... published only as embodied in motion pictures; (J) Published works in the form of two-dimensional...

  12. 19 CFR 202.5 - Type of information to be developed at hearing.

    Science.gov (United States)

    2010-04-01

    ... similarity between grades, classes, and price groups of the American product and the imported article. (c... equity, and transportation to markets. For the foreign product the expenses (other than duties) incident to importation are also important. Any information which may be available bearing on the...

  13. 7 CFR 59.202 - Mandatory daily reporting for barrows and gilts.

    Science.gov (United States)

    2010-01-01

    ... MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946 AND THE EGG PRODUCTS INSPECTION ACT... unavailable due to pricing that is determined on a delayed basis. The packer shall report information on...

  14. 50 CFR 226.202 - Critical habitat for Stellar sea lions.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Critical habitat for Stellar sea lions... Critical habitat for Stellar sea lions. Steller Sea Lion (Eumetopias jubatus) (a) Alaska rookeries, haulouts, and associated areas. In Alaska, all major Steller sea lion rookeries identified in Table 1...

  15. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (202-0612-272217)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  16. 7 CFR 1786.202 - Prepayment and refinancing of RUS guaranteed FFB loans.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 12 2010-01-01 2010-01-01 false Prepayment and refinancing of RUS guaranteed FFB...) RURAL UTILITIES SERVICE, DEPARTMENT OF AGRICULTURE (CONTINUED) PREPAYMENT OF RUS GUARANTEED AND INSURED LOANS TO ELECTRIC AND TELEPHONE BORROWERS Refinancing and Prepayment of RUS Guaranteed FFB...

  17. 48 CFR 26.202-1 - Local area set-aside.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Local area set-aside. 26... area set-aside. The contracting officer may set aside solicitations to allow only local firms within a... requirements office, shall define the specific geographic area for the local set-aside. (b) A major disaster...

  18. 45 CFR 1703.202 - Provisions under which a meeting may be closed.

    Science.gov (United States)

    2010-10-01

    ... arbitration, or the initiation, conduct, or disposition by the agency of a particular case of formal agency... unwarranted invasion of personal privacy; (7) Disclose investigatory records compiled for law enforcement... invasion of personal privacy, (iv) Disclose the identity of a confidential source and, in the case of...

  19. 10 CFR 611.202 - Advanced Technology Vehicle Manufacturing Facility Award Program.

    Science.gov (United States)

    2010-01-01

    ... Vehicle Manufacturing Facility Award Program. DOE may issue, under the Advanced Technology Vehicle Manufacturing Facility Award Program, 10 CFR part 611, subpart C, awards for eligible projects. ... 10 Energy 4 2010-01-01 2010-01-01 false Advanced Technology Vehicle Manufacturing Facility...

  20. 31 CFR 541.202 - Effect of transfers violating the provisions of this part.

    Science.gov (United States)

    2010-07-01

    ... for the provisions of the International Emergency Economic Powers Act (50 U.S.C. 1701 et seq.), this...) Except to the extent otherwise provided by law or unless licensed pursuant to this part, any...

  1. 31 CFR 542.202 - Effect of transfers violating the provisions of this part.

    Science.gov (United States)

    2010-07-01

    ... the same extent that it would be valid or enforceable but for the provisions of the International Emergency Economic Powers Act, this part, and any regulation, order, directive, ruling, instruction, or... law or unless licensed pursuant to this part, any attachment, judgment, decree, lien,...

  2. 31 CFR 594.202 - Effect of transfers violating the provisions of this part.

    Science.gov (United States)

    2010-07-01

    ... for the provisions of the International Emergency Economic Powers Act, this part, and any regulation... extent otherwise provided by law or unless licensed pursuant to this part, any attachment,...

  3. Men’s Suits Retail Sales in Top 22 BJ Department Stores Worth CNY202 million

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    The retail sales data of Beijing department stores is based on the sales receipts of more than 20 Beijing department stores each month, the following is an analysis of the sales performance of men’s suits and stores by price range.

  4. Shelf-Life of ɛ-Lysyl-3-(Trimethylstannyl)Benzamide Immunoconjugates, Precursors for 211At Labeling of Antibodies

    OpenAIRE

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per; Jensen, Holger; Holgersson, Stellan; Lindegren, Sture

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity and the complex radiochemistry of 211At are major obstacles for research and prospective clinical applications. In the present study, astatination of immunoconjugates, already prepared well in advance...

  5. Hanford Tanks 241-C-202 and 241-C-203 Residual Waste Contaminant Release Models and Supporting Data

    Energy Technology Data Exchange (ETDEWEB)

    Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Mattigod, Shas V.; Schaef, Herbert T.; Arey, Bruce W.

    2007-09-13

    As directed by Congress, the U. S. Department of Energy (DOE) established the Office of River Protection in 1998 to manage DOE's largest, most complex environmental cleanup project – retrieval of radioactive waste from Hanford tanks for treatment and eventual disposal. Sixty percent by volume of the nation's high-level radioactive waste is stored at Hanford in aging deteriorating tanks. If not cleaned up, this waste is a threat to the Columbia River and the Pacific Northwest. CH2M Hill Hanford Group, Inc., is the Office of River Protection's prime contractor responsible for the storage, retrieval, and disposal of Hanford's tank waste. As part of this effort, CH2M HILL Hanford Group, Inc. contracted with Pacific Northwest National Laboratory (PNNL) to develop release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for DOE.

  6. AB202. Transumbilical single incision for laparoendoscopic bilateral renal cyst decortication using a homemade glove port device

    Science.gov (United States)

    Li, Gang; Quan, Changyi; Niu, Yuanjie

    2016-01-01

    Objective Transumbilical single incision surgery (TSIS) has recently gained popularity for symptomatic renal cysts. We evaluated the clinical utility and safety of homemade glove port device in bilateral renal cyst decortication patients at our institution. Methods We reviewed our series of 42 bilateral symptomatic renal cyst (range, 4–12 cm) decortication performed from November 2010 to December 2013. A homemade port device consisted of two control loops and a glove to form three channels was placed through the umbilical single incision. A homemade single port device was made by fixing a size 7 1/2 surgical glove to the retractor outer ring and securing the glove fingers to the end of three trocars with a tie. The homemade port was inserted at the umbilical incision, operation was performed by using a special flexible 30-degree laparoscope and conventional laparoscopic instruments. Results All cases were completed successfully, without conversion to a standard laparoscopic or open approach. The average operative time was 75 min and the estimated blood loss was less than 30 mL, no intraoperative complication occurred. The mean hospital stay was 2.8 d lap[2–5] days, with a median follow-up of 20 months (range, 8–32) there was no recurrence. Conclusions Our homemade single port device is cost-effective and more flexible to deal with bilateral renal cysts especially ventral lesions than the current multichannel port or traditional laparoscopic surgery.

  7. Ann Crabbé and Pieter Leroy, 2008, The Handbook of Environmental Policy Evaluation, Earthscan, London, 202 p.

    Directory of Open Access Journals (Sweden)

    François Destandau

    2010-09-01

    Full Text Available Ann Crabbé de l’Université d’Anvers (Belgique et Pieter Leroy de l’Université de Nijmegen (Pays-Bas proposent ici un ouvrage pionnier sur l’évaluation appliquée aux politiques environnementales. Ce manuel s’inspire des enseignements théoriques et méthodologiques des sciences politiques et sociales. Les auteurs y présentent un panel de méthodes adaptées aux politiques environnementales, de façon pratique et accessible. « Peut-on identifier une relation de causalité entre l’intervention polit...

  8. Hanford Tanks 241-C-202 and 241-C-203 Residual Waste Contaminant Release Models and Supporting Data

    International Nuclear Information System (INIS)

    As directed by Congress, the U. S. Department of Energy (DOE) established the Office of River Protection in 1998 to manage DOE's largest, most complex environmental cleanup project retrieval of radioactive waste from Hanford tanks for treatment and eventual disposal. Sixty percent by volume of the nation's high-level radioactive waste is stored at Hanford in aging deteriorating tanks. If not cleaned up, this waste is a threat to the Columbia River and the Pacific Northwest. CH2M Hill Hanford Group, Inc., is the Office of River Protection's prime contractor responsible for the storage, retrieval, and disposal of Hanford's tank waste. As part of this effort, CH2M HILL Hanford Group, Inc. contracted with Pacific Northwest National Laboratory PNNL to develop release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for DOE.

  9. 40 CFR 33.202 - How does an entity qualify as an MBE or WBE under EPA's 8% statute?

    Science.gov (United States)

    2010-07-01

    ... CFR 124.105 and 13 CFR 124.106, respectively. (See also 13 CFR 124.109 for special rules applicable to Indian tribes and Alaska Native Corporations; 13 CFR 124.110 for special rules applicable to Native... person who has been subjected to racial or ethnic prejudice or cultural bias because of his or...

  10. ALSC cutter. Period covered: January--March 1976. Normal process development endeavor No. 202. [Aluminum sheath linear shaped charge (ALSC)

    Energy Technology Data Exchange (ETDEWEB)

    Schmitz, G.T.

    1976-01-01

    Aluminum sheath linear shaped charge (ALSC) containing HNS-II core explosive was specified as the explosive component in the MC 3125 design. Technology and tooling for cutting and forming ALSC, HNS II, 5.3 g/m core load, are described as preliminary developments to the manufacturing process.

  11. 75 FR 4477 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, -243, -301, -302, -303, -321...

    Science.gov (United States)

    2010-01-28

    ..., 2009 (74 FR 45781). That NPRM proposed to correct an unsafe condition for the specified products. The... Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic impact, positive or...], the bogie stop pad was found deformed and cracked. Upon removal of the bogie stop pad for...

  12. 78 FR 39003 - 60-Day Notice of Proposed Information Collection: Section 202 Supportive Housing for the Elderly...

    Science.gov (United States)

    2013-06-28

    ... the Elderly Application Submission Requirements AGENCY: Multifamily Housing Program, Office of Housing... Supportive Housing for the Elderly Application Submission Requirements. OMB Approval Number: 2502-0267. Type... Department to assist HUD in determining applicant eligibility and ability to develop housing for the...

  13. 34 CFR 403.202 - What must each State's system of core standards and measures of performance include?

    Science.gov (United States)

    2010-07-01

    ... academic skills; (2) One or more measures of the following: (i) Student competency attainment. (ii) Job or... necessary to obtain employment in the field for which the student has been prepared, including occupational..., or employment; (3) Incentives or adjustments that are— (i) Designed to encourage service to...

  14. CALiPER Report 20.2: Dimming, Flicker, and Power Quality Characteristics of LED PAR38 Lamps

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2014-03-31

    This report focuses on the flicker and power quality performance of the Series 20 lamps at full output and various dimmed levels. All of the Series 20 PAR38 lamps that manufacturers claimed to be dimmable (including all halogen lamps) were evaluated individually (one lamp at a time) both on a switch and under the control of a phase-cut dimmer designed for use with "all classes of bulbs." Measurements of luminous flux, flicker, and power quality were taken at 10 target dimmed settings and compared with operation on a switch. Because only a single unit of each product was evaluated on a single dimmer that may or may not have been recommended by its manufacturer, this report focuses on the performance of the products relative to each other, rather than the best-case performance of each lamp or variation in performance delivered from each lamp. Despite these limitations, the results suggest that LED performance is improving, and performance trends are beginning to emerge, perhaps due in part to the identification of preferred LED driver strategies for lamp products.

  15. Risk of pseudophakic retinal detachment in 202 226 patients using the fellow nonoperated eye as reference

    DEFF Research Database (Denmark)

    Bjerrum, Søren S; Mikkelsen, Kim Lyngby; La Cour, Morten

    2013-01-01

    To study the risk of pseudophakic retinal detachment (PRD) after first-eye phacoemulsification cataract surgery in Denmark relative to the risk of retinal detachment (RD) in the patients' fellow nonoperated eyes.......To study the risk of pseudophakic retinal detachment (PRD) after first-eye phacoemulsification cataract surgery in Denmark relative to the risk of retinal detachment (RD) in the patients' fellow nonoperated eyes....

  16. 76 FR 55084 - Announcement of Funding Awards for the Section 202 Supportive Housing for the Elderly Program...

    Science.gov (United States)

    2011-09-06

    ... Rental Subsidy: $178,200 Number of units: 20 California Auburn, CA Mercy Housing California Capital... Mercy Housing California Capital Advance: $12,936,600 Three-year Rental Subsidy: $1,566,300 Number of... Subsidy: $72,300 Number of Units: 5 Idaho Boise, ID Mercy Housing Idaho Inc. Capital Advance:...

  17. 7 CFR 1728.202 - RUS Bulletin 1728H-702, RUS Specification for Quality Control and Inspection of Timber Products.

    Science.gov (United States)

    2010-01-01

    ... § 1728.97 of this part and in § 1755.97 of 7 CFR part 1755. (b) Related specifications and standards... in accordance with 5 U.S.C. 552(a) and 1 CFR part 51. Copies of each are available for inspection... 7 Agriculture 11 2010-01-01 2010-01-01 false RUS Bulletin 1728H-702, RUS Specification for...

  18. 75 FR 60655 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes; Airbus...

    Science.gov (United States)

    2010-10-01

    ... Inspection Requirements'' (66 FR 23086, May 7, 2001). In addition to new airworthiness standards for... Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic... power unit (APU) bleed leak detection system could result in overheat of the fuel tank located in...

  19. 76 FR 432 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes; Airbus...

    Science.gov (United States)

    2011-01-05

    ... October 1, 2010 (75 FR 60655). That NPRM proposed to correct an unsafe condition for the specified...'' under the DOT Regulatory Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have... definition review against explosion hazards. * * * * * Failure of the auxiliary power unit (APU) bleed...

  20. Shelf-life of ɛ-lysyl-3-(trimethylstannyl)benzamide immunoconjugates, precursors for 211At labeling of antibodies

    DEFF Research Database (Denmark)

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per;

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity ...

  1. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  2. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    International Nuclear Information System (INIS)

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons

  3. Separation of 211At from irradiated bismuth target and labelling of a model protein

    International Nuclear Information System (INIS)

    Astatine-211 is a promising radionuclide for therapeutic use in nuclear medicine. An efficient method (70%) for radiochemical separation from the irradiated Bi-target has been described. The level of Bi contamination in the purified 2'11At-solution was estimated. Finally labelling of a model protein has been tried. (author). 14 refs

  4. Familial FTDP-17 Missense Mutations Inhibit Microtubule Assembly-promoting Activity of Tau by Increasing Phosphorylation at Ser202 in Vitro*S⃞

    OpenAIRE

    Han, Dong; Qureshi, Hamid Y.; Lu, Yifan; Paudel, Hemant K.

    2009-01-01

    In Alzheimer disease (AD), frontotemporal dementia and parkinsonism linked to chromosome 17 (FTDP-17) and other tauopathies, tau accumulates and forms paired helical filaments (PHFs) in the brain. Tau isolated from PHFs is phosphorylated at a number of sites, migrates as ∼60-, 64-, and 68-kDa bands on SDS-gel, and does not promote microtubule assembly. Upon dephosphorylation, the PHF-tau migrates as ∼50–60-kDa bands on SDS-gels in a manner similar to tau that is isolat...

  5. 76 FR 24832 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes, A330-300...

    Science.gov (United States)

    2011-05-03

    ... Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic impact, positive or... include vacuum loss and elasticity laminate checker inspections for damage including de-bonding between... exist or develop on other products of the same type design. Differences Between This AD and the MCAI...

  6. Antilisterial activity of bacteriocinogenic Pediococcus acidilactici HA6111-2 and Lactobacillus plantarum ESB 202 grown under pH and osmotic stress conditions.

    Science.gov (United States)

    Engelhardt, Tekla; Albano, Helena; Kiskó, Gabriella; Mohácsi-Farkas, Csilla; Teixeira, Paula

    2015-06-01

    Bacteriocin producing lactic acid bacteria (LAB) cultures can be used as biopreservatives in fermented food products; thus the food industry is interested in stable cultures that produce bacteriocins consistently. Inhibtion of Listeria spp. by bacteriocinogenic Pediococcus acidilactici and Lactobacillus plantarum (both isolated from fermented meats) was investigated under conditions of stress induced by low pH and high salt concentrations. Listeria monocytogenes serogroup IIb (from cheese), L. monocytogenes serogroup IVb (from cheese), L. monocytogenes serogroup IIb (from ground beef) and Listeria innocua NCTC 11288 were used as target strains. P. acidilactici and Lb. plantarum demonstrated antilisterial activity under the stress conditions investigated (pH 3.5; pH 8.5; 7.5% NaCl). However, activity was dependent on the stress conditions applied and on the target organism. L. monocytogenes serogroup IIb (from ground beef) and L. innocua C 11288 were, respectively the most sensitive and the most resistant to the cell-free supernatants produced by the LAB investigated. PMID:25790998

  7. Antilisterial activity of bacteriocinogenic Pediococcus acidilactici HA6111-2 and Lactobacillus plantarum ESB 202 grown under pH and osmotic stress conditions

    OpenAIRE

    Engelhardt, Tekla; Albano, Helena; Kisk, Gabriella; Acsi-Farkas, Csilla Moh; Teixeira, Paula

    2015-01-01

    Bacteriocin producing lactic acid bacteria (LAB) cultures can be used as biopreservatives in fermented food products; thus the food industry is interested in stable cultures that produce bacteriocins consistently. Inhibtion of Listeria spp. by bacteriocinogenic Pediococcus acidilactici and Lactobacillus plantarum (both isolated from fermented meats) was investigated under conditions of stress induced by low pH and high salt concentrations. Listeria monocytogenes serogroup IIb (fro...

  8. Discrimination of two geographically distinct populations of sea bass Dicentrarchus labrax, using stable isotopic signatures of mercury (δ202Hg, Δ199Hg)

    OpenAIRE

    Cransveld, Alice; Amouroux, David; Koutrakis, Emmanuil; Bérail, Sylvain; Caiyan, Feng; Barre, Julien P. G.; Schnitzler, Joseph; Das, Krishna

    2014-01-01

    Despite the reduction of mercury (Hg) emissions in Europe in the last decades, Hg emissions are increasing worldwide and concentrations found in some marine predators remain high. This raises questions on mercury's biogeochemical cycle at both local and global scale. In the present work, we investigate the possibility to use mercury isotopic signature in fish as a tool to discriminate different polluted areas and potential pollution sources. Indeed, Hg can exhibit both mass-dependent (MDF) an...

  9. [Fatal poisoning due to narcotic abuse in the analytic-toxicological practice of Forensic Medicine Department Silesian Medical Academy in Katowice in years 1996-202].

    Science.gov (United States)

    Soja, Artur; Celiński, Rafał; Kulikowska, Joanna; Albert, Małgorzata; Sybirska, Halina

    2003-01-01

    147 cases of fatal poisonings in people due to narcotic abuse examined in the Forensic Medicine Department Silesian School of Medicine, Katowice in the years 1996-2002 have been presented in the paper. In the group examined there were 126 males and 21 females at the age of 16-44. Opium narcotics were found in 139 out of 147 cases and amphetamine derivatives in 18. Opiates were indicated in 58 individuals and amphetamine only in 8. In 35 poisoned people opiates with barbituric acid derivatives were found. In 3 cases death resulted after taking opiates and amphetamine derivatives. 1 individual died after taking opiates and substances of the phenothiazine group. In the organic fluids of 18 people opiates and medicines being derivatives of 1,4-benzodiazepine and barbituric acid were found. Amphetamine and derivatives of 1,4-benzodiazepine were found in 6 individuals and opiates, barbiturates, benzodiazepines and amphetamine in 1 individual. Concentrations of all the substances indicated ranged widely and were as follows: microgram/ml for opiates; microgram/ml for amphetamine; microgram/ml for 1.4-benzodiazepine derivatives and microgram/ml for barbituric acid derivatives. Ethanol was found in 18 individuals and its concentration was @1000. PMID:14669548

  10. 37 CFR Appendix B to Part 202 - “Best Edition” of Published Copyrighted Works for the Collections of the Library of Congress

    Science.gov (United States)

    2010-07-01

    ... Packaging: 1. Archival-quality rather than less-permanent paper. 2. Hard cover rather than soft cover. 3... prints B. Video Formats 1. Betacam SP 2. Digital Beta (Digibeta) 3. DVD 4. VHS Cassette IV. Other Graphic... rather than those without them. E. Binding and Packaging: 1. Bound rather than unbound. 2. If...

  11. No psychological effect of color context in a low level vision task [v1; ref status: indexed, http://f1000r.es/202

    Directory of Open Access Journals (Sweden)

    Adam Pedley

    2013-11-01

    Full Text Available Background: A remarkable series of recent papers have shown that colour can influence performance in cognitive tasks. In particular, they suggest that viewing a participant number printed in red ink or other red ancillary stimulus elements improves performance in tasks requiring local processing and impedes performance in tasks requiring global processing whilst the reverse is true for the colour blue. The tasks in these experiments require high level cognitive processing such as analogy solving or remote association tests and the chromatic effect on local vs. global processing is presumed to involve widespread activation of the autonomic nervous system. If this is the case, we might expect to see similar effects on all local vs. global task comparisons. To test this hypothesis, we asked whether chromatic cues also influence performance in tasks involving low level visual feature integration. Methods: Subjects performed either local (contrast detection or global (form detection tasks on achromatic dynamic Glass pattern stimuli. Coloured instructions, target frames and fixation points were used to attempt to bias performance to different task types. Based on previous literature, we hypothesised that red cues would improve performance in the (local contrast detection task but would impede performance in the (global form detection task.  Results: A two-way, repeated measures, analysis of covariance (2×2 ANCOVA with gender as a covariate, revealed no influence of colour on either task, F(1,29 = 0.289, p = 0.595, partial η2 = 0.002. Additional analysis revealed no significant differences in only the first attempts of the tasks or in the improvement in performance between trials. Discussion: We conclude that motivational processes elicited by colour perception do not influence neuronal signal processing in the early visual system, in stark contrast to their putative effects on processing in higher areas.

  12. Fiscal Equity in Kansas under the School District Equalization Act: Consultants' Analysis on Behalf of Turner USD 202 in Mock v State of Kansas.

    Science.gov (United States)

    Thompson, David C.; And Others

    Updated information is provided in this addendum to an original report that assessed the equity of the Kansas School District Equalization Act (SDEA) from 1973 to 1988. This consultants' analysis on behalf of Turner School District in "Mock v. State of Kansas" consists of five parts. Following an introduction, section 2 reviews the initial…

  13. HIV Testing in the Past Year among the U.S. Household Population Aged 15-44: 2011-2013. NCHS Data Brief. Number 202

    Science.gov (United States)

    Copen, Casey E.; Chandra, Anjani; Febo-Vazquez, Isaedmarie

    2015-01-01

    In 2011, more than 1 million Americans aged 13 and over were living with HIV infection, and one in seven did not know their infection status. Routine, voluntary HIV testing is a recognized way to reduce HIV transmission. Using data from the 2011-2013 National Survey of Family Growth (NSFG), this report updates nationally representative estimates…

  14. Decree 302/013. It amend Art. 5 of Decree 202/005 on the integration of the National Oncology Committee and it create a Standing Advisory Group

    International Nuclear Information System (INIS)

    The decree is about an adaptation of the integration of the national committee on oncologic o including representatives of the Faculty of Medicine of the University of the Republic and representatives of the National Board of Health and Honorary Commission to Fight Cancer that is proposed.Creating a Standing Advisory Group is also suggested

  15. DATA PACKET FOR THE FRIT 202-A11 SB3 GLASS SYSTEM A CANDIDATE FOR THE COLD CRUCIBLE INDUCTION MELTER DEMONSTRATION

    International Nuclear Information System (INIS)

    A demonstration of the Cold Crucible Induction Melter (CCIM) technology is currently planned for the fall of 2007 to assess the potential for attaining higher waste throughputs as compared to joule heated melter technology. The CCIM demonstrations will be based on a Defense Waste Processing Facility (DWPF) waste slurry feed surrogate with a nominal operating temperature of approximately 1250 C (higher temperatures may be used). The waste slurry feed (nominally 45-50 weight percent solids) surrogate will be representative of Sludge Batch 3 (SB3) in order to allow a direct comparison to the DWPF joule heated melter performance during processing of this sludge waste. This pilot scale demonstration is being conducted to evaluate performance and to identify potential processing issues with the existing CCIM technology, and it will include characterization of the resultant glass product to ensure current product performance (durability) specifications are met. The information presented in this data packet provides a technical basis from which decisions regarding the melter demonstration can be made. More specifically, the results presented in this report provide technical data on the impact of waste loading (WL) on critical properties of interest--in particular, durability, liquidus temperature, and viscosity. All of the glasses of this study, regardless of heat treatment, were acceptable when their durabilities were compared to those of the Environmental Assessment (EA) glass. In general, as WL increases, the durabilities for the quenched versions of the glasses tend to decrease due to the changing composition of the glass. For the glasses subjected to the canister centerline cooling (ccc) regime, the durability response appears to be more non-linear as WL increases. At WLs less than 50%, X-ray diffraction (XRD) analysis indicates the potential for the presence of aegirine and/or nepheline crystalline phases, and when these phases are present, there is a decrease in the durability of the glass. As WL is increased above 50%, there is a transition from the aegirine and/or nepheline phases to a spinel phase field leading to more durable glasses. The results for durability suggest that WLs of 50% or greater should be targeted for the CCIM demonstration, thus, avoiding the potential for the formation of aegirine and/or nepheline. However, if decisions to target WLs of 50% or greater are made, liquidus temperature (TL) measurements indicate that there could be some degree of crystallization within the melter if a nominal 1250 C temperature is used. It is also anticipated that increasing WLs will lead to higher TL's. Specifically, the TL of the 50% WL glass (HTLG-21) was measured to be slightly above 1250 C. To minimize the potential of crystallization during processing, higher melt temperatures could be targeted which not only could allow for higher WLs to be obtained but will also result in a reduction in viscosity, which in itself could pose certain processing issues (the ability to control the pour and the possibility of increased volatility). The viscosity of the 50% WL glass at 1250 and 1300 C was measured to be 20 and 13 Poise, respectively. Thus, a balance between processing and product performance issues may be required for the initial CCIM demonstrations since the frit development efforts to date were not necessarily intended to optimize this glass system nor have these efforts accounted for the variation from the intended target that is likely to occur in the composition of the waste slurry feed surrogate that is being used in the study

  16. Decomposition of Askarel Oil by Microwave Radiation and H202/TiO2 Agents in Order to Reduce Occupational Hazards

    Directory of Open Access Journals (Sweden)

    Reza Tajik

    2012-06-01

    Full Text Available Background: Poly chlorinated biphenyls (PCBS are the groups of organicchemical material and toxic, persistent, bio accumulate and pose a risk of causingadverse effects to human health and the environment. PCB compounds arecaused the different health effects in human depending of age, sex, route of entry,intensity and frequency exposure. This study was conducted to determine theeffect of microwave rays, hydrogen peroxide, TiO2 catalyst and ethanol on theDecomposition of PCBS.Methods: In this experiment used a MW oven, Pyrex vessel reactor (250mlvolume, Pyrex tube connector and condensing system. A 900w domestic MWoven with a fixed frequency of 2450 MHZ was used to provide MW irradiation. Raypowers used in 540، 720 and 900w. The PCBS were analyzed by GC-ECDResults: The degradation of total PCBS in terms of 540, 720 and 900W was85.03%, 90.32% and 96.87% respectively. The degradation of total PCBS in termsof ratio to solvent with transformer oil in 1:1، 2:1 and 3:1 was 53.97%، 78.98% and95.13% respectively. The degradation of total PCBs in terms of not using of H2O2/TiO2 and using 20% of H2O2 and 0.05, 0.1, 0.15 and 0.2 g TiO2 was 68.78%,93.97%, 95.13%, 96.18% and 96.87 % respectively.Conclusion: The Microwave thermal reaction was applied for the dechlorinationof PCBs and high efficiencies were obtained. Microwave power and amounts ofreactants added are important factors influencing dechlorination efficiency.

  17. Hurdles for a Broader Use of 211At and for the Synthesis of 211At-Labelled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    One of the key impediments to the use of 211At is the very well known deleterious effect of high radiation fields caused by its alpha particles on the synthesis of 211At-labelled radiopharmaceuticals. This is problematic because radiolysis-mediated effects can produce diminishing efficiency of electrophilic astatination reactions due to increasing deposition of radiation dose with increasing activities and with the passage of the time. Astatine-211 has chemical properties that permit complex labelling strategies and a longer half-life than 213Bi that makes it more suitable when the targeting molecule does not gain immediate access to the tumour cells. The first clinical evaluation was published in 2001 [2] in patients with brain tumour. Although this study circumvents many of the challenges to entering clinical studies with 211At and many obstacles had to be surmounted before clinical studies could be initiated, several problems were encountered in maintaining efficient labelling with escalating radiation dose of α-particle even with fresh 211At elution [3]. Astatine-211 also has an additional hurdle to overcome before to its clinical application in labelled radiopharmaceuticals related with its production and distribution. Among the potential group of promising α- emitter it is the only one produced by cyclotrons, but due to the scarcity of cyclotrons equipped with 25−30 MeV α-particle beams, it will of necessity be utilized in distant locations from the site of production. It presents a major chemical challenge because the diminishing efficiency of electrophilic astatination reactions with the passage of the time is well known, a problem likely related to the radiolysis produced by the high LET (linear energy transfer) meaning that large amounts of energy are deposited in a highly localized manner. This problem has been most comprehensively investigated to understand and evaluate the role of the radiolysis effects of astatine alpha particles in the synthesis

  18. Direct synthesis of H202: Study of the influence of N2 as reaction inert and optimization of the reactor configuration = (Síntesis directa del H202. Estudio de la influencia de N2 como inerte de reacción y selección de la configuración de reactor óptima)

    OpenAIRE

    Huerta Illera, Irene

    2014-01-01

    El desarrollo de la producción de peróxido de hidrógeno mediante síntesis directa y su aplicación en el entorno de la industria química constituye una de las principales prioridades en la Agenda estratégica de Investigación (SRA) de la Plataforma Tecnológica Europea para la Química Sostenible.El peróxido de hidrógeno, conocido comúnmente como agua oxigenada, es un líquido incoloro con fuertes propiedades oxidantes y altamente inestable que se puede descomponer por acción de: el calor, la luz ...

  19. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  20. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  1. Radiopharmaceutical Chemistry of Targeted Radiopharmaceutics. Synthesis of 211At-Labeled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    Targeted α-particle radiotherapy is an appealing approach to cancer treatment because of the potential for delivering curative doses of radiation to tumor with minimal damage to normal tissue due to a range equivalent to only a few cell diameters. Compared with β-emitters they have significant advantages from a radiobiological perspective. The LET of 211At α-particles is more than 400 times higher than the β-particles emitted by 90Y, in addition the distance between ionizing events is almost the same as that between the two strands of DNA, yielding a high probability of creating non-repairable DNA damage. It gives the ability to kill cancer cells not compromised by hypoxia, dose rate effects or cell cycle position, enhancing their attractiveness for targeted radiotherapy. However, translation of the concept to the clinic has been slow, many obstacles had to be surmounted before clinical studies could be initiated, the first clinical evaluation of a 211At- labeled mAb was made in 2001. This study circumvents many of the challenges to entering clinical studies with 211At. But several problems were encountered in maintaining efficient labeling with escalating radiation dose of alpha-particle likely related to radiolysis. The impact of the radiolysis produced by the α-particle over the labeling chemistry is much higher in comparison with typical β-emitters due to a deposition of energy in the solvent in a highly localized manner two orders of magnitude per unit volume higher than 90Y or 131I. Due to these difficulties a comprehensive basic science study about the radiolytic effects of astatine alpha-particles over the synthesis of 211At-labeled radiopharmaceuticals was carried out. Its main goal was overcoming the problem of the synthesis of 211At-labeled radiopharmaceuticals at the high activities necessaries for therapy and also to extend the shelf life of astatine elutions. Briefly this study held several steps, the first one was to study the role of solvent

  2. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    International Nuclear Information System (INIS)

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211At and 124I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[211At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[211At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [124I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[124I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of macromolecules

  3. 211At production and recovery: first results of a new start

    International Nuclear Information System (INIS)

    Full text: 211At is the only alpha-emitting isotope which can be introduced into organic molecular structures by covalent chemical binding and possesses superior decay characteristics for therapeutic applications when compared with other alpha emitters. However, its production requires a minimum of 27,5 MeV alpha-particles, which are relatively rarely available. In view of the revival of alpha-therapy approaches a production of 211At has been set up at the MHH cyclotron (MC-35). The first aim of this project was to establish a target- and work-up-system for the reliable production of several ten MBq-quantities of 211At for animal- and cell-research. An aluminum-target-system holds a 1.3 cm diameter Bi-disc of 0.25 mm thickness. The disk is pressed onto a the aluminum backing with 2 tons/cm2. The front is covered with a 125 μm Al foil, cooled by a He jet which is separated from the vacuum by a 250 μm Ti foil. Starting with 27.5 MeV alpha-particles the resulting target-energy is 25 MeV. This relatively low energy is chosen to avoid any contamination with 210At and 210Po in the first experimental period. A beam current of 10 μA for 15 min (9 mCoulomb) yields 16.4 MBq 211At theoretically. Astatine is recovered from the target by a dry distillation technique, using various gases as a transport support-medium. The small all-quartz distillation-apparatus is heated up to 900 oC. Astatine is recovered in a small cool able vessel containing various trapping media. Distillation and trapping can be monitored with small radioactivity monitors. The whole system fits in a cubical 0.5 m glove box. Continuous monitoring of the distillation process allowed to optimize the heating rate, the transport support-medium and its flow-rate. Various trapping solutions were tested for their efficiency. Different beam dispersion in the target seems to influence the release and distillation of astatine from the molten bismuth-target. Two different release patterns were observed. The first

  4. Methodical Optimization of Model Approaches on Pollutant Balancing in River Basin Districts to Promote the Implementation Strategy for the Water Framework Directive. Final Report on the Project FZK: 370 822 202/01

    OpenAIRE

    Fuchs, Stephan; Wander, Ramona,; Weber, Tatyana; Hilgert, Stephan; Scherer, Ulrike; Ihringer, Jürgen,; Höllering, Simon

    2012-01-01

    Within a feasibility study the existing quantification approaches of the model system MONERIS have been methodically developed and their adequacy for modeling in the scale of large river basins has been tested. Additionally, input data sets of spatially and temporally higher resolution have been implemented. The following approaches and methods have been developed based on their relevance for pollutant emissions: water balance and runoff components, sewer systems, erosion and sediment deliver...

  5. INFLUENCE OF SINTERING TEMPERATURE ON THE POLARIZATION RESISTANCE OF LaO20.6SrO20.4CoO20.2FeO20.8O3-δ - SDC CARBONATE COMPOSITE CATHODE

    Directory of Open Access Journals (Sweden)

    Nurul Akidah Baharuddin

    2016-05-01

    Full Text Available The effects of sintering temperature of an LSCF-samarium-doped ceria carbonate (SDCC cathode composite film on its polarization resistance (Rp were evaluated in this study. An LSCF-SDCC composite cathode was prepared for cathode film development by electrophoretic deposition (EPD. The LSCF-SDCC composite cathode was prepared at 50:50 weight percentage ratio. An EPD suspension which is based on an organic aqueous solution was used, and a mixture of ethanol and deionized water was used as medium with poly diallyl dimethyl ammonium chloride (PDADMAC as a dispersing agent. SDCC substrate was used, and EPD was performed on both sides. A symmetrical cell with cathode composite LSCF-SDCC films on both sides of the substrate was subjected to sintering at five different temperatures (from 550°C to 750°C. A symmetrical cell was painted using silver paste before undergoing electrochemical performance test (air condition, in which the impedance, Z data, was measured. The effects of sintering temperature change on element content and film porosity were first investigated by energy-dispersive X-ray spectroscopy, field emission scanning electron microscopy, and J-image analysis. Ceramic-based cathode LSCF-SDCC that was sintered at 600°C exhibited the lowest Rp at a value of 0.68 Ω when operated at 650°C. This study proved that EPD has potential in developing IT-LT solid oxide fuel cell cathode components with high electrochemical performance in terms of Rp values.

  6. Moscheen und Madrasabauten in Iran 1785 – 1848: Architektur zwischen Rückgriff und Neuerung. Leiden, Boston, Brill, 2006, 1002 p., 202 pls. (Islamic History and Civilization. Studies and Texts, eds. Wadad Kadi and Rotraud Wielandt, vol. 62)

    OpenAIRE

    Rührdanz, Karin

    2008-01-01

    Although shaping the traditional quarters of Iranian cities, Qajar architecture has largely been neglected by art historians, so far. Ritter’s research is a promising start to establish 19th century architecture within the framework of the art history of Iran, as this has already been achieved in respect to Qajar painting. The first half of the volume is dedicated to the analysis of several types of mosque and madrasa buildings belonging to the early Qajar period. The second part contains the...

  7. Structural characterization of bamboo hemicellulose fractions isolated by alkaline H202%基于碱性H2O2法分级分离竹材半纤维素的结构特性

    Institute of Scientific and Technical Information of China (English)

    谢涛; 余秉奇; 张儒

    2011-01-01

    To probe the efficient utilization of bamboo hemicellulose, the structural characterizations of three hemicelluose fractions isolated by alkaline hydrogen peroxide from defatted bamboo fiber were studied. The results demonstrated that the purity of the second and third fractional hemicelluloses is very high except that the first fractional hemicellulose contains only a little lignin. The three fractional hemicelluloses belong to xylan-hemicellulose because of the highest content of xylose up to about 50%.The three fractional hemicelluloses are non-crystal. With the increasing of fractional grade, the existence of hemicellulose gradually shift by round sphere to cloud body as a result of the more uniform of molecular chain of hemicellulose. Therefore, multi-stage separation is helpful to promote the purity and structural homogeneity of hemicellulose.%为探讨竹材半纤维素的高效利用,研究竹材纤维原料碱性过氧化氢法分级分离所得三级半纤维素的结构特性.结果表明:一级半纤维素中含有少量木质素,二级与三级半纤维素的纯度很高;3种半纤维素都是木聚糖型半纤维素,其组成中木糖含量高达50%左右;三级半纤维素均为无定形的非晶体,随着分离级数增加,半纤维素的分子链段趋向均匀,半纤维素的存在形态由圆球体逐渐向云状体转变.认为多级分离有利于提高半纤维素产品的纯度和结构均一性.

  8.   30‑day mortality after hysterectomy among women with liver cirrhosis, Danish population‑based cohorts study" Eur J Obstet Gynecol Reprod Biol. 2002 May 10;102:202-5

    DEFF Research Database (Denmark)

    Lesnikova, Iana; Thulstrup, AM; Nielsen, GL;

    2002-01-01

    BACKGROUND: Women with liver cirrhosis have a higher incidence of hysterectomy than the general population, generally because of abnormal bleeding. They may also have an increased risk of postoperative mortality and morbidity. METHODS: In the nationwide Danish National Patients Register (NPR) we ...

  9. 偶合反应流动注射化学发光法测定扑热息痛%Flow injection chemiluminescence determination of paracetamol with chromium (VI)-H202-luminol system

    Institute of Scientific and Technical Information of China (English)

    王书民; 樊雪梅; 苏智魁; 陈凤英; 刘萍

    2011-01-01

    As chromium(Ⅵ) can be reduced by paracetamol to chromium(Ⅲ) which enhance the CL intensity of luminol-H2O2system, a new chemiluminescent method for the determination of paracetamol was developed. The relative CL intensity was linearly related to the concentration of paracetamol in the range of 4. 0 × 10-9 ~4. 0 ×10-5mol/L with a detection limit of 1.0 × 10-9mol/L. The relative standard deviation( n = 8) for 4. 0 × 10-7mol/L paracetamol was 2. 7%. The method has been applied to the determination of paracetamol in the tablets.%基于扑热息痛还原铬(Ⅵ)和铬(Ⅲ)催化鲁米诺-过氧化氢的化学发光,建立了氧化还原偶合反应流动注射化学发光法测定扑热息痛的新方法.方法线性范围为4.0×10-9~4.0×10-5mol/L,检出限为1.0×10-9 mol/L.对4.0×10-7 mol/L扑热息痛平行测定8次,其标准偏差为2.7%.已将该方法用于片剂中扑热息痛含量测定.

  10. Integrated Advanced Microwave Sounding Unit-A (AMSU-A). Performance Verification Reports: Final Comprehensive Performance Test Report, P/N: 1356006-1, S.N: 202/A2

    Science.gov (United States)

    Platt, R.

    1998-01-01

    This is the Performance Verification Report. the process specification establishes the requirements for the comprehensive performance test (CPT) and limited performance test (LPT) of the earth observing system advanced microwave sounding unit-A2 (EOS/AMSU-A2), referred to as the unit. The unit is defined on drawing 1356006.

  11. Antibody levels against GLURP R2, MSP1 block 2 hybrid and AS202.11 and the risk of malaria in children living in hyperendemic (Burkina Faso) and hypo-endemic (Ghana) areas

    DEFF Research Database (Denmark)

    Adu, Bright; Cherif, Mariama K; Bosomprah, Samuel;

    2016-01-01

    BACKGROUND: Differences in parasite transmission intensity influence the process of acquisition of host immunity to Plasmodium falciparum malaria and ultimately, the rate of malaria related morbidity and mortality. Potential vaccines being designed to complement current intervention efforts there...

  12. Inclusive measurement of (p,πsup(-)xn) double charge exchange reactions on bismuth from threshold to 800 MeV

    International Nuclear Information System (INIS)

    The energy dependence of the total angle-integrated cross section for the production of astatine isotopes from (p,πsup(-)xn) double charge exchange reactions on bismuth (sup(209)Bi) was measured from 120 to 800 MeV using activation and radiochemical techniques. Chemical yields were estimated by direct radioassaying of sup(211)At activity in thin (approximately 1 mg/cmsup(2)), irradiated bismuth targets. Calculations of the contributions of secondary (2-step) reactions to these measured astatine yields were performed, based partially upon the observed sup(211)At activity although even at the highest energies, the contribution to products lighter than sup(207)At was negligible. These data for products with as many as 7 neutrons removed from the doubly coherent product (sup(210)At) display nearby gaussian shapes for the mass distributions of the astatine residues with the maximum occurring for about sup(204)At. The most probable momentum transfer deduced from these distributions for the initial πsup(-) production step was 335 MeV/c. The observed excitation functions display a behaviour similar to that observed for the yield of sup(210)Po from a (p,πsup(O)) reaction on sup(209)Bi, but radically different from that observed for inclusive πsup(-) reactions on a heavy nucleus. These data are discussed in terms of recent theoretical approaches to negative pion production from bismuth. In addition, a simple, schematic model is developed to treat the rapidly decreasing percentage of the total inclusive πsup(-) emission which is observed for this double charge exchange reaction. This model reflects the capacity of a nucleus to a source of internal energetic protons

  13. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    OpenAIRE

    BAYRAM, Ali

    1998-01-01

    In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 1...

  14. Human radiation studies: Remembering the early years: Oral history of Dr. Patricia Wallace Durbin, Ph.D., conducted November 11, 1994

    International Nuclear Information System (INIS)

    This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches

  15. 75 FR 1751 - Hearing on the Department of Justice's Actions Related to the New Black Panther Party Litigation...

    Science.gov (United States)

    2010-01-13

    ..., color, religion, sex, age, disability, or national origin, or in the administration of justice. The..., Public Affairs Unit (202) 376-8591. TDD: (202) 376-8116. Persons with a disability requiring...

  16. 76 FR 785 - Notice of Nationwide Waiver of Section 1605 (Buy American Requirement) of the American Recovery...

    Science.gov (United States)

    2011-01-06

    .... FOR FURTHER INFORMATION CONTACT: Timothy Connor, Chemical Engineer, (202) 566-1059, Office of Wastewater Management (OWM) or Kirsten Kroner, Civil Engineer, (202) 564-3134, Office of Ground Water...

  17. 76 FR 28727 - Child Nutrition (CN) Labeling Program; Request for Extension and Revision of a Currently Approved...

    Science.gov (United States)

    2011-05-18

    ...., Washington, DC 20250-0247, telephone: (202) 720-9939 and Fax: (202) 690-3824; or Internet: http://www...-3824; or Internet: http://www.regulations.gov . All comments received will be available for...

  18. Dicty_cDB: Contig-U12431-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kxxx- -- ---xxx*strftritkssckfrdcssk*s*iltstiscrtiptttattsqsttitinan* tikgiygfntcstinl*stnstkslqstsytettttki...trand = Plus / Plus Query: 351 ttaatgcaaattaaacaatcaaaggaatatatggttttaacacctgctcaacaattaatt 410 ||||||||||||...gctcaacaattaatt 410 Query: 411 tataatcaacaaattcaacaaaatcattacaatcaacaagttatactgag 46...and = Plus / Plus Query: 202 atgatccacacgttttacaaggattacaaaatcaagttgcaaatttagagattgctcaag 261 ||||||||||||||...|||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 202 atgatccacacgttttacaaggattacaaaatcaagttgcaaatttagagattgctc

  19. Aplastic Anemia and Myelodysplastic Syndromes

    Science.gov (United States)

    ... when it is safe to eat in a restaurant. When dining out, stem cell transplant recipients should ... Phone: 202–776–0544 Fax: 202–776–0545 Internet: www.hematology.org Aplastic Anemia & MDS International Foundation ...

  20. 75 FR 16738 - Antidumping or Countervailing Duty Order, Finding, or Suspended Investigation; Advance...

    Science.gov (United States)

    2010-04-02

    ... Review). (202) 482-1391. Potassium Permanganate from the PRC (A-570-001) Jennifer Moats, (202) (3rd... Countervailing Duty Orders; Policy Bulletin, 63 FR 18871 (April 16, 1998). The Notice of Initiation of...

  1. 78 FR 57128 - Forest Resource Coordinating Committee

    Science.gov (United States)

    2013-09-17

    ... assistance delivery systems, forest inventory and analysis, markets, climate change adaptation, forest... Program Coordinator, Cooperative Forestry Staff, 202-205-1376 or Ted Beauvais, Forest Resource Coordinating Committee Designated Federal Officer, Cooperative Forestry Staff, 202-205-1190. Individuals...

  2. Osteogenesis Imperfecta Overview

    Science.gov (United States)

    ... often from little or no apparent cause. A classification system of different types of OI is commonly ... TTY: 202-466-4315 Fax: 202-293-2356 Email: NIHBoneInfo@mail.nih.gov Website: http://www.bones. ...

  3. 78 FR 22872 - Review of Cost Submittals by Other Federal Agencies for Administering Part I of the Federal Power...

    Science.gov (United States)

    2013-04-17

    ... this notice should contact W. Doug Foster at (202) 502-6118 (via email at doug.foster@ferc.gov ), or Norman Richardson at (202) 502-6219 (via email at norman.richardson@ferc.gov ). Dated: April 11,...

  4. 76 FR 9742 - Agenda and Notice of Public Meeting of the Vermont Advisory Committee

    Science.gov (United States)

    2011-02-22

    ... From the Federal Register Online via the Government Publishing Office COMMISSION ON CIVIL RIGHTS.... Telephone #: 202-376-7533. Fax #: 202-376-7548. E-mail address: ero@usccr.gov . TDD: Dial 711 for relay services and dial 202-376-7533. Dated in Washington, DC, on February 15, 2011. Peter Minarik, Acting...

  5. 76 FR 66718 - Clean Air Act Advisory Committee (CAAAC): Notice of Meeting

    Science.gov (United States)

    2011-10-27

    ..., please contact Pat Childers, Office of Air and Radiation, U.S. EPA (202) 564-1082, FAX (202) 564-1352 or... on access or services for individuals with disabilities, please contact Mr. Pat Childers at (202) 564-1082 or childers.pat@epa.gov . To request accommodation of a disability, please contact Mr....

  6. Dicty_cDB: SSD363 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ning vector pDXA-3strep. 202 8e-50 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 202 8...oning vector pDXA-3FLAG. 202 8e-50 2 X85118 |X85118.1 Artificial sequences clonin...g vector DNA pDXA-3C. 202 8e-50 2 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 202 9e-5...0 2 AF269236 |AF269236.1 Cloning vector pDXA-FLAG, complete sequence. 202 9e-50 2 X85120 |X85120.1 Artificial...e-50 2 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 202 8e-50 2 AJ510165 |AJ510165.1 Cl

  7. Younger Adults Derive Pleasure and Utilitarian Benefits from Browsing for Music Information Seeking in Physical and Digital Spaces. A Review of: Laplante, A., & Downie, J. S. (2011. The utilitarian and hedonic outcomes of music information-seeking in everyday life. Library & Information Science Research, 33, 202-210. doi:10.1016/j.lisr.2010.11.002

    Directory of Open Access Journals (Sweden)

    Diana K. Wakimoto

    2012-09-01

    Full Text Available Objective – This study’s objective was to identify the utilitarian and hedonic features of satisfying music information seeking experiences from the perspective of younger adults when using physical and digital music information retrieval (MIR systems in their daily lives.Design – In-depth, semi-structured interviews.Setting – Large public library in Montreal, Canada.Subjects – 15 French-speaking younger adults,10 males and 5 females (aged 18 to 29 years, mean age of 24 years.Methods – A pre-test was completed to test the interview guide. The guide was dividedinto five sections asking the participants questions about their music tastes, how music fit into their daily lives, how they discovered music, what music information sources were used and how they were used, what made their experiences satisfying, and theirbiographical information. Participants were recruited between April 1, 2006 and August 8,2007 following maximum variation samplingfor the main study. Recruitment stopped whendata saturation was reached and no new themes arose during analysis. Interviews were recorded and the transcripts were analyzed via constant comparative method (CCM to determine themes and patterns. Main Results – The researchers found that both utilitarian and hedonic factors contributed to satisfaction with music information seeking experiences for the young adults. Utilitarian factors were divided between two main categories: finding music and finding information about music. Finding information about music could be further divided into three sub-categories: increasing cultural knowledge and social acceptance through increased knowledge about music, enriching the listening experience by finding information about the artist and the music, and gathering information to help with future music purchases including information that would help the participants recommend music to others. Hedonic outcomes that contributed to satisfying information seeking experiences included deriving pleasure and feeling engaged while searching or browsing for music. Especially satisfying experiences were those where the participants felt highly engaged in the process and found new, independent, non-mainstream music. Not finding new music did not automatically lead to an unsatisfying experience for the participants; however, technology malfunctions in digital MIR systems and unpleasant environments such as those with unfriendly staff in physical music spaces (libraries and stores, led to unsatisfying experiences for the participants.Conclusions – As the results show that the hedonic aspects of music information seeking are very important, designers of MIR systems must take into account the hedonic as well as utilitarian outcomes when creating user interfaces. MIR systems should be designed with browsing as well as searching capabilities so searchers can make serendipitous discoveries of new music and information about music. In other words, MIR systems need to be engaging to ensure satisfying interactions for searchers.

  8. Representações sociais de familiares de pacientes internados no centro de terapia intensiva sobre saúde e doença
    doi: 10.12662/2317-3076jhbs.v3i4.164.p202-208.2015

    OpenAIRE

    Esleane Vilela Vasconcelos; Karina de Oliveira Freitas; Rosana Santos Bezerra; Sílvio Éder Dias da Silva; Jeferson Santos Araújo; Natacha Mariana Farias da Cunha; Poliana dos Santos Alves; Ronaldo de Sousa Moeira Baia

    2015-01-01

    Introdução: O processo saúde e doença representa o conjunto de relações e variáveis que produzem e condicionam o estado de saúde-doença de uma população que se modifica, nos diversos momentos históricos, conforme o desenvolvimento científico da humanidade, sendo uma expressão particular do processo geral da vida de cada meio social. Objetivo: Identificar, analisar e descrever as representações dos familiares de pacientes internados no CTI sobre saúde e doença. Métodos: Pesquisa qualitativa ba...

  9. El péptido ? A [25-35] y el hierro promueven apoptosis en linfocitos por un mecanismo de estrés oxidativo: contribución del H202,, caspasa 3, fn- kb, p53 y c-Jun

    Directory of Open Access Journals (Sweden)

    Marlene Jiménez

    2001-04-01

    Full Text Available El depósito del beta-amiloide (βA en las placas neuríticas es
    uno de los principales marcadores neuropatológicos de la enfermedad de Alzheimer (EA. Estudios in vitro han demostrado que el fragmento βA25-35, el cual contiene la secuencia funcionalmente citotóxica del péptido amiloide, induce neurotoxicidad y muerte celular por apoptosis (1. A pesar de las intensas investigaciones, no se ha dado una descripción completa de la cascada de eventos moleculares que conducen a muerte inducida por βA25-35 en un modelo celular único. Por lo tanto, nuestro objetivo principal es evidenciar una cascada de eventos moleculares ordenados inducidos por el bA25-35 y el hierro en un modelo celular.

  10. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  11. A route for polonium 210 production from alpha-particle irradiated bismuth-209 target

    International Nuclear Information System (INIS)

    A method is proposed for production of polonium-210 via the 209Bi(α,3n)210 At nuclear reaction. Bombardment of a bismuth-209 target was performed with a 37 MeV alpha-particle beam that leads to the production of astatine-210 (T1/2 = 8.1 h), which decays to polonium-210. It is purified from the bismuth target matrix by employing liquid-liquid extraction using tributyl phosphate (TBP) in para-xylene from 7 M hydrochloric acid. Back extraction of polonium-210 was performed by 9 M nitric acid. This method allows to purify a tracer amount of Po-210 (2.6 x 10-13 mol) from macroscopic amount of Bi (2.8 x 10-2 mol).

  12. Effective bond orders from two-step spin–orbit coupling approaches: The I{sub 2}, At{sub 2}, IO{sup +}, and AtO{sup +} case studies

    Energy Technology Data Exchange (ETDEWEB)

    Maurice, Rémi, E-mail: remi.maurice@subatech.in2p3.fr; Montavon, Gilles [SUBATECH, CNRS UMR 6457, IN2P3/EMN Nantes/Université de Nantes, 4 rue Alfred Kastler, BP 20722, 44307 Nantes Cedex 3 (France); Réal, Florent; Gomes, André Severo Pereira; Vallet, Valérie [Laboratoire PhLAM, CNRS UMR 8523, Université de Lille, 59655 Villeneuve d’Ascq Cedex (France); Galland, Nicolas [CEISAM, UMR CNRS 6230, Université de Nantes, 2 rue de la Houssinière, BP 92208, 44322 Nantes Cedex 3 (France)

    2015-03-07

    The nature of chemical bonds in heavy main-group diatomics is discussed from the viewpoint of effective bond orders, which are computed from spin–orbit wave functions resulting from spin–orbit configuration interaction calculations. The reliability of the relativistic correlated wave functions obtained in such two-step spin–orbit coupling frameworks is assessed by benchmark studies of the spectroscopic constants with respect to either experimental data, or state-of-the-art fully relativistic correlated calculations. The I{sub 2}, At{sub 2}, IO{sup +}, and AtO{sup +} species are considered, and differences and similarities between the astatine and iodine elements are highlighted. In particular, we demonstrate that spin–orbit coupling weakens the covalent character of the bond in At{sub 2} even more than electron correlation, making the consideration of spin–orbit coupling compulsory for discussing chemical bonding in heavy (6p) main group element systems.

  13. Effective bond orders from two-step spin–orbit coupling approaches: The I2, At2, IO+, and AtO+ case studies

    International Nuclear Information System (INIS)

    The nature of chemical bonds in heavy main-group diatomics is discussed from the viewpoint of effective bond orders, which are computed from spin–orbit wave functions resulting from spin–orbit configuration interaction calculations. The reliability of the relativistic correlated wave functions obtained in such two-step spin–orbit coupling frameworks is assessed by benchmark studies of the spectroscopic constants with respect to either experimental data, or state-of-the-art fully relativistic correlated calculations. The I2, At2, IO+, and AtO+ species are considered, and differences and similarities between the astatine and iodine elements are highlighted. In particular, we demonstrate that spin–orbit coupling weakens the covalent character of the bond in At2 even more than electron correlation, making the consideration of spin–orbit coupling compulsory for discussing chemical bonding in heavy (6p) main group element systems

  14. Different ways to improve the clinical effectiveness of radioimmunotherapy in solid tumors

    Directory of Open Access Journals (Sweden)

    Chatal Jean-Francois

    2009-09-01

    Full Text Available Radioimmunotherapy (RIT has been proven effective in the treatment of radiosensitive non-Hodgkin lymphoma but, for radioresistant solid tumors, new approaches are necessary to improve the clinical effectiveness. A real improvement has been the introduction of the pretargeting technology which appeared to be able to significantly increase tumor-to-normal organ uptake ratios.Another very promising approach consists in associating RIT with other treatment modalities. Finally the use of alpha particle-emitting radionuclides such as astatin-211 or bismuth-213 (alpha-RIT should allow to efficiently eradicate disseminated microscopic clusters of tumor cells or isolated tumor cells which fit well with the short path length of alpha particles.

  15. Sequential radioimmunotherapy with 177Lu- and 211At-labeled monoclonal antibody BR96 in a syngeneic rat colon carcinoma model

    DEFF Research Database (Denmark)

    Eriksson, Sophie E; Elgström, Erika; Bäck, Tom;

    2014-01-01

    UNLABELLED: Alpha-particle emitters, such as astatine-211 (211At), are generally considered suitable for the treatment of small cell clusters due to their short path length, while beta-particle emitters, for example, Lutetium-177 (177Lu), have a longer path length and are considered better for...... small, established tumors. A combination of such radionuclides may be successful in regimens of radioimmunotherapy. In this study, rats were treated by sequential administration of first a 177Lu-labeled antibody, followed by a 211At-labeled antibody 25 days later. METHODS: Rats bearing solid colon...... carcinoma tumors were treated with 400 MBq/kg body weight 177Lu-BR96. After 25 days, three groups of animals were given either 5 or 10 MBq/kg body weight of 211At-BR96 simultaneously with or without a blocking agent reducing halogen uptake in normal tissues. Control animals were not given any 211At-BR96...

  16. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  17. Development of 211At Chemistry for Labelling Biomolecules

    International Nuclear Information System (INIS)

    Our studies have demonstrated that high recovery of 211At can be obtained using a “wet chemistry” approach to isolation from the bismuth target. We have also demonstrated that direct labelling of antibody-B10 conjugates with 211At can be performed in high yields, and that the astatinated antibodies are stable to in vivo deastatination. While these results will allow us to enter clinical studies with 211At-labelled antibodies, the chemistry associated with 211At is not fully understood. Therefore, it is important that many more basic studies to be conducted with 211At, so the optimal labelling reagent for each type of disease-targeting agent becomes apparent

  18. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena;

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... levels of γH2AX decreased during the first 24h in both cycling and stationary cultures and complete repair was seen in all cultures but cycling cells exposed to (211)At. Compared to stationary cells alpha particles were more harmful for cycling cultures, an effect also seen at the pChk2 levels...... cultures at a modest level of damage, clearly demonstrating that cell cycle status influences the relative effectiveness of alpha particles....

  19. An improved synthesis of an 125I and 211At labelled benzamide for melanoma imaging

    International Nuclear Information System (INIS)

    Recent studies have indicated that benzamides can exhibit affinity for malignant melanoma and may be exploited diagnostically in the treatment of this cancer. Radioiodinated N-(2-diethylaminoethyl)-3-[123I/131I]iodo-4-methoxybenzamide (*I-IMBA) is a benzamide with promising diagnostic properties. A new synthesis procedure was developed to obtain 125I-IMBA suitable for use in vivo. The assets of the procedure include the use of less toxic reagents and better reproducible results when radiolabelling the precursor. The procedure also facilitates the synthesis of the astatinated N-(2-diethylaminoethyl)-3-[211At]astatine-4-methoxybenzamide (211At-AMBA), a new benzamide with a therapeutic potential. The regiospecific no-carrier-added 125I- and 211At-labeling of the benzamide is performed by demetalation of an organotin precursor. Using tributylstannyl as a leaving group, the radiochemical yield obtained after 15 minutes of reaction was 70 %-90 % for both 125I-IMBA and 211At-AMBA. The labelling was performed in a solution of MeOH:AcOH with NCS as the oxidising agent. The organotin precursor N-(2-diethylaminoethyl)-3-(tri-n-butylstannyl)-4-methoxy-benzamide was synthesized from 3-bromo-4-methoxybenzoic acid, with n-BuLi (2 eq) and Bu3SnCl (1 eq) in THF, giving 3-(tri-n-butylstannyl)-4-methoxybenzoic acid. The amide function was introduced by converting the acid group into an active N-succinimidyl-ester, a good leaving group in the reaction with 2-(diethylamino)ethylamine. The overall yield of the organotin precursor was 65 %

  20. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Energy Technology Data Exchange (ETDEWEB)

    Marsh, B.A., E-mail: bruce.marsh@cern.ch [CERN, CH-1211 Geneva (Switzerland); Andel, B. [Comenius University, Bratislava (Slovakia); Andreyev, A.N. [University of York, Department of Physics, York YO10 5DD (United Kingdom); Antalic, S. [Comenius University, Bratislava (Slovakia); Atanasov, D. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Barzakh, A.E. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, 188300 Gatchina (Russian Federation); Bastin, B. [Grand Accérateur National d’Ions Lourds (GANIL), Bd Henri Becquerel, F-14076 Caen (France); Borgmann, Ch. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Capponi, L. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Cocolios, T.E.; Day Goodacre, T. [CERN, CH-1211 Geneva (Switzerland); University of Manchester, Manchester (United Kingdom); Dehairs, M. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Derkx, X. [University of the West of Scotland, School of Engineering, Paisley PA1 2BE (United Kingdom); De Witte, H. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fedorov, D.V. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, 188300 Gatchina (Russian Federation); Fedosseev, V.N.; Focker, G.J. [CERN, CH-1211 Geneva (Switzerland); Fink, D.A. [Ruprecht-Karls Universität, Seminarstr. 2, 69117 Heidelberg (Germany); CERN, CH-1211 Geneva (Switzerland); Flanagan, K.T. [University of Manchester, Manchester (United Kingdom); Franchoo, S. [CSNSM-IN2P3-CNRS, Université Paris-Sud, 91406 Orsay (France); and others

    2013-12-15

    Highlights: • Upgrade of the lasers, detectors and data acquisition for in-source resonance ionization spectroscopy at ISOLDE. • First use of the ISOLTRAP MR-ToF MS in combination with laser spectroscopy at ISOLDE. • Resonance ionization of astatine for the study of its nuclear structure. -- Abstract: At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  1. Immunophilins and their function in photosystem II assembly

    Energy Technology Data Exchange (ETDEWEB)

    Sheng Luan

    2012-11-27

    In the past funding period, the following lines of experiments have been conducted: to identify the partner proteins for FKBP20-2; to identify the mechanism of CYP38 function; studies on other FKBPs in the thylakoid lumen; to identify the partner proteins for FKBP20-2 using yeast two hybrid and transgenic lines expressing HA-FKBP20-2; to identify the partner protein of CYP38; studies on other FKBPs in the chloroplast.

  2. AcEST: BP912162 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_G10 384 Adiantum capillus-veneris mRNA. clone: YMU001_000015_G10. BP912162 CL2655C ... 1 Query: 381 MVHKAIGDRLHCVFVDNGLLRFKERERVMSTFETDLHLPVT CVDASAKFLGKLKGVTDPE 202 ++HKAIGD+L CVFVDNGLLR E ++V ... 1 Query: 381 MVHKAIGDRLHCVFVDNGLLRFKERERVMSTFETDLHLPVT CVDASAKFLGKLKGVTDPE 202 + H+AIGD+LHC F+D+GLLR+KERE ... 1 Query: 381 MVHKAIGDRLHCVFVDNGLLRFKERERVMSTFETDLHLPVT CVDASAKFLGKLKGVTDPE 202 + +KAIGD+LHCVF+DNGLLR+ E E+ ... V F +L +PVT ... VD SA FL +LK +TDPE Sbjct: 238 LTYKAIGDQLHCVFIDNGLL ...

  3. Isotopic Composition of Gaseous Elemental Mercury in the Free Troposphere of the Pic du Midi Observatory, France.

    Science.gov (United States)

    Fu, Xuewu; Marusczak, Nicolas; Wang, Xun; Gheusi, François; Sonke, Jeroen E

    2016-06-01

    Understanding the sources and transformations of mercury (Hg) in the free troposphere is a critical aspect of global Hg research. Here we present one year of observations of atmospheric Hg speciation and gaseous elemental Hg (GEM) isotopic composition at the high-altitude Pic du Midi Observatory (2860 m above sea level) in France. Biweekly integrated GEM from February 2012 to January 2013 revealed significant variations in δ(202)HgGEM (-0.04‰ to 0.52‰) but not in Δ(199)HgGEM (-0.17‰ to -0.27‰) or Δ(200)HgGEM (-0.10‰ to 0.05‰). δ(202)HgGEM was negatively correlated with CO and reflected air mass origins from Europe (high CO, low δ(202)HgGEM) and from the Atlantic Ocean (low CO, high δ(202)HgGEM). We suggest that the δ(202)HgGEM variations represent mixing of recent low δ(202)HgGEM European anthropogenic emissions with high δ(202)HgGEM northern hemispheric background GEM. In addition, Atlantic Ocean free troposphere air masses showed a positive correlation between δ(202)HgGEM and gaseous oxidized Hg (GOM) concentrations, indicative of mass-dependent Hg isotope fractionation during GEM oxidation. On the basis of atmospheric δ(202)HgGEM and speciated Hg observations, we suggest that the oceanic free troposphere is a reservoir within which GEM is readily oxidized to GOM. PMID:27214126

  4. The effect of oxidative stress on phagocytosis and apoptosis in the earthworm Eisenia hortensis

    Directory of Open Access Journals (Sweden)

    SL Fuller-Espie

    2010-03-01

    Full Text Available The effect of exogenous hydrogen peroxide (H202 on phagocytic function and apoptosis in coelomocytes from Eisenia hortensis was investigated. Treating coelomocytes with H202 (0.26 to 8.4 mM evoked a significant increase in phagocytosis for one or more of the concentrations of H202 employed in 67 % of cases. Using annexin V-FITC we show that H202 induced apoptosis of coelomocytes in vitro. We found that 100 % of viable coelomocyte populations exhibited significant increases in phosphatidylserine translocation for one or more of the concentrations of H202 tested (8.4 to 67.6 mM. Using a fluorescent inhibitor of caspases, we revealed the presence of activated caspases observing increased caspase activity in 67 % of viable coelomocyte populations treated with 33.8mM H202, and in 100 % of cases treated with 67.6 mM H202. Agarose gel electrophoresis and the TUNEL assay showed DNA fragmentation in samples treated with 16.9 and 33.8 mM H202. In addition, endogenous H202 production during phagocytosis by hyaline amoebocytes was detected using a fluorogenic substrate. Thus, free radicals not only appear to facilitate phagocytosis and are produced during phagocytosis, but they also promote an oxidative-stress-induced apoptosis that may play an important function in regulating innate immune responses in E. hortensis

  5. 75 FR 44991 - Division of Longshore and Harbor Workers' Compensation; Proposed Extension of Information...

    Science.gov (United States)

    2010-07-30

    ... collection: Employer's First Report of Injury or Occupational Disease (LS-202) and Employer's Supplementary Report of Accident or Occupational Illness (LS-210). A copy of the proposed information...

  6. Comparative Embryological Studies on Infertility of Interspecific Hybridizations Between Oryza sativa with Different Ploidy Levels and O.officinalis

    Institute of Scientific and Technical Information of China (English)

    FU Xue-lin; LU Yong-gen; LIU Xiang-dong; LI Jin-quan; ZHAO Xing-juan

    2009-01-01

    As maternal parents, diploid (L202-2x) and autotetraploid (L202-4x) of Oryza sativa cv. L202 were crossed with O. officinalis. Embryo development and fertilization in these two crosses were comparatively studied. There were no mature hybrid seeds obtained because all the hybridized spikelets died 30 days after pollination. The main reasons for no seed set were abnormal fertilization and development of the embryos and endosperms in the interspecific hybrids. There were double- fertilization, egg cell single-fertilization and non-fertilization in these crosses. Although 59.45% and 54.87% of hybrid embryos produced in the crosses of L202-2x/O. officinalis and L202-4x/O. officinalis, respectively, hybrid embryos ceased to develop or degenerated and plenty of free endosperm nuclei were in disaggregating state without developing cellular endosperms three days after pollination. Besides, some embryological differences in these two crosses were found, that is, the rate of double-fertilization and total rate of double- and single-fertilization in L202-2x/O. officinalis were higher than those in L202-4x/O. officinalis. The embryo and endosperm of hybrids developed more slowly, and embryos and free endosperm nuclei were more severely degenerated in L202-4x/O. officinalis than in L202-2x/O. officinalis. Five days after pollination, a few of embryos in L202-2x/O. officinalis developed into pear-shaped ones, however, embryos in L202-4x/O. officinalis were all degenerated. Therefore, it is more difficult to obtain interspecific hybrids by wide crosses between autotetraploid of O. sativa and O. officinalis.

  7. Associativity of triangular norms characterized by the geometry of their level sets

    Czech Academy of Sciences Publication Activity Database

    Petrík, Milan; Sarkoci, P.

    2012-01-01

    Roč. 202, 1 September (2012), s. 100-109. ISSN 0165-0114 R&D Projects: GA ČR GAP202/10/1826 Institutional support: RVO:67985807 Keywords : associativity * contour * level set * Reidemeister closure condition * triangular norm * web geometry Subject RIV: BA - General Mathematics Impact factor: 1.749, year: 2012

  8. 76 FR 15340 - Certain Festive Articles: Recommendations for Modifying the Harmonized Tariff Schedule of the...

    Science.gov (United States)

    2011-03-21

    ... published in the Federal Register of December 2, 2010 (75 FR 75185)). This notice is being issued as an... COMMISSION Certain Festive Articles: Recommendations for Modifying the Harmonized Tariff Schedule of the... Beck, Director, Office of Tariff Affairs and Trade Agreements (202-205-2603, fax 202-205-2616,...

  9. 76 FR 31785 - Prevailing Rate Systems; Redefinition of the Madison, Wisconsin, and Southwestern Wisconsin...

    Science.gov (United States)

    2011-06-02

    ..., (202) 606-2838; e- mail pay-leave-policy@opm.gov ; or FAX: (202) 606-4264. SUPPLEMENTARY INFORMATION: On November 18, 2010, the U.S. Office of Personnel Management (OPM) issued a proposed rule (75 FR... Grant Green Green Lake Iowa Jefferson Lafayette Marquette Rock Sauk Waushara * * * * *...

  10. 78 FR 20357 - NASA Advisory Council; Science Committee; Meeting

    Science.gov (United States)

    2013-04-04

    ... CONTACT: Ms. Marian Norris, Science Mission Directorate, NASA Headquarters, Washington, DC 20546, (202... Norris via email at mnorris@nasa.gov or by fax at (202) 358- 3094. U.S. citizens and Permanent Residents... meeting to Marian Norris. Patricia D. Rausch, Advisory Committee Management Officer, National...

  11. 77 FR 71641 - NASA Advisory Council; Science Committee; Planetary Protection Subcommittee; Meeting

    Science.gov (United States)

    2012-12-03

    ... CONTACT: Ms. Marian Norris, Science Mission Directorate, NASA Headquarters, Washington, DC 20546, (202... home address to Marian Norris via email at mnorris@nasa.gov or by fax at (202) 358- 1377. U.S. citizens... meeting to Marian Norris. Susan M. Burch, Acting Advisory Committee Management Officer,...

  12. 76 FR 47518 - Energy Conservation Program: Treatment of “Smart” Appliances in Energy Conservation Standards and...

    Science.gov (United States)

    2011-08-05

    ... Appliances, EERE-2011-BT-NOA-0038, 1000 ] Independence Avenue, SW., Washington, DC 20585-0121. Phone: (202.... Phone: (202) 586-2945. Please submit one signed paper original. Instructions: All submissions received... appliance to change its normal operating behavior in response to a signal from a utility or another...

  13. Anemia of Inflammation and Chronic Disease

    Science.gov (United States)

    ... 699–710. 4 Anemia of Inflammation and Chronic Disease Eating, Diet, and Nutrition People with anemia caused by ... Phone: 202–776–0544 Fax: 202–776–0545 Internet: www. hematology. org Iron Disorders Institute P.O. Box 675 Taylors, SC 29687 ...

  14. EST Table: BY914788 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BY914788 ceN-2673 10/09/28 100 %/202 aa ref|NP_001036916.1| G protein alpha subunit Go isoform 1 ... 8 86 %/202 aa C26C6.2#CE05311#WBGene00001648#locus:goa -1#guanine nucleotide-binding protein#status:Confir ...

  15. 75 FR 29798 - Bureau of Educational and Cultural Affairs (ECA) Request for Grant Proposals: Survey of...

    Science.gov (United States)

    2010-05-27

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF STATE Bureau... Package Please contact the Educational Information and Resources Branch, ECA/A/S/A, SA-5, 4th Floor, U.S. Department of State, 2200 C Street, NW., Washington, DC 20522-0504, telephone 202-632-6354, fax 202-632-...

  16. 75 FR 42375 - Trade Adjustment Assistance for Farmers

    Science.gov (United States)

    2010-07-21

    ... Foreign Agricultural Service Trade Adjustment Assistance for Farmers AGENCY: Foreign Agricultural Service... Assistance for Farmers Staff, FAS, USDA, by phone: (202) 720-0638, or (202) 690-0633; or by e-mail: tradeadjustment@fas.usda.gov ; or visit the TAA for Farmers' Web site: http://www.fas.usda.gov/itp/taa ....

  17. 75 FR 42376 - Trade Adjustment Assistance for Farmers

    Science.gov (United States)

    2010-07-21

    ... Foreign Agricultural Service Trade Adjustment Assistance for Farmers AGENCY: Foreign Agricultural Service... Assistance for Farmers Staff, FAS, USDA, by phone: (202) 720-0638, or (202) 690-0633; or by e-mail: tradeadjustment@fas.usda.gov ; or visit the TAA for Farmers' Web site: http:// www.fas.usda.gov/itp/taa ....

  18. 75 FR 41430 - Trade Adjustment Assistance for Farmers

    Science.gov (United States)

    2010-07-16

    ...; ] DEPARTMENT OF AGRICULTURE Foreign Agricultural Service Trade Adjustment Assistance for Farmers AGENCY... Economic Research Service and reviewed by the TAA for Farmers Review Committee, comprised of... Assistance for Farmers Staff, FAS, USDA, by phone: (202) 720-0638, or (202) 690-0633; or by...

  19. 75 FR 51978 - Trade Adjustment Assistance for Farmers

    Science.gov (United States)

    2010-08-24

    ... Foreign Agricultural Service Trade Adjustment Assistance for Farmers AGENCY: Foreign Agricultural Service... Assistance for Farmers Program Staff, FAS, USDA by phone: (202) 720-0638 or (202) 690- 0633: or by e-mail at: tradeadjustment@fas.usda.gov ; or visit the TAA for Farmers' Web site: http://www.fas.usda.gov/itp/taa ....

  20. 75 FR 43485 - Trade Adjustment Assistance for Farmers

    Science.gov (United States)

    2010-07-26

    ...; ] DEPARTMENT OF AGRICULTURE Foreign Agricultural Service Trade Adjustment Assistance for Farmers AGENCY...: Trade Adjustment Assistance for Farmers Staff, FAS, USDA, by phone: (202) 720-0638, or (202) 690-0633; or by e-mail: tradeadjustment@fas.usda.gov ; or visit the TAA for Farmers' Web site:...