WorldWideScience

Sample records for astatine 202

  1. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  2. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-09-15

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Discovery of the astatine, radon, francium, and radium isotopes

    Science.gov (United States)

    Fry, C.; Thoennessen, M.

    2013-09-01

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration

    2011-11-30

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  6. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Science.gov (United States)

    Uusitalo, J.; Jakobsson, U.

    2011-11-01

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  7. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy.

    Science.gov (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  9. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others

    2015-10-15

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  10. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Science.gov (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.

    2015-10-01

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  11. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  12. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  13. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  14. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  15. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  16. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  17. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  18. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study

    Science.gov (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi

    2018-01-01

    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).

  19. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  20. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  1. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  2. Comment: 202 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available black-headed gull Larus ridibundus Larus_ridibundus_L.png 202.png Takeru Nakazato (Database Center for Life...: Takeru Nakazato (Database Center for Life Science) すみません。JPEGであげようとしてしまった。 PNGで。 nakazato 2008/12/22 09:56:50 2010/01/14 20:12:21 ...

  3. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  4. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  5. Main: PPD202 [AT Atlas

    Lifescience Database Archive (English)

    Full Text Available cherichia coli Development of innovative methods to support membrane protein crystallization Hiroaki Kato Graduate School of Pharmace...utical Sciences, Kyoto University J. Mol. Biol. (1996) 8757792 PPD202.csml ...

  6. 40 CFR 202.12 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Applicability. 202.12 Section 202.12 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS MOTOR CARRIERS... to snow plows when in operation. (f) The provisions of § 202.20(a) and § 202.21(a) of Subpart B apply...

  7. 28 CFR 36.202 - Activities.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Activities. 36.202 Section 36.202 Judicial Administration DEPARTMENT OF JUSTICE NONDISCRIMINATION ON THE BASIS OF DISABILITY BY PUBLIC ACCOMMODATIONS AND IN COMMERCIAL FACILITIES General Requirements § 36.202 Activities. (a) Denial of participation...

  8. 41 CFR 109-27.202 - Applicability.

    Science.gov (United States)

    2010-07-01

    ...-INVENTORY MANAGEMENT 27.2-Management of Shelf-Life Materials § 109-27.202 Applicability. When considered... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Applicability. 109-27.202 Section 109-27.202 Public Contracts and Property Management Federal Property Management...

  9. 27 CFR 70.202 - Intervention.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Intervention. 70.202 Section 70.202 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT... Excise and Special (Occupational) Tax Judicial Proceedings § 70.202 Intervention. If the United States is...

  10. 37 CFR 202.2 - Copyright notice.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Copyright notice. 202.2 Section 202.2 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES PREREGISTRATION AND REGISTRATION OF CLAIMS TO COPYRIGHT § 202.2 Copyright notice. (a...

  11. 47 CFR 24.202 - Service areas.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Service areas. 24.202 Section 24.202... SERVICES Broadband PCS § 24.202 Service areas. Broadband PCS service areas are Major Trading Areas (MTAs) and Basic Trading Areas (BTAs) as defined in this section. MTAs and BTAs are based on the Rand McNally...

  12. 24 CFR 202.12 - Title II.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Title II. 202.12 Section 202.12... INSTITUTIONS AND MORTGAGEES Title I and Title II Specific Requirements § 202.12 Title II. (a) Tiered pricing—(1... mortgagee approved for participation in Title II programs is notified by the Secretary that it had a rate of...

  13. 24 CFR 202.11 - Title I.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Title I. 202.11 Section 202.11... INSTITUTIONS AND MORTGAGEES Title I and Title II Specific Requirements § 202.11 Title I. (a) Administrative... may be imposed under the Title I program. The administrative actions that may be applied are set forth...

  14. 20 CFR 202.13 - Electric railways.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Electric railways. 202.13 Section 202.13... THE ACT § 202.13 Electric railways. (a) The Deputy General Counsel will require the submission of information pertaining to the history and operations of an electric railway with a view to determining whether...

  15. 46 CFR 184.202 - Restrictions.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Restrictions. 184.202 Section 184.202 Shipping COAST... CONTROL AND MISCELLANEOUS SYSTEMS AND EQUIPMENT Cooking and Heating § 184.202 Restrictions. (a) The use of... in § 184.240 of this part. The use of these fuels for cooking, heating, and lighting on ferry vessels...

  16. 19 CFR 202.6 - Reports.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Reports. 202.6 Section 202.6 Customs Duties UNITED... PRODUCTION § 202.6 Reports. After the completion of its investigation, the Commission will incorporate its findings in a report, and the report will be transmitted to the President. ...

  17. 7 CFR 20.2 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Administration. 20.2 Section 20.2 Agriculture Office of the Secretary of Agriculture EXPORT SALES REPORTING REQUIREMENTS § 20.2 Administration. The regulations of this part will be administered by the Foreign Agricultural Service (FAS) under the general...

  18. 7 CFR 25.202 - Strategic plan.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Strategic plan. 25.202 Section 25.202 Agriculture... Procedure § 25.202 Strategic plan. (a) Principles of strategic plan. The strategic plan included in the application must be developed in accordance with the following four key principles: (1) Strategic vision for...

  19. 20 CFR 202.4 - Control.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Control. 202.4 Section 202.4 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT EMPLOYERS UNDER THE ACT § 202.4 Control. A company or person is controlled by one or more carriers, whenever there exists in one...

  20. 12 CFR 303.202 - Processing.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Processing. 303.202 Section 303.202 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION PROCEDURE AND RULES OF PRACTICE FILING PROCEDURES Prompt Corrective Action § 303.202 Processing. The FDIC will provide the applicant with a subsequent written...

  1. 5 CFR 720.202 - Definitions.

    Science.gov (United States)

    2010-01-01

    ...) AFFIRMATIVE EMPLOYMENT PROGRAMS Federal Equal Opportunity Recruitment Program § 720.202 Definitions. For the... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Definitions. 720.202 Section 720.202... of a minority group within a category of civil service employment constitutes a lower percentage of...

  2. Dicty_cDB: CHF202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHF202 (Link to dictyBase) - - - Contig-U11551-1 CHF202P (Link to Original site) CHF...202F 646 CHF202Z 654 CHF202P 1280 - - Show CHF202 Library CH (Link to library) Clone ID CHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHF2-A/CHF202Q.Seq.d/ Representative seq. ID CHF...202P (Link to Original site) Representative DNA sequence >CHF202 (CHF202Q) /CSM/CH/CHF2-A/CHF...AAAAAAGTAAATAAAAAAAATAAAAAA sequence update 2002.10.25 Translated Amino Acid sequence fyfifgnfkthfhiifflly*N

  3. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.

    2017-04-01

    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  4. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination.

    Science.gov (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick

    2007-01-01

    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  5. Dicty_cDB: CHR202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR202 (Link to dictyBase) - - - Contig-U16475-1 CHR202P (Link to Original site) CHR...202F 615 CHR202Z 786 CHR202P 1381 - - Show CHR202 Library CH (Link to library) Clone ID CHR...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHR2-A/CHR202Q.Seq.d/ Representative seq. ID CHR...202P (Link to Original site) Representative DNA sequence >CHR202 (CHR202Q) /CSM/CH/CHR2-A/CHR...nt alignments: (bits) Value CHR202 (CHR202Q) /CSM/CH/CHR2-A/CHR202Q.Seq.d/ 2619 0

  6. 18 CFR 292.202 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Definitions. 292.202 Section 292.202 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT... Definitions. For purposes of this subpart: (a) Biomass means any organic material not derived from fossil...

  7. 5 CFR 734.202 - Permitted activities.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Permitted activities. 734.202 Section 734... (CONTINUED) POLITICAL ACTIVITIES OF FEDERAL EMPLOYEES Permitted Activities § 734.202 Permitted activities. Employees may take an active part in political activities, including political management and political...

  8. 48 CFR 47.202 - Presolicitation planning.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Presolicitation planning. 47.202 Section 47.202 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT... Presolicitation planning. Contracting officers shall inform activities that plan to acquire transportation or...

  9. 37 CFR 202.11 - Architectural works.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Architectural works. 202.11 Section 202.11 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE... Protection Act, title VII of the Judicial Improvements Act of 1990, Public Law 101-650. (b) Definitions. (1...

  10. 41 CFR 101-27.202 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Applicability. 101-27.202 Section 101-27.202 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 27-INVENTORY MANAGEMENT 27.2-Management of...

  11. 7 CFR 205.202 - Land requirements.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Land requirements. 205.202 Section 205.202 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) ORGANIC FOODS PRODUCTION ACT PROVISIONS NATIONAL ORGANIC PROGRAM Organic...

  12. 41 CFR 101-29.202 - Standard.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Standard. 101-29.202 Section 101-29.202 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 29-FEDERAL PRODUCT DESCRIPTIONS 29.2...

  13. 50 CFR 222.202 - Certificate renewal.

    Science.gov (United States)

    2010-10-01

    ... whom a Certificate of Exemption has been issued by the National Marine Fisheries Service may apply to... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Certificate renewal. 222.202 Section 222.202 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC...

  14. 12 CFR 202.4 - General rules.

    Science.gov (United States)

    2010-01-01

    ... electronic form, subject to compliance with the consumer consent and other applicable provisions of the Electronic Signatures in Global and National Commerce Act (E-Sign Act) (15 U.S.C. 7001 et seq.). Where the... by §§ 202.5 and 202.13, in a form the applicant may retain. (2) Disclosures in electronic form. The...

  15. 5 CFR 339.202 - Medical standards.

    Science.gov (United States)

    2010-01-01

    ... require a certain level of health status or fitness because the nature of the positions involve a high... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Medical standards. 339.202 Section 339.202 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS MEDICAL...

  16. 27 CFR 24.202 - Dried fruit.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Dried fruit. 24.202... OF THE TREASURY LIQUORS WINE Production of Agricultural Wine § 24.202 Dried fruit. In the production of wine from dried fruit, a quantity of water sufficient to restore the moisture content to that of...

  17. 40 CFR 600.202-77 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-Procedures for Calculating Fuel Economy Values § 600.202-77 Definitions. The... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Definitions. 600.202-77 Section 600...

  18. 48 CFR 31.202 - Direct costs.

    Science.gov (United States)

    2010-10-01

    ... REQUIREMENTS CONTRACT COST PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations 31.202 Direct... amount as an indirect cost if the accounting treatment— (1) Is consistently applied to all final cost... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Direct costs. 31.202...

  19. 18 CFR 281.202 - Applicability.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Applicability. 281.202 Section 281.202 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT... Corporation. Tennessee Gas Pipeline Company, a Division of Tenneco, Inc. Tennessee Natural Gas Lines. Texas...

  20. 7 CFR 956.202 - Assessment rate.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Assessment rate. 956.202 Section 956.202 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE SWEET ONIONS GROWN IN THE WALLA WALLA VALLEY OF SOUTHEAST WASHINGTON AND...

  1. 40 CFR 86.202-94 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Definitions. 86.202-94 Section 86.202-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...

  2. 31 CFR 202.3 - Authorization.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Authorization. 202.3 Section 202.3 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE DEPOSITARIES AND FINANCIAL AGENTS OF THE FEDERAL...

  3. 31 CFR 202.2 - Designations.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Designations. 202.2 Section 202.2 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE DEPOSITARIES AND FINANCIAL AGENTS OF THE FEDERAL...

  4. 31 CFR 202.6 - Collateral security.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Collateral security. 202.6 Section 202.6 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE... section to the Federal Reserve Bank of the district, as fiscal agent of the United States, and in any...

  5. 31 CFR 800.202 - Certification.

    Science.gov (United States)

    2010-07-01

    ... TAKEOVERS BY FOREIGN PERSONS Definitions § 800.202 Certification. (a) The term certification means a written... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Certification. 800.202 Section 800... material respects, as it relates to: (i) The transaction, and (ii) The party providing the certification...

  6. 5 CFR 9701.202 - Coverage.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Coverage. 9701.202 Section 9701.202 Administrative Personnel DEPARTMENT OF HOMELAND SECURITY HUMAN RESOURCES MANAGEMENT SYSTEM (DEPARTMENT OF HOMELAND SECURITY-OFFICE OF PERSONNEL MANAGEMENT) DEPARTMENT OF HOMELAND SECURITY HUMAN RESOURCES...

  7. 14 CFR 1212.202 - Identification procedures.

    Science.gov (United States)

    2010-01-01

    ... REGULATIONS Access to Records § 1212.202 Identification procedures. (a) The system manager will release records to the requester or representative in person only upon production of satisfactory identification... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Identification procedures. 1212.202 Section...

  8. Dicty_cDB: CHB202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) CHB202 (Link to dictyBase) - - - Contig-U14945-1 - (Link to Original site) - - CHB202Z 608 -...- - - - Show CHB202 Library CH (Link to library) Clone ID CHB202 (Link to dictyBase) Atlas ID - NBRP ID...URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHB2-A/CHB202Q.Seq.d/ Representative seq. ID - (Link to Original...site) Representative DNA sequence >CHB202 (CHB202Q) /CSM/CH/CHB2-A/CHB202Q.Seq.d/ XXXXXXXXXXCAATGGTGACC.../CSM/SF/SFF1-B/SFF145Q.Seq.d/ 1185 0.0 CHB202 (CHB202Q) /CSM/CH/CHB2-A/CHB202Q.Seq.d/ 1185 0.0 CFG295 (CFG295Q)

  9. 48 CFR 44.202-1 - Responsibilities.

    Science.gov (United States)

    2010-10-01

    ... SUBCONTRACTING POLICIES AND PROCEDURES Consent to Subcontracts 44.202-1 Responsibilities. (a) The cognizant... notification and supporting data to ensure that the proposed subcontract is appropriate for the risks involved...

  10. 48 CFR 251.202 - Authorization.

    Science.gov (United States)

    2010-10-01

    ... OF DEFENSE CONTRACT MANAGEMENT USE OF GOVERNMENT SOURCES BY CONTRACTORS Contractor Use of Interagency Fleet Management System (IFMS) Vehicles 251.202 Authorization. (a)(2)(A) See FAR 28.307-2(c) for policy...

  11. 48 CFR 19.202-4 - Solicitation.

    Science.gov (United States)

    2010-10-01

    ... citations to each major Federal law or agency rule with which such business concern must comply in performing such contract other than laws or agency rules with which the small business must comply when doing... PROGRAMS SMALL BUSINESS PROGRAMS Policies 19.202-4 Solicitation. The contracting officer must encourage...

  12. 15 CFR 2011.202 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... authority hereafter may be delegated to act in his place. (i) Specialty sugar means brown slab sugar (also... TRADE REPRESENTATIVE ALLOCATION OF TARIFF-RATE QUOTA ON IMPORTED SUGARS, SYRUPS AND MOLASSES Specialty Sugar § 2011.202 Definitions. Unless the context otherwise requires, for the purpose of this subpart...

  13. 5 CFR 534.202 - Coverage.

    Science.gov (United States)

    2010-01-01

    ... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PAY UNDER OTHER SYSTEMS Student-Employees in Government Hospitals § 534.202 Coverage. In addition to the student-employees specified in 5 U.S.C. 5351(2)(A), the following student-employees are covered under this program, provided they are...

  14. 5 CFR 430.202 - Coverage.

    Science.gov (United States)

    2010-01-01

    ... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERFORMANCE MANAGEMENT Performance Appraisal for General Schedule, Prevailing Rate, and Certain Other Employees § 430.202 Coverage. (a) Employees and agencies covered by statute. (1) Section 4301(1) of title 5, United States Code...

  15. 40 CFR 91.202 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... EMISSIONS FROM MARINE SPARK-IGNITION ENGINES Averaging, Banking, and Trading Provisions § 91.202 Definitions... families within a given manufacturer's product line. Banking means the retention of marine SI engine emission credits by the manufacturer generating the emission credits for use in future model year averaging...

  16. 48 CFR 11.202 - Maintenance of standardization documents.

    Science.gov (United States)

    2010-10-01

    ... standardization documents. 11.202 Section 11.202 Federal Acquisition Regulations System FEDERAL ACQUISITION... Maintenance of standardization documents. (a) Recommendations for changes to standardization documents listed..., DC 20406. Agencies shall submit recommendations for changes to standardization documents listed in...

  17. 5 CFR 2610.202 - Net worth exhibit.

    Science.gov (United States)

    2010-01-01

    ....202 Administrative Personnel OFFICE OF GOVERNMENT ETHICS ORGANIZATION AND PROCEDURES IMPLEMENTATION OF THE EQUAL ACCESS TO JUSTICE ACT Information Required From Applicants § 2610.202 Net worth exhibit. (a... Government Ethics' established procedures under the Freedom of Information Act. ...

  18. 32 CFR 202.4 - Composition of a RAB.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Composition of a RAB. 202.4 Section 202.4 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS RESTORATION ADVISORY BOARDS General Requirements § 202.4 Composition of a RAB. (a) Membership. At...

  19. 40 CFR 246.202-5 - Recommended procedures: Transportation.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended procedures: Transportation. 246.202-5 Section 246.202-5 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... § 246.202-5 Recommended procedures: Transportation. Transportation to market may be supplied by either...

  20. 5 CFR 1216.202 - Factors the MSPB will consider.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Factors the MSPB will consider. 1216.202 Section 1216.202 Administrative Personnel MERIT SYSTEMS PROTECTION BOARD ORGANIZATION AND PROCEDURES... PROCEEDINGS Demands or Requests for Testimony and Production of Documents § 1216.202 Factors the MSPB will...

  1. 5 CFR 2417.202 - Factors the FLRA will consider.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Factors the FLRA will consider. 2417.202 Section 2417.202 Administrative Personnel FEDERAL LABOR RELATIONS AUTHORITY, GENERAL COUNSEL OF THE... or Requests for Testimony and Production of Documents § 2417.202 Factors the FLRA will consider. The...

  2. 4 CFR 202.3 - Prohibitions against misuse of seal.

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false Prohibitions against misuse of seal. 202.3 Section 202.3 Accounts RECOVERY ACCOUNTABILITY AND TRANSPARENCY BOARD OFFICIAL SEAL § 202.3 Prohibitions against misuse of seal. (a) Falsely making, forging, counterfeiting, mutilating, or altering the Board seal or...

  3. 4 CFR 202.2 - Authority to affix seal.

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false Authority to affix seal. 202.2 Section 202.2 Accounts RECOVERY ACCOUNTABILITY AND TRANSPARENCY BOARD OFFICIAL SEAL § 202.2 Authority to affix seal. (a) The following officials of the Board are authorized to affix the official seal (including reproductions) to...

  4. 48 CFR 411.202 - Maintenance of standardization documents.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Maintenance of standardization documents. 411.202 Section 411.202 Federal Acquisition Regulations System DEPARTMENT OF... Documents 411.202 Maintenance of standardization documents. Recommendations for changes to standardization...

  5. 7 CFR 202.1 - Meaning of words.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Meaning of words. 202.1 Section 202.1 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... RULES OF PRACTICE General § 202.1 Meaning of words. As used in this part, words in the singular form...

  6. 37 CFR 202.1 - Material not subject to copyright.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Material not subject to copyright. 202.1 Section 202.1 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES PREREGISTRATION AND REGISTRATION OF CLAIMS TO COPYRIGHT § 202.1 Material not...

  7. 30 CFR 202.151 - Royalty on processed gas.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Royalty on processed gas. 202.151 Section 202... MANAGEMENT ROYALTIES Federal Gas § 202.151 Royalty on processed gas. (a)(1) A royalty, as provided in the... settlement without resorting to processing; and (ii) Residue gas and all gas plant products resulting from...

  8. 30 CFR 202.150 - Royalty on gas.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Royalty on gas. 202.150 Section 202.150 Mineral... Federal Gas § 202.150 Royalty on gas. (a) Royalties due on gas production from leases subject to the... part 206 of this title multiplied by the royalty rate in the lease. (b)(1) All gas (except gas...

  9. 40 CFR 57.202 - How to apply.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 5 2010-07-01 2010-07-01 false How to apply. 57.202 Section 57.202... NONFERROUS SMELTER ORDERS The Application and the NSO Process § 57.202 How to apply. (a) Letter of intent. To... to apply for an NSO, and an agreement to provide any information required under this part. The letter...

  10. 37 CFR 202.4 - Effective date of registration.

    Science.gov (United States)

    2010-07-01

    ... registration. 202.4 Section 202.4 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES PREREGISTRATION AND REGISTRATION OF CLAIMS TO COPYRIGHT § 202.4 Effective date of registration. The effective date of registration for claims received in the Copyright Office on...

  11. 12 CFR 268.202 - Equal Pay Act.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Equal Pay Act. 268.202 Section 268.202 Banks... REGARDING EQUAL OPPORTUNITY Provisions Applicable to Particular Complaints § 268.202 Equal Pay Act. Complaints alleging violations of the Equal Pay Act shall be processed under this part. ...

  12. 29 CFR 1614.202 - Equal Pay Act.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 4 2010-07-01 2010-07-01 false Equal Pay Act. 1614.202 Section 1614.202 Labor Regulations... OPPORTUNITY Provisions Applicable to Particular Complaints § 1614.202 Equal Pay Act. (a) In its enforcement of the Equal Pay Act, the Commission has the authority to investigate an agency's employment practices on...

  13. 10 CFR 800.202 - Loan terms and conditions.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Loan terms and conditions. 800.202 Section 800.202 Energy... CONTRACTS AND ASSISTANCE Loans § 800.202 Loan terms and conditions. (a) The loan shall be based upon a loan... authorization necessary for the continued operation of the business throughout the term of the loan. (9) The...

  14. 5 CFR 581.202 - Service of process.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Service of process. 581.202 Section 581.202 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROCESSING GARNISHMENT ORDERS FOR CHILD SUPPORT AND/OR ALIMONY Service of Process § 581.202 Service of process. (a) A...

  15. 5 CFR 582.202 - Service of legal process.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Service of legal process. 582.202 Section 582.202 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS COMMERCIAL GARNISHMENT OF FEDERAL EMPLOYEES' PAY Service of Legal Process § 582.202 Service of legal process. (a) A...

  16. 48 CFR 214.202-5 - Descriptive literature.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Descriptive literature. 214.202-5 Section 214.202-5 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... 214.202-5 Descriptive literature. (c) Requirements of invitation for bids. When brand name or equal...

  17. 48 CFR 1442.202 - Assignment of contract administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Assignment of contract administration. 1442.202 Section 1442.202 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR CONTRACT MANAGEMENT CONTRACT ADMINISTRATION AND AUDIT SERVICES Contract Administration Services 1442.202 Assignment of contract administration. ...

  18. 48 CFR 1342.202 - Assignment of contract administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Assignment of contract administration. 1342.202 Section 1342.202 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CONTRACT MANAGEMENT CONTRACT ADMINISTRATION Contract Administration Services 1342.202 Assignment of contract administration. The designee authorized...

  19. 32 CFR 202.8 - Training RAB members.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Training RAB members. 202.8 Section 202.8...) MISCELLANEOUS RESTORATION ADVISORY BOARDS Operating Requirements § 202.8 Training RAB members. Training is not required for RAB members. It may be advisable, however, to provide RAB members with some initial...

  20. 41 CFR 109-38.202-50 - Security.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Security. 109-38.202-50 Section 109-38.202-50 Public Contracts and Property Management Federal Property Management Regulations....202-50 Security. Unissued license tags shall be stored in a locked drawer, cabinet, or storage area...

  1. 7 CFR 1260.202 - Books and records.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and records. 1260.202 Section 1260.202 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... Promotion and Research Order Reports, Books and Records § 1260.202 Books and records. Each person subject to...

  2. 5 CFR 410.202 - Responsibilities for evaluating training.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Responsibilities for evaluating training. 410.202 Section 410.202 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS TRAINING Planning and Evaluating Training § 410.202 Responsibilities for evaluating training...

  3. Draft genome sequence of the coccolithovirus Emiliania huxleyi virus 202.

    Science.gov (United States)

    Nissimov, Jozef I; Worthy, Charlotte A; Rooks, Paul; Napier, Johnathan A; Kimmance, Susan A; Henn, Matthew R; Ogata, Hiroyuki; Allen, Michael J

    2012-02-01

    Emiliania huxleyi virus 202 (EhV-202) is a member of the Coccolithoviridae, a group of viruses that infect the marine coccolithophorid Emiliania huxleyi. EhV-202 has a 160- to 180-nm-diameter icosahedral structure and a genome of approximately 407 kbp, consisting of 485 coding sequences (CDSs). Here we describe the genomic features of EhV-202, together with a draft genome sequence and its annotation, highlighting the homology and heterogeneity of this genome in comparison with the EhV-86 reference genome.

  4. Draft Genome Sequence of the Coccolithovirus Emiliania huxleyi Virus 202

    OpenAIRE

    Nissimov, Jozef I.; Worthy, Charlotte A.; Rooks, Paul; Napier, Johnathan A.; Kimmance, Susan A.; Henn, Matthew R.; Ogata, Hiroyuki; Allen, Michael J.

    2012-01-01

    Emiliania huxleyi virus 202 (EhV-202) is a member of the Coccolithoviridae, a group of viruses that infect the marine coccolithophorid Emiliania huxleyi. EhV-202 has a 160- to 180-nm-diameter icosahedral structure and a genome of approximately 407 kbp, consisting of 485 coding sequences (CDSs). Here we describe the genomic features of EhV-202, together with a draft genome sequence and its annotation, highlighting the homology and heterogeneity of this genome in comparison with the EhV-86 refe...

  5. 29 CFR 530.202 - Piece rates-work measurement.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Piece rates-work measurement. 530.202 Section 530.202 Labor... Piece rates—work measurement. (a) No certificate will be issued pursuant to § 530.101 of subpart B to an employer who pays homeworkers based on piece rates unless the employer establishes the piece rates for the...

  6. 9 CFR 202.3 - Institution of proceedings.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Institution of proceedings. 202.3 Section 202.3 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS... proceedings. (a) Informal complaint. Any interested person desiring to complain of the lawfulness of any rate...

  7. 48 CFR 242.202 - Assignment of contract administration.

    Science.gov (United States)

    2010-10-01

    ... the military department, and subject to prior agreement, perform contract administration services on a... subcontract that includes foreign contract military sale (FMS) requirements, the contract administration... administration. 242.202 Section 242.202 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS...

  8. 10 CFR 72.202 - Participation in license reviews.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Participation in license reviews. 72.202 Section 72.202 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSING REQUIREMENTS FOR THE INDEPENDENT STORAGE OF... reviews. States, local governmental bodies and affected, Federally-recognized Indian Tribes may...

  9. 5 CFR 295.202 - Factors OPM will consider.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Factors OPM will consider. 295.202... PROCEEDINGS Requests for Testimony and Production of Documents § 295.202 Factors OPM will consider. The... would assist or hinder OPM in performing its statutory duties or use OPM resources in a way that will...

  10. 10 CFR 1707.202 - Factors DNFSB will consider.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Factors DNFSB will consider. 1707.202 Section 1707.202... will consider. The General Counsel, in his or her sole discretion, may grant an employee permission to... where responding to the request will interfere with the ability of DNFSB employees to do their work; (e...

  11. 5 CFR 2608.202 - Factors OGE will consider.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Factors OGE will consider. 2608.202... PROCEEDINGS Requests for Testimony and Production of Documents § 2608.202 Factors OGE will consider. The... request will interfere with the ability of OGE employees to do their work; (e) Allowing such testimony or...

  12. 40 CFR 266.202 - Definition of solid waste.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Definition of solid waste. 266.202 Section 266.202 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS FOR THE MANAGEMENT OF SPECIFIC HAZARDOUS WASTES AND SPECIFIC TYPES OF HAZARDOUS WASTE...

  13. 30 CFR 90.202 - Certified person; sampling.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Certified person; sampling. 90.202 Section 90... Sampling Procedures § 90.202 Certified person; sampling. (a) The respirable dust sampling required by this... on sampling of respirable coal mine dust. (c) A person may be temporarily certified by MSHA to take...

  14. 30 CFR 71.202 - Certified person; sampling.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Certified person; sampling. 71.202 Section 71... Sampling Procedures § 71.202 Certified person; sampling. (a) The respirable dust sampling required by this... on sampling of respirable coal mine dust. (c) A person may be temporarily certified by MSHA to take...

  15. 30 CFR 70.202 - Certified person; sampling.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Certified person; sampling. 70.202 Section 70... HEALTH MANDATORY HEALTH STANDARDS-UNDERGROUND COAL MINES Sampling Procedures § 70.202 Certified person; sampling. (a) The respirable dust sampling required by this part shall be done by a certified person. (b...

  16. 9 CFR 202.101 - Rule 1: Meaning of words.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Rule 1: Meaning of words. 202.101 Section 202.101 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION...: Meaning of words. In these rules, words in the singular form shall be deemed to import the plural, and...

  17. 7 CFR 22.202 - Federal unit responsibilities.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Federal unit responsibilities. 22.202 Section 22.202 Agriculture Office of the Secretary of Agriculture RURAL DEVELOPMENT COORDINATION Roles and Responsibilities..., Commerce, Transportation, Environmental Protection Agency, Small Business Administration and others as...

  18. 9 CFR 202.121 - Rule 21: Intervention.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Rule 21: Intervention. 202.121 Section 202.121 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS...: Intervention. At any time after docketing of a proceeding and before commencement of a hearing, oral or written...

  19. 7 CFR 1416.202 - Eligible owners and contract growers.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Eligible owners and contract growers. 1416.202... DISASTER ASSISTANCE PROGRAMS Livestock Indemnity Program II § 1416.202 Eligible owners and contract growers. (a) To be considered eligible, a livestock owner must have had legal ownership of the eligible...

  20. 48 CFR 14.202-1 - Bidding time.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Bidding time. 14.202-1... AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 14.202-1 Bidding time. (a) Policy. A reasonable time for prospective bidders to prepare and submit bids shall be allowed in all invitations, consistent...

  1. 27 CFR 31.202 - Possession of refilled liquor bottles.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Possession of refilled liquor bottles. 31.202 Section 31.202 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS ALCOHOL BEVERAGE DEALERS Reuse and Possession of Used...

  2. 48 CFR 3042.202 - Assignment of contract administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Assignment of contract administration. 3042.202 Section 3042.202 Federal Acquisition Regulations System DEPARTMENT OF HOMELAND SECURITY, HOMELAND SECURITY ACQUISITION REGULATION (HSAR) CONTRACT MANAGEMENT CONTRACT ADMINISTRATION AND AUDIT SERVICES Contract Administration...

  3. 10 CFR 431.202 - Definitions concerning illuminated exit signs.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Definitions concerning illuminated exit signs. 431.202... COMMERCIAL AND INDUSTRIAL EQUIPMENT Illuminated Exit Signs § 431.202 Definitions concerning illuminated exit signs. Basic model means, with respect to illuminated exit signs, all units of a given type of...

  4. 43 CFR 20.202 - Ethics program responsibilities.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Ethics program responsibilities. 20.202... AND CONDUCT Department Ethics Program § 20.202 Ethics program responsibilities. (a) The Designated Agency Ethics Official (or the alternate agency ethics official in his or her absence) shall coordinate...

  5. 7 CFR 1219.202 - Exemption for organic Hass avocados.

    Science.gov (United States)

    2010-01-01

    ... organic farm or organic handling operation certificate provided by a USDA-accredited certifying agent as... 7 Agriculture 10 2010-01-01 2010-01-01 false Exemption for organic Hass avocados. 1219.202 Section... AVOCADO PROMOTION, RESEARCH, AND INFORMATION Rules and Regulations § 1219.202 Exemption for organic Hass...

  6. 7 CFR 1206.202 - Exemption for organic mangos.

    Science.gov (United States)

    2010-01-01

    ... certificate provided by a USDA-accredited certifying agent as defined in the Organic Act, a signed... 7 Agriculture 10 2010-01-01 2010-01-01 false Exemption for organic mangos. 1206.202 Section 1206... PROMOTION, RESEARCH, AND INFORMATION Rules and Regulations § 1206.202 Exemption for organic mangos. (a) A...

  7. 31 CFR 202.4 - Agreement of deposit.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Agreement of deposit. 202.4 Section 202.4 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE... Federal Reserve Banks as Fiscal Agents of the United States or by any other Government agency. (c) The...

  8. 31 CFR 202.7 - Maintenance of balances within authorizations.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Maintenance of balances within authorizations. 202.7 Section 202.7 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE DEPOSITARIES AND...

  9. 31 CFR 202.1 - Scope of regulations.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Scope of regulations. 202.1 Section 202.1 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE DEPOSITARIES AND FINANCIAL AGENTS OF THE FEDERAL...

  10. 31 CFR 202.5 - Previously designated depositaries.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Previously designated depositaries. 202.5 Section 202.5 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE DEPOSITARIES AND FINANCIAL AGENTS...

  11. 10 CFR 63.202 - Definitions for Subpart K.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Definitions for Subpart K. 63.202 Section 63.202 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN A GEOLOGIC... Definitions for Subpart K. General environment means everywhere outside the Yucca Mountain site, the Nellis...

  12. 47 CFR 202.2 - Criteria and guidance.

    Science.gov (United States)

    2010-10-01

    ... telecommunications systems and networks during wartime or non-wartime emergencies is of the utmost importance. This... 47 Telecommunication 5 2010-10-01 2010-10-01 false Criteria and guidance. 202.2 Section 202.2 Telecommunication OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL NATIONAL SECURITY AND...

  13. 9 CFR 202.104 - Rule 4: Agency action.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Rule 4: Agency action. 202.104 Section 202.104 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS... parties to an amicable or informal adjustment of the matter by communication with the parties or their...

  14. 18 CFR 706.202 - Gifts, entertainment, and favors.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Gifts, entertainment, and favors. 706.202 Section 706.202 Conservation of Power and Water Resources WATER RESOURCES COUNCIL... loans from banks or other financial institutions on customary terms to finance proper and usual...

  15. 5 CFR 2638.202 - Responsibilities of agency head.

    Science.gov (United States)

    2010-01-01

    ... Section 2638.202 Administrative Personnel OFFICE OF GOVERNMENT ETHICS GOVERNMENT ETHICS OFFICE OF GOVERNMENT ETHICS AND EXECUTIVE AGENCY ETHICS PROGRAM RESPONSIBILITIES Designated Agency Ethics Official... and shall exercise personal leadership in establishing, maintaining, and carrying out the agency's...

  16. 40 CFR 60.202 - Standard for fluorides.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Standard for fluorides. 60.202 Section... Industry: Wet-Process Phosphoric Acid Plants § 60.202 Standard for fluorides. (a) On and after the date on... facility any gases which contain total fluorides in excess of 10.0 g/Mg of equivalent P2O5 feed (0.020 lb...

  17. 46 CFR 57.04-1 - Test specimen requirements and definition of ranges (modifies QW 202, QW 210, QW 451, and QB 202).

    Science.gov (United States)

    2010-10-01

    ... HOMELAND SECURITY (CONTINUED) MARINE ENGINEERING WELDING AND BRAZING Procedure Qualification Range § 57.04... procedure specification shall be in accordance with QW 202, QW 210, or QB 202 of the ASME Code as applicable...

  18. 21 CFR 202.1 - Prescription-drug advertisements.

    Science.gov (United States)

    2010-04-01

    ...) DRUGS: GENERAL PRESCRIPTION DRUG ADVERTISING § 202.1 Prescription-drug advertisements. (e) * * * (6... drug, nor may an advertisement contain a quantitative statement of safety or effectiveness (a) unless... effectiveness is supported by substantial evidence derived from adequate and well-controlled studies as defined...

  19. 12 CFR Supplement I to Part 202 - Official Staff Interpretations

    Science.gov (United States)

    2010-01-01

    ... 202.3—Limited Exceptions for Certain Classes of Transactions 1. Scope. Under this section, procedural requirements of the regulation do not apply to certain types of credit. All classes of transactions remain... through electronic media and Applications through video.) Paragraph 4(d) 1. Clear and conspicuous. This...

  20. 50 CFR 216.202 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Construction and Operation of Offshore Oil and Gas Facilities in the U.S. Beaufort Sea § 216.202 Permissible methods of taking. (a) Under Letters of...

  1. 48 CFR 14.202-8 - Electronic bids.

    Science.gov (United States)

    2010-10-01

    ... subpart 4.5, contracting officers may authorize use of electronic commerce for submission of bids. If electronic bids are authorized, the solicitation shall specify the electronic commerce method(s) that bidders... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Electronic bids. 14.202-8...

  2. Storm water monitoring along loop 202 and Salt River.

    Science.gov (United States)

    2010-10-01

    A comprehensive research program for the characterization of storm water runoff from an Arizona : highway was conducted from January through December 2007. The study area covered a portion of : the Loop 202 freeway west of Mesa Drive to a retention b...

  3. 32 CFR 202.10 - RAB adjournment and dissolution.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false RAB adjournment and dissolution. 202.10 Section... dissolution. (a) RAB adjournment—(1) Requirements for RAB adjournment. An Installation Commander may adjourn a... Commander decides to adjourn the RAB. (b) RAB dissolution—(1) Requirements for RAB dissolution. An...

  4. 48 CFR 1019.202-70-14 - Obligation.

    Science.gov (United States)

    2010-10-01

    ... PROGRAMS SMALL BUSINESS PROGRAMS Policies 1019.202-70-14 Obligation. (a) Mentor or protégé firms, may... mission and contract requirements under the prime contract. (b) At the conclusion of each year in the... objectives in the agreement; and, (4) To what extent the mentor firm's participation in the Mentor-Protégé...

  5. 20 CFR 702.202 - Employer's report; form and contents.

    Science.gov (United States)

    2010-04-01

    ... employee's injury or death shall be in writing and on a form prescribed by the Director for this purpose... circumstances of the injury or death; (d) The year, month, day, and hour when, and the particular locality where... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Employer's report; form and contents. 702.202...

  6. Phenotype abnormality: 202 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 202 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u708i decreased number... of vascular leaf in organ named whole plant ... whole plant ... present in fewer numbers in organism ... vascular leaf ...

  7. 40 CFR 243.202-3 - Recommended procedures: Operations.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended procedures: Operations... SOLID WASTE Requirements and Recommended Procedures § 243.202-3 Recommended procedures: Operations. (a... wipers, taillights, backup lights, audible reverse warning devices, tires, and hydraulic systems. Any...

  8. 48 CFR 514.202-5 - Descriptive literature.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Descriptive literature... CONTRACTING METHODS AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 514.202-5 Descriptive literature... FAR 52.211-6 satisfies the requirement for descriptive literature. ...

  9. 48 CFR 14.202-5 - Descriptive literature.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Descriptive literature. 14... CONTRACTING METHODS AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 14.202-5 Descriptive literature. (a) Policy. Contracting officers must not require bidders to furnish descriptive literature unless it is...

  10. 48 CFR 2919.202-2 - Locating small business sources.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Locating small business... SOCIOECONOMIC PROGRAMS SMALL BUSINESS AND SMALL DISADVANTAGED BUSINESS CONCERNS Policies 2919.202-2 Locating small business sources. Any procurement conducted on an unrestricted basis will include solicitations to...

  11. 48 CFR 319.202-2 - Locating small business sources.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Locating small business... SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 319.202-2 Locating small business sources. (a) OPDIVs shall foster, to the extent practicable, maximum participation by small businesses in HHS acquisitions...

  12. 30 CFR 202.351 - Royalties on geothermal resources.

    Science.gov (United States)

    2010-07-01

    ... free of royalty or direct use fees geothermal resources that are: (A) Unavoidably lost or reinjected... operations are subject to direct use fees, except for geothermal resources that are unavoidably lost or... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Royalties on geothermal resources. 202.351...

  13. 31 CFR 592.202 - Evasions; attempts; conspiracies.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Evasions; attempts; conspiracies. 592... Prohibitions § 592.202 Evasions; attempts; conspiracies. (a) Notwithstanding the existence of any rights or... purpose of evading or avoiding, or attempts to violate, any of the prohibitions set forth in this part is...

  14. 31 CFR 596.202 - Evasions; attempts; conspiracies.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Evasions; attempts; conspiracies. 596... REGULATIONS Prohibitions § 596.202 Evasions; attempts; conspiracies. Any transaction for the purpose of, or... the prohibitions set forth in this part, is hereby prohibited. Any attempt to violate the prohibitions...

  15. 29 CFR 779.202 - Basic concepts of definition.

    Science.gov (United States)

    2010-07-01

    ... Business Unit § 779.202 Basic concepts of definition. Under the definition, the “enterprise” consists of “the related activities performed * * * for a common business purpose.” All of the activities comprising the enterprise must be “related.” Activities serving a single business purpose may be related...

  16. 24 CFR 100.202 - General prohibitions against discrimination because of handicap.

    Science.gov (United States)

    2010-04-01

    ... discrimination because of handicap. 100.202 Section 100.202 Housing and Urban Development Regulations Relating to... Against Discrimination Because of Handicap § 100.202 General prohibitions against discrimination because of handicap. (a) It shall be unlawful to discriminate in the sale or rental, or to otherwise make...

  17. 48 CFR 12.202 - Market research and description of agency need.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Market research and description of agency need. 12.202 Section 12.202 Federal Acquisition Regulations System FEDERAL ACQUISITION... Commercial Items 12.202 Market research and description of agency need. (a) Market research (see 10.001) is...

  18. 48 CFR 312.202(d) - Market research and description of agency need.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Market research and description of agency need. 312.202(d) Section 312.202(d) Federal Acquisition Regulations System HEALTH AND... for the Acquisition of Commercial Items 312.202(d) Market research and description of agency need...

  19. 37 CFR 202.23 - Full term retention of copyright deposits.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Full term retention of copyright deposits. 202.23 Section 202.23 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES PREREGISTRATION AND REGISTRATION OF CLAIMS TO COPYRIGHT § 202.23...

  20. 24 CFR 103.202 - Notification of respondent; joinder of additional or substitute respondents.

    Science.gov (United States)

    2010-04-01

    ... of additional or substitute respondents. 103.202 Section 103.202 Housing and Urban Development... Procedures § 103.202 Notification of respondent; joinder of additional or substitute respondents. (a) Within... may be joined as an additional or substitute respondent by service of a notice on the person under...

  1. 30 CFR 202.101 - Standards for reporting and paying royalties.

    Science.gov (United States)

    2010-07-01

    .... 202.101 Section 202.101 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT ROYALTIES Federal and Indian Oil § 202.101 Standards for reporting and paying... for Basic Sediment and Water (BS&W) and other impurities. Reported American Petroleum Institute (API...

  2. 48 CFR 1806.202 - Establishing or maintaining alternative sources. (NASA supplements paragraphs (a) and (b))

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Establishing or maintaining alternative sources. (NASA supplements paragraphs (a) and (b)) 1806.202 Section 1806.202 Federal Acquisition... maintaining alternative sources. (NASA supplements paragraphs (a) and (b)) (a) The authority of FAR 6.202 is...

  3. 48 CFR 1832.202-1 - Policy. (NASA supplements paragraph (b))

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Policy. (NASA supplements paragraph (b)) 1832.202-1 Section 1832.202-1 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND... Financing 1832.202-1 Policy. (NASA supplements paragraph (b)) (b)(6) Advance payment limitations do not...

  4. 48 CFR 9903.202-9 - Illustration of Disclosure Statement Form, CASB-DS-1.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Illustration of Disclosure Statement Form, CASB-DS-1. 9903.202-9 Section 9903.202-9 Federal Acquisition Regulations System COST... PRACTICES AND COST ACCOUNTING STANDARDS CONTRACT COVERAGE CAS Program Requirements 9903.202-9 Illustration...

  5. 48 CFR 9903.202-10 - Illustration of Disclosure Statement Form, CASB DS-2.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Illustration of Disclosure Statement Form, CASB DS-2. 9903.202-10 Section 9903.202-10 Federal Acquisition Regulations System COST... PRACTICES AND COST ACCOUNTING STANDARDS CONTRACT COVERAGE CAS Program Requirements 9903.202-10 Illustration...

  6. 31 CFR 537.202 - Prohibited exportation or reexportation of financial services to Burma.

    Science.gov (United States)

    2010-07-01

    ... reexportation of financial services to Burma. 537.202 Section 537.202 Money and Finance: Treasury Regulations... permit granted prior to July 29, 2003, the exportation or reexportation of financial services to Burma... BURMESE SANCTIONS REGULATIONS Prohibitions § 537.202 Prohibited exportation or reexportation of financial...

  7. Alternative Evaluation for the REDOX (202-S) Plutonium Loadout Hood

    Energy Technology Data Exchange (ETDEWEB)

    N. R. Kerr

    1999-09-20

    Located in the 200 Areas is the inactive 202-S Reduction Oxidation (REDOX) Facility, which is managed by the Bechtel Hanford, Inc. Surveillance/Maintenance and Transition project. This facility is contaminated from nuclear material processes related to nuclear material separation from Hanford Site facility operations. This alternative evaluation report describes the alternatives and selection criteria based on the necessary protective requirements to maintain the REDOX Plutonium Loadout Hood in a safe and stable condition awaiting a final waste response action.

  8. Excitation functions of $^{nat}$Pb(d,x)$^{206,205,204,203,202}$Bi, $^{203cum,202m,201cum}$Pb and $^{202cum,201cum}$Tl reactions up to 50 MeV

    OpenAIRE

    Ditrói, F.; Tárkányi, F.; Takács, S.; Hermanne, A.; Ignatyuk, A. V.

    2014-01-01

    Cross-sections of deuteron induced nuclear reactions on lead were measured up to 50 MeV using the standard stacked foil irradiation technique and high resolution $\\gamma$-ray spectrometry. Experimental cross-sections and derived integral yields are presented for the $^{nat}$Pb(d,x)$^{206,205,204,203,202}$Bi, $^{203cum,202m,201cum}$Pb and $^{202cum,201cum}$Tl reactions. The experimental data were compared with the results from literature and with the data in the TENDL-2013 library (obtained wi...

  9. MicroRNA-202 inhibits tumor progression by targeting LAMA1 in esophageal squamous cell carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Meng, Xiangrui, E-mail: xiangruimengzz@163.com [Department of Oncology, The First Affiliated Hospital of Zhengzhou University, 1 East Jianshe Road, Zhengzhou 450000, Henan Province (China); Chen, Xiaoqi [Department of Digestion and Oncology, The First Affiliated Hospital of Henan Uninversity of TCM, 19 Renmin Road, Zhengzhou 450000, Henan Province (China); Lu, Peng [Department of Gastrointestinal Surgery, The People' s Hospital of Zhengzhou, 33 Huanghe Road, Zhengzhou 450000, Henan Province (China); Ma, Wang; Yue, Dongli; Song, Lijie; Fan, Qingxia [Department of Oncology, The First Affiliated Hospital of Zhengzhou University, 1 East Jianshe Road, Zhengzhou 450000, Henan Province (China)

    2016-05-13

    Esophageal squamous cell carcinoma (ESCC) is one of the most aggressive malignancies in the gastrointestinal tract. Emerging studies have indicated that microRNAs (miRNAs) are strongly implicated in the development and progression of ESCC. Here, we focused on the function and the underlying molecular mechanism of miR-202 in ESCC. The results showed that miR-202 was significantly down-regulated in ESCC tissues and cell lines. Overexpression of miR-202 in ECa-109 and KYSE-510 cells markedly suppressed cell proliferation and cell migration, and induced cell apoptosis. Furthermore, laminin α1 (LAMA1) expression was frequently positive in ESCC tissues and inversely correlated with miR-202 expression. Then we demonstrated that miR-202 targeted 3'-untranslated region (UTR) of LAMA1 and inhibited its protein expression. Additionally, LAMA1 overexpression rescued the proliferation inhibition and cell apoptosis elevation induced by miR-202. MiR-202 also inhibited the protein expression of p-FAK and p-Akt, which were all reversed by LAMA1 overexpression. Taken together, these findings suggest that miR-202 may function as a novel tumor suppressor in ESCC by repressing cell proliferation and migration, and its biological effects may attribute the inhibition of LAMA1-mediated FAK-PI3K-Akt signaling. - Highlights: • Expression of miR-202 was decreased in ESCC tissues and cell lines. • MiR-202 overexpression inhibited ESCC cell growth and induced apoptosis. • MiR-202 directly targeted LAMA1 in ESCC. • The LAMA1-FAK-PI3K signaling mediated the suppressive role of miR-202.

  10. [Clinal analysis of 202 nasal bone fractures cases].

    Science.gov (United States)

    Zhong, Zhenhua; Fan, Xihui; Lian, Zhuang; Cheng, Zexing; Zhuang, Yuanling

    2014-12-01

    To evaluate the age, sex, etiology, diagnosis and treatment time of nasal bone fractures. Clinical data of 202 cases with nasal bone fractures treated in the hospital were retrospectively analysed. A total of 202 cases,163 men (80. 7%) and 39 women (19. 3%). Fifty-two patients had a relationship with alcohol consumption, and all of them were males. The most frequent reasons of the injury were fight 46. 5% (94 cases) followed by falling-down 21. 3% (43 cases), traffic accidents 19. 3% (39 cases), works related 6. 5% (13 cases), sport injuries 5. 9% (12 cases) and others 0. 5% (1 cases). Patients distribution in seasons were: spring 54 cases (26.7%), summer 42 cases (20.8%), autumn 58 cases (28.7%), winter 48 cases (23. 8%). Diagnosis of nasal bone fractures were made positively by x-ray films in 79. 7% of cases, but 100% by CT. Positive predictive value of CT was superior to that of X-ray films in the diagnosis of nasal bone fracture. High morbidity of nasal bone fracture was seen in the age group of 20-29 years, and predominantly in male. Fight was found to be the main etiologic factor. We think that CT is necessary for diagnosing nasal bone fracture.

  11. 19 CFR 202.5 - Type of information to be developed at hearing.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Type of information to be developed at hearing. 202.5 Section 202.5 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION NONADJUDICATIVE... levels of domestic and foreign costs of production, the differentials between particular elements of...

  12. 9 CFR 202.111 - Rule 11: Hearing, oral or written.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Rule 11: Hearing, oral or written. 202.111 Section 202.111 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS... for oral hearing, timely filed. Declining to make such withdrawal shall not affect the rights or...

  13. 48 CFR 1519.202-5 - Data collection and reporting requirements.

    Science.gov (United States)

    2010-10-01

    ... purchasing activity the following information (cumulative monthly) for small purchases: (1) Total actions and... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Data collection and reporting requirements. 1519.202-5 Section 1519.202-5 Federal Acquisition Regulations System ENVIRONMENTAL...

  14. 41 CFR 50-202.3 - Learners, student learners, apprentices, and handicapped workers.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Learners, student learners, apprentices, and handicapped workers. 50-202.3 Section 50-202.3 Public Contracts and Property... handicapped workers. Learners, student learners, apprentices, and handicapped workers may be employed at less...

  15. 9 CFR 202.7 - Modification or vacation of final order.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Modification or vacation of final order. 202.7 Section 202.7 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS... Modification or vacation of final order. (a) Informal petition. Any interested person may file an informal...

  16. 13 CFR 126.202 - Who does SBA consider to control a HUBZone SBC?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Who does SBA consider to control a HUBZone SBC? 126.202 Section 126.202 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION HUBZONE... positions: officer, director, general partner, managing partner, managing member and manager. In addition...

  17. 9 CFR 113.202 - Canine Hepatitis and Canine Adenovirus Type 2 Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... established as pure, safe, and immunogenic shall be used for vaccine production. All serials of vaccine shall... used for vaccine production shall be tested for immunogenicity by one or both of the following methods... Type 2 Vaccine, Killed Virus. 113.202 Section 113.202 Animals and Animal Products ANIMAL AND PLANT...

  18. 48 CFR 1019.202-70-5 - Incentives for prime contractor participation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Incentives for prime contractor participation. 1019.202-70-5 Section 1019.202-70-5 Federal Acquisition Regulations System...-monetary award that will be presented (annually or as often as appropriate) to the mentoring firm providing...

  19. Particle on a Boron Disk : Ring Currents and Disk Aromaticity in B-20(2-)

    NARCIS (Netherlands)

    Truong Ba Tai, [No Value; Havenith, Remco W. A.; Teunissen, Jos L.; Dok, Ahmet R.; Hallaert, Simon D.; Minh Tho Nguyen, [No Value; Ceulemans, Arnout

    2013-01-01

    The B-20(2-) cluster is predicted to exhibit a planar sheet-like structure with a circular circumference. Orbital plots and energy correlations demonstrate the close correspondence between the electronic structure of B-20(2-) and the Bessel functions describing the waves of a quantum mechanical

  20. 9 CFR 202.200 - Scope and applicability of rules of practice.

    Science.gov (United States)

    2010-01-01

    ....200 Scope and applicability of rules of practice. The Uniform Rules of Practice for the Department of... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Scope and applicability of rules of practice. 202.200 Section 202.200 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS...

  1. 30 CFR 243.202 - When will MMS monitor my financial solvency?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false When will MMS monitor my financial solvency? 243.202 Section 243.202 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT Financial...

  2. 75 FR 16820 - Delegated Processing for Certain 202 Supportive Housing for the Elderly Projects

    Science.gov (United States)

    2010-04-02

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT Delegated Processing for Certain 202 Supportive Housing for the Elderly Projects... 202 Supportive Housing for the Elderly projects. OMB Approval Number: 2502-New. Form Numbers: Schedule...

  3. 13 CFR 127.202 - What are the requirements for control of an EDWOSB or WOSB?

    Science.gov (United States)

    2010-01-01

    ... decision making and the day-to-day management and administration of the business operations must be... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the requirements for control of an EDWOSB or WOSB? 127.202 Section 127.202 Business Credit and Assistance SMALL BUSINESS...

  4. 41 CFR 50-202.2 - Minimum wage in all industries.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Minimum wage in all... Public Contracts PUBLIC CONTRACTS, DEPARTMENT OF LABOR 202-MINIMUM WAGE DETERMINATIONS Groups of Industries § 50-202.2 Minimum wage in all industries. In all industries, the minimum wage applicable to...

  5. 30 CFR 202.353 - Measurement standards for reporting and paying royalties and direct use fees.

    Science.gov (United States)

    2010-07-01

    ... standards for reporting and paying royalties and direct use fees. (a) For geothermal resources used to...-hour. (b) For geothermal resources used in direct use processes, you must report the quantity on which... royalties and direct use fees. 202.353 Section 202.353 Mineral Resources MINERALS MANAGEMENT SERVICE...

  6. 76 FR 53115 - Expansion of Foreign-Trade Zone 202; Los Angeles, CA

    Science.gov (United States)

    2011-08-25

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF COMMERCE Foreign-Trade Zones Board Expansion of Foreign-Trade Zone 202; Los Angeles, CA Pursuant to its authority... City of Los Angeles, grantee of Foreign-Trade Zone 202, submitted an application to the Board for...

  7. 76 FR 86 - Expansion/Reorganization of Foreign-Trade Zone 202, Los Angeles, CA

    Science.gov (United States)

    2011-01-03

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF COMMERCE Foreign-Trade Zones Board Expansion/Reorganization of Foreign-Trade Zone 202, Los Angeles, CA Pursuant to... Commissioners of the City of Los Angeles, grantee of Foreign-Trade Zone 202, submitted an application to the...

  8. 49 CFR 236.202 - Signal governing movements over hand-operated switch.

    Science.gov (United States)

    2010-10-01

    ... switch. 236.202 Section 236.202 Transportation Other Regulations Relating to Transportation (Continued...-operated switch. Signal governing movements over hand-operated switch in the facing direction shall display... over the switch in the normal and in the reverse position, the signal shall display its most...

  9. 4SC-202 activates ASK1-dependent mitochondrial apoptosis pathway to inhibit hepatocellular carcinoma cells

    Energy Technology Data Exchange (ETDEWEB)

    Fu, Meili, E-mail: fumeilidrlinyi@tom.com [Department of Infectious Disease, Linyi People' s Hospital, Linyi 276000 (China); Wan, Fuqiang [Department of Head and Neck Surgery, Linyi Tumor Hospital, Linyi 276000 (China); Li, Zhengling [Department of Nursing, Tengzhou Central People' s Hospital, Tengzhou 277500 (China); Zhang, Fenghua [Department of Operating Room, Linyi People' s Hospital, Linyi 276000 (China)

    2016-03-04

    The aim of the present study is to investigate the potential anti-hepatocellular carcinoma (HCC) cell activity by 4SC-202, a novel class I HDAC inhibitor (HDACi). The associated signaling mechanisms were also analyzed. We showed that 4SC-202 treatment induced potent cytotoxic and proliferation–inhibitory activities against established HCC cell lines (HepG2, HepB3, SMMC-7721) and patient-derived primary HCC cells. Further, adding 4SC-202 in HCC cells activated mitochondrial apoptosis pathway, which was evidenced by mitochondrial permeability transition pore (mPTP) opening, cytochrome C cytosol release and caspase-3/-9 activation. Inhibition of this apoptosis pathway, by caspase-3/-9 inhibitors, mPTP blockers, or by shRNA-mediated knockdown of cyclophilin-D (Cyp-D, a key component of mPTP), significantly attenuated 4SC-202-induced HCC cell death and apoptosis. Reversely, over-expression of Cyp-D enhanced 4SC-202's sensitivity in HCC cells. Further studies showed that 4SC-202 induced apoptosis signal-regulating kinase 1 (ASK1) activation, causing it translocation to mitochondria and physical association with Cyp-D. This mitochondrial ASK1-Cyp-D complexation appeared required for mediating 4SC-202-induced apoptosis activation. ASK1 stable knockdown by targeted-shRNAs largely inhibited 4SC-202-induced mPTP opening, cytochrome C release, and following HCC cell apoptotic death. Together, we suggest that 4SC-202 activates ASK1-dependent mitochondrial apoptosis pathway to potently inhibit human HCC cells. - Highlights: • 4SC-202 exerts potent anti-proliferative and cytotoxic activity against established/primary HCC cells. • SC-202-induced anti-HCC cell activity relies on caspase-dependent apoptosis activation. • 4SC-202 activates Cyp-D-dependent mitochondrial apoptosis pathway in HCC cells. • 4SC-202 activates ASK1 in HCC cells, causing it translocation to mitochondria. • Mitochondrial ASK1-Cyp-D complexation mediates 4SC-202's activity in HCC cells.

  10. 30 CFR 202.555 - What portion of the gas that I produce is subject to royalty?

    Science.gov (United States)

    2010-07-01

    ... subject to royalty? 202.555 Section 202.555 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT ROYALTIES Gas Production From Indian Leases § 202.555 What... lease when the Bureau of Land Management (BLM) approves such off-lease use. (4) Gas used as plant fuel...

  11. 76 FR 55084 - Announcement of Funding Awards for the Section 202 Supportive Housing for the Elderly Program...

    Science.gov (United States)

    2011-09-06

    ... URBAN DEVELOPMENT Announcement of Funding Awards for the Section 202 Supportive Housing for the Elderly... Availability (NOFA) for the Section 202 Supportive Housing for the Elderly Program. This announcement contains... Elderly Program is authorized by section 202 of the Housing Act of 1959 (12 U.S.C. 1701q), as amended by...

  12. Functional promoter variant in zinc finger protein 202 predicts severe atherosclerosis and ischemic heart disease

    DEFF Research Database (Denmark)

    Frikke-Schmidt, R.; Nordestgaard, Børge; Grande, Peer

    2008-01-01

    association with IHD in 10,431 individuals from the Danish general population, the CCHS ( Copenhagen City Heart Study), including 1,511 incident IHD events during 28 years of follow-up. Results were verified in 2 independent case-control studies including, respectively, 942 and 1,549 cases with IHD and 8......Objectives This study was designed to test the hypotheses that single nucleotide polymorphisms ( SNPs), in zinc finger protein 202 ( ZNF202), predict severe atherosclerosis and ischemic heart disease ( IHD). Background ZNF202 is a transcriptional repressor controlling promoter elements in genes...... involved in vascular maintenance and lipid metabolism. Methods We first determined genotype association for 9 ZNF202 SNPs with severe atherosclerosis ( ankle brachial index >0.7 vs.

  13. Influence of Gas Flow Rate on the Deposition Rate on Stainless Steel 202 Substrates

    Directory of Open Access Journals (Sweden)

    M.A. Chowdhury

    2012-12-01

    Full Text Available Solid thin films have been deposited on stainless steel 202 (SS 202 substrates at different flow rates of natural gas using a hot filament thermal chemical vapor deposition (CVD reactor. In the experiments, the variations of thin film deposition rate with the variation of gas flow rate have been investigated. The effects of gap between activation heater and substrate on the deposition rate have also been observed. Results show that deposition rate on SS 202 increases with the increase in gas flow rate within the observed range. It is also found that deposition rate increases with the decrease in gap between activation heater and substrate. In addition, friction coefficient and wear rate of SS 202 sliding against SS 304 under different sliding velocities are also investigated before and after deposition. The experimental results reveal that improved friction coefficient and wear rate is obtained after deposition than that of before deposition.

  14. 29 CFR 825.202 - Intermittent leave or reduced leave schedule.

    Science.gov (United States)

    2010-07-01

    ... and Medical Leave Act § 825.202 Intermittent leave or reduced leave schedule. (a) Definition. FMLA... period of six months, such as for chemotherapy. A pregnant employee may take leave intermittently for...

  15. Study on the Association Between miRNA-202 Expression and Drug Sensitivity in Multiple Myeloma Cells.

    Science.gov (United States)

    Shen, Xianjuan; Guo, Yuehua; Qi, Jing; Shi, Wei; Wu, Xinhua; Ni, Hongbing; Ju, Shaoqing

    2016-07-01

    An increasing amount of experimental evidence has shown that miRNAs play a causal role in hematologic tumorigenesis. In this study, we characterized the role of miR-202 in multiple myeloma (MM) drug sensitivity. The potential binding site of miR-202 and B cell-activating factor (BAFF) was confirmed by luciferase reporter assay. MM cells were transfected with miR-202 mimics and inhibitor. Cells growth was measured by WST-1 cell proliferation assay and Annexin V-FLUOS apoptosis assay. BAFF and miR-202 mRNA levels were measured by real-time PCR. Meanwhile, BAFF, Bcl-2 family survival proteins and MAPK pathway proteins were measured by Western blot. It was found that miR-202 was functioned as a modulator of BAFF expression. miR-202 over-expression sensitized MM cells to bortezomib (Bort) but less to Thalidomide (Thal) and dexamethasone (Dex). miR-202 mimics in combination with Bort inhibited MM cell survival more effectively as compared with Bort treatment alone. Our study also provided experimental evidence that JNK/SAPK signaling pathway was involved in the regulatory effect of miR-202 on drug resistance of MM cells. These results suggest that the regulatory mechanism of miR-202 expression may be a promising target for fine-tuning anti-myeloma therapy.

  16. Precision electron-capture energy in {sup 202}Pb and its relevance for neutrino mass determination

    Energy Technology Data Exchange (ETDEWEB)

    Welker, A. [CERN, Geneva (Switzerland); Technische Universitaet Dresden, Dresden (Germany); Filianin, P. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Petersburg Nuclear Physics Institute, Gatchina (Russian Federation); Althubiti, N.A.S. [The University of Manchester, School of Physics and Astronomy, Manchester (United Kingdom); Atanasov, D.; Blaum, K.; Eliseev, S.; Kreim, S. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Cocolios, T.E. [The University of Manchester, School of Physics and Astronomy, Manchester (United Kingdom); KU Leuven, Instituut voor Kern- en Stralingsfysica, Leuven (Belgium); Herfurth, F.; Neidherr, D. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Lunney, D. [CSNSM-IN2P3-CNRS, Universite Paris-Sud, Orsay (France); Manea, V. [CERN, Geneva (Switzerland); Novikov, Yu. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Petersburg Nuclear Physics Institute, Gatchina (Russian Federation); Physics Faculty, St. Petersburg State University (Russian Federation); Rosenbusch, M.; Schweikhard, L.; Wienholtz, F. [Ernst-Moritz-Arndt-Universitaet, Institut fuer Physik, Greifswald (Germany); Wolf, R.N. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); The University of Sydney, ARC Centre of Excellence for Engineered Quantum Systems, Sydney (Australia); Zuber, K. [Technische Universitaet Dresden, Dresden (Germany)

    2017-07-15

    Within the framework of an extensive programme devoted to the search for alternative candidates for the neutrino mass determination, the atomic mass difference between {sup 202}Pb and {sup 202}Tl has been measured with the Penning trap mass spectrometer ISOLTRAP at the ISOLDE facility at CERN. The obtained value Q{sub EC} = 38.8(43) keV is three times more precise than the AME2012 value. While it will probably not lead to a replacement of {sup 163}Ho in modern experiments on the determination of the electron-neutrino mass, the electron capture in {sup 202}Pb would however allow a determination of the electron-neutrino mass on the few-eV level using a cryogenic micro-calorimeter. (orig.)

  17. miR-202 Diminishes TGFβ Receptors and Attenuates TGFβ1-Induced EMT in Pancreatic Cancer.

    Science.gov (United States)

    Mody, Hardik R; Hung, Sau Wai; Pathak, Rakesh K; Griffin, Jazmine; Cruz-Monserrate, Zobeida; Govindarajan, Rajgopal

    2017-08-01

    Previous studies in our laboratory identified that 3-deazaneplanocin A (DZNep), a carbocyclic adenosine analog and histone methyl transferase inhibitor, suppresses TGFβ-induced epithelial-to-mesenchymal (EMT) characteristics. In addition, DZNep epigenetically reprograms miRNAs to regulate endogenous TGFβ1 levels via miR-663/4787-mediated RNA interference (Mol Cancer Res. 2016 Sep 13. pii: molcanres.0083.2016) (1). Although DZNep also attenuates exogenous TGFβ-induced EMT response, the mechanism of this inhibition was unclear. Here, DZNep induced miR-202-5p to target both TGFβ receptors, TGFBR1 and TGFBR2, for RNA interference and thereby contributes to the suppression of exogenous TGFβ-induced EMT in pancreatic cancer cells. Lentiviral overexpression of miR-202 significantly reduced the protein levels of both TGFβ receptors and suppressed TGFβ signaling and EMT phenotypic characteristics of cultured parenchymal pancreatic cancer cells. Consistently, transfection of anti-miRNAs against miR-202-5p resulted in increased TGFBR1 and TGFBR2 protein expressions and induced EMT characteristics in these cells. In stellate pancreatic cells, miR-202 overexpression slowed growth as well as reduced stromal extracellular membrane matrix protein expression. In orthotopic pancreatic cancer mouse models, both immunodeficient and immunocompetent, miR-202 reduced tumor burden and metastasis. Together, these findings demonstrate an alternative mechanism of DZNep in suppressing TGFβ signaling at the receptor level and uncover the EMT-suppressing role of miR-202 in pancreatic cancer.Implications: These findings support the possibility of combining small molecule-based (e.g., DZNep analogs) or large molecule-based (e.g., miRNAs) epigenetic modifiers with conventional nucleoside analogs (e.g., gemcitabine, capecitabine) to improve the antimetastatic potential of current pancreatic cancer therapy. Mol Cancer Res; 15(8); 1029-39. ©2017 AACR. ©2017 American Association for Cancer

  18. Formation of a "Cluster Molecule" (C20)2 and its thermal stability

    OpenAIRE

    Podlivaev, A. I.; Openov, L. A.

    2006-01-01

    The possible formation of a "cluster molecule" (C20)2 from two single C20 fullerenes is studied by the tight-binding method. Several (C20)2 isomers in which C20 fullerenes are bound by strong covalent forces and retain their identity are found; actually, these C20 fullerenes play the role of "atoms" in the "cluster molecule". The so-called open-[2+2] isomer has a minimum energy. Its formation path and thermal stability at T = 2000 - 4000 K are analyzed in detail. This isomer loses its molecul...

  19. SOX9 regulates microRNA miR-202-5p/3p expression during mouse testis differentiation

    DEFF Research Database (Denmark)

    Wainwright, Elanor N; Jorgensen, Joan S; Kim, Youngha

    2013-01-01

    MicroRNAs are important regulators of developmental gene expression, but their contribution to fetal gonad development is not well understood. We have identified the evolutionarily conserved gonadal microRNAs miR-202-5p and miR-202-3p as having a potential role in regulating mouse embryonic gonad...

  20. 45 CFR 2540.202 - What two search components of the National Service Criminal History Check must I satisfy to...

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false What two search components of the National Service Criminal History Check must I satisfy to determine an individual's suitability to serve in a covered position? 2540.202 Section 2540.202 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVIC...

  1. 34 CFR 403.202 - What must each State's system of core standards and measures of performance include?

    Science.gov (United States)

    2010-07-01

    ... academic skills; (2) One or more measures of the following: (i) Student competency attainment. (ii) Job or... measures of performance include? 403.202 Section 403.202 Education Regulations of the Offices of the... system of core standards and measures of performance include? (a) The statewide system of core standards...

  2. 42 CFR 495.202 - Identification of qualifying MA organizations, MA-EPs and MA-affiliated eligible hospitals.

    Science.gov (United States)

    2010-10-01

    ...-EPs and MA-affiliated eligible hospitals. 495.202 Section 495.202 Public Health CENTERS FOR MEDICARE... STANDARDS FOR THE ELECTRONIC HEALTH RECORD TECHNOLOGY INCENTIVE PROGRAM Requirements Specific to Medicare...-affiliated eligible hospitals. (a) Identification of qualifying MA organizations. (1) Beginning with bids due...

  3. 5 CFR 2641.202 - Two-year restriction on any former employee's representations to United States concerning...

    Science.gov (United States)

    2010-01-01

    ... responsibility. A communication or appearance is not prohibited unless, at the time of the proposed post... responsibility for the resulting contract even though she is responsible for all budget matters within the agency... official responsibility. 2641.202 Section 2641.202 Administrative Personnel OFFICE OF GOVERNMENT ETHICS...

  4. 17 CFR 202.11 - Public Company Accounting Oversight Board budget approval process.

    Science.gov (United States)

    2010-04-01

    ..., human resources, capital assets, and other resources to be used in achieving the PCAOB's performance... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Public Company Accounting... AND EXCHANGE COMMISSION INFORMAL AND OTHER PROCEDURES § 202.11 Public Company Accounting Oversight...

  5. 29 CFR 780.202 - Subordination to farming operations is necessary for exemption.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Subordination to farming operations is necessary for... Operations § 780.202 Subordination to farming operations is necessary for exemption. While section 3(f) speaks of practices performed “in conjunction with” as well as “incident to” farming operations, it would...

  6. 7 CFR 767.202 - Real estate inventory property located in special hazard areas.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Real estate inventory property located in special...) FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE SPECIAL PROGRAMS INVENTORY PROPERTY MANAGEMENT Real Estate Property With Important Resources or Located in Special Hazard Areas § 767.202 Real estate...

  7. 75 FR 24963 - Notice of Proposed Information Collection for Public Comment: 202 Demonstration Planning Grant...

    Science.gov (United States)

    2010-05-06

    ... Planning Grant Evaluation AGENCY: Office of Policy Development and Research, HUD. ACTION: Notice. SUMMARY... Demonstration Planning Grant Program. Description of the need for information and proposed use: The Department..., a study of the Section 202 Supportive Housing for the Elderly Demonstration Planning Grant Program...

  8. 7 CFR 1710.202 - Requirement to prepare a load forecast-power supply borrowers.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Requirement to prepare a load forecast-power supply... TO ELECTRIC LOANS AND GUARANTEES Load Forecasts § 1710.202 Requirement to prepare a load forecast... must maintain an approved load forecast that meets the requirements of this subpart on an ongoing basis...

  9. 48 CFR 32.202-3 - Conducting market research about financing terms.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Conducting market research... 32.202-3 Conducting market research about financing terms. Contract financing may be a subject included in the market research conducted in accordance with part 10. If market research for contract...

  10. 49 CFR 1546.202 - Persons and property onboard the aircraft.

    Science.gov (United States)

    2010-10-01

    ...) TRANSPORTATION SECURITY ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY FOREIGN AIR CARRIER SECURITY Operations § 1546.202 Persons and property onboard the aircraft. Each foreign air carrier operating under § 1546.101(e) or (f) must apply the security measures in its security program for persons...

  11. 49 CFR 1544.202 - Persons and property onboard an all-cargo aircraft.

    Science.gov (United States)

    2010-10-01

    ...) TRANSPORTATION SECURITY ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY AIRCRAFT OPERATOR SECURITY: AIR CARRIERS AND COMMERCIAL OPERATORS Operations § 1544.202 Persons and property onboard an all... program in an all-cargo operation, must apply the security measures in its security program for persons...

  12. 30 CFR 285.202 - What types of leases will MMS issue?

    Science.gov (United States)

    2010-07-01

    ... RENEWABLE ENERGY ALTERNATE USES OF EXISTING FACILITIES ON THE OUTER CONTINENTAL SHELF Issuance of OCS Renewable Energy Leases General Lease Information § 285.202 What types of leases will MMS issue? The MMS may issue leases on the OCS for the assessment and production of renewable energy and may authorize a...

  13. 37 CFR 202.24 - Deposit of published electronic works available only online.

    Science.gov (United States)

    2010-07-01

    ... COPYRIGHT § 202.24 Deposit of published electronic works available only online. (a) Pursuant to authority... or a phonorecord of an electronic work published in the United States and available only online upon... regulations as being subject to demand. (2) Demands may be made only for works published on or after February...

  14. 10 CFR 611.202 - Advanced Technology Vehicle Manufacturing Facility Award Program.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Advanced Technology Vehicle Manufacturing Facility Award... TECHNOLOGY VEHICLES MANUFACTURER ASSISTANCE PROGRAM Facility/Funding Awards § 611.202 Advanced Technology Vehicle Manufacturing Facility Award Program. DOE may issue, under the Advanced Technology Vehicle...

  15. 33 CFR 146.202 - Notice of arrival or relocation of MODUs on the OCS.

    Science.gov (United States)

    2010-07-01

    ... OF HOMELAND SECURITY (CONTINUED) OUTER CONTINENTAL SHELF ACTIVITIES OPERATIONS Mobile Offshore Drilling Units § 146.202 Notice of arrival or relocation of MODUs on the OCS. (a) The owner of any mobile... contained in, applications and notices under 33 CFR part 67 for aids to navigation on the Outer Continental...

  16. 75 FR 47536 - Foreign-Trade Zone 202-Los Angeles, CA; Application for Expansion

    Science.gov (United States)

    2010-08-06

    ... Foreign-Trade Zones Board Foreign-Trade Zone 202--Los Angeles, CA; Application for Expansion An application has been submitted to the Foreign-Trade Zones Board (the Board) by the Board of Harbor... Foreign-Trade Zones Act, as amended (19 U.S.C. 81a-81u), and the regulations of the Board (15 CFR part 400...

  17. 16 CFR 20.2 - Deception as to identity of rebuilder, remanufacturer, reconditioner or reliner.

    Science.gov (United States)

    2010-01-01

    ... AND TRADE PRACTICE RULES GUIDES FOR THE REBUILT, RECONDITIONED AND OTHER USED AUTOMOBILE PARTS INDUSTRY § 20.2 Deception as to identity of rebuilder, remanufacturer, reconditioner or reliner. (a) It is... reliner of an industry product. (b) In connection with the sale or offering for sale of an industry...

  18. 46 CFR 180.202 - Survival craft-vessels operating on oceans routes.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft-vessels operating on oceans routes. 180... § 180.202 Survival craft—vessels operating on oceans routes. (a) Each vessel certificated to operate on an oceans route in cold water must either: (1) Be provided with inflatable buoyant apparatus of an...

  19. 5 CFR 2604.202 - Index identifying information for the public.

    Science.gov (United States)

    2010-01-01

    ... DISCLOSURE REPORTS FOIA Public Reading Room Facility and Web Site; Index Identifying Information for the Public § 2604.202 Index identifying information for the public. (a) The Office of Government Ethics will... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Index identifying information for the...

  20. 48 CFR 1319.202-70 - Small business set-aside review form.

    Science.gov (United States)

    2010-10-01

    ... Operating Unit Counsel Small Business Specialist, and forwarded to the OSDBU for approval. If applicable... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Small business set-aside... COMMERCE SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies. 1319.202-70 Small business set-aside...

  1. 18 CFR 382.202 - Annual charges under the Natural Gas Act and Natural Gas Policy Act of 1978 and related statutes.

    Science.gov (United States)

    2010-04-01

    ... the Natural Gas Act and Natural Gas Policy Act of 1978 and related statutes. 382.202 Section 382.202... GENERAL RULES ANNUAL CHARGES Annual Charges § 382.202 Annual charges under the Natural Gas Act and Natural Gas Policy Act of 1978 and related statutes. The adjusted costs of administration of the natural gas...

  2. [miR-202 contributes to sensitizing MM cells to drug significantly via activing JNK/SAPK signaling pathway].

    Science.gov (United States)

    Zhang, Y; Shen, X J; Wu, X H; Cong, H; Ni, H B; Ju, S Q; Su, J Y

    2016-11-14

    Objective: To explore the role of miR-202 in multiple myeloma (MM) cells, and study the regulation of miR-202 on drug sensitivity of MM cells. Methods: miR-202 and BAFF mRNA levels were detected by real-time PCR. U266 cells were transfected with miR-202-mimics, miR-202-inhibitor, siBAFF and their negative controls. After above treatments, protein levels of Bcl-2 family and MAPK signaling pathway were detected by Western blot analysis, and the proliferation and apoptosis ability of MM cells were examined by WST-1, Annexin V-FLUOS assay, respectively. Results: The results showed that the expression of miR-202 in CD138+ MM cells (0.304±0.354) and U266 cells (0.052± 0.009) were lower than in normal controls (3.550 ± 1.126) (PBort group (51.23±5.41)% was higher as compared with Bort treatment alone (31.70±4.40)% or miR-202 mimics control combined with Bort group (27.94±4.04)%, (P=0.047, P= 0.028), whereas the apoptosis rate in miR-202 mimics combined with Thal or Dex had no significant difference compared with miR-202 mimics control [(11.66±1.91)% vs (10.63±1.74)%, P=0.700; (16.35± 1.32)% vs (17.43 ± 1.95)%, P=0.400]. The inhibitory rate of cell growth in miR-202 mimics combined with Bort group was higher as compared with Bort treatment alone [(36.93±5.98)% vs (18.18±4.10)%, P= 0.029]. The expressions of p-JNK protein decreased in U266 cells transfected with miR-202 mimics and treated with Bort. Conclusion: miR-202 mimics combined with Bort could inhibit proliferation and induce apoptosis of U266 cells through negative regulating target gene BAFF, which further inhibited the JNK/SAPK signaling pathway.

  3. Study of dimuon pair production in e+ e- collisions from 196 - 202 GeV

    CERN Document Server

    Flacher, Henning

    2000-01-01

    In this thesis the electroweak process $e^{+} e^{-}$ --> $μ^{+} μ^{-}$ was studied and an inclusive and exclusive cross section were measured. Furthermore the forward-backward asymmetry Afb was determined from the exclusive event sample. The investigated data was recorded·with the detector ALEPH at centre-of-mass energies of 196, 200 and 202 GeV resulting in a total integrated luminosity of 208.1 pb-1. All the measured results are in good agreement with the Standard Model. From the measurements of total cross sections and angular distributions for all the two fermion processes at energies from 130 - 202 GeV limits on processes beyond the Standard Model were derived. For Contact Interactions they were found to be of the order of 10 TeV while for TeV-Scale Quantum Gravity a limit for the ultra-violet cut-off parameter of A::1 TeV could be derived.

  4. VLT spectroscopic analysis of HH 202. Implications on dust destruction and thermal inhomogeneities

    Science.gov (United States)

    Espíritu, J. N.; Peimbert, A.; Delgado-Inglada, G.; Ruiz, M. T.

    2017-04-01

    We present a long-slit spectroscopic analysis of Herbig-Haro 202 and the surrounding gas of the Orion Nebula using data from the Very Large Telescope. We determined the spatial variation of its physical conditions and chemical abundances; our results are consistent with those from previous studies albeit with improved uncertainties in some determinations. Special attention is paid to the iron (Fe) and oxygen (O) abundances, which show a peak at the brightest part of HH 202, allowing us to estimate that 57% of the dust is the destroyed; we also calculate the amount of depletion of oxygen in dust grains, which amounts to 0.126±0.024 dex. Finally we show that O abundances determined from collisionally excited lines and recombination lines are irreconcilable at the center of the shock unless thermal inhomogeneities are considered.

  5. Development of a frit 202 analytic standard for the Defense Waste Processing Facility

    Energy Technology Data Exchange (ETDEWEB)

    Schumacher, R.F.; Hardy, B.J.; Sproull, J.F.

    1997-03-30

    During the qualification of Frit 202 samples for the `DWPF Cold Runs`, the need for a reliable chemical frit standard became apparent. A standard was prepared by obtaining a quantity of Frit 202 and grinding into a fine powder. This material was homogenized as one slurry material volume, spray dried to prevent segregation, and hydraulically pressed into discs. These discs were fired and packaged into eleven sub-lots containing approximately 2,000 discs per sub-lot. A number of samples were obtained and analyzed by two analytic laboratories. The chemical analyses were carefully reviewed and evaluated by several statistical means. While there were several statistically significant variations between the sub-lots, it is believed that those variations are partially caused by the variability of the analytic method. These discs should provide a reliable standard for future chemical analyses of DWPF Frits similar in comparison to Frit 202. It is recommended that these discs be used as a standard material included with the representative frit sample to the independent chemical analysis laboratory, and the order of use of these standards be from sub-lot eleven to sub-lot four. It is further recommended that the NIST standard material (93a) be employed along with the 202 standard until confidence in the new standard is gained. The NIST standard should also be used when initial use of a new sub-lot is begun. this procedure should continue to the end of the DWPF program or such time as the chemical composition of the frit is extensively modified.

  6. Selective degradation of the recalcitrant cell wall of Scenedesmus quadricauda CASA CC202.

    Science.gov (United States)

    Reshma, Ragini; Arumugam, Muthu

    2017-07-06

    An eco-friendly cell wall digestion strategy was developed to enhance the availability of nutritionally important bio molecules of edible microalgae and exploit them for cloning, transformation, and expression of therapeutic proteins. Microalgae are the source for many nutritionally important bioactive compounds and potential drugs. Even though edible microalgae are rich in nutraceutical, bioavailability of all these molecules is very less due to their rigid recalcitrant cell wall. For example, the cell wall of Scenedesmus quadricauda CASA CC202 is made up of three layers comprising of rigid outer pectin and inner cellulosic layer separated by a thin middle layer. In the present investigation, a comprehensive method has been developed for the selective degradation of S. quadricauda CASA CC202 cell wall, by employing both mechanical and enzymatic treatments. The efficiency of cell wall removal was evaluated by measuring total reducing sugar (TRS), tannic acid-ferric chloride staining, calcoflour white staining, scanning electron microscopy (SEM), and Fourier transform infrared spectroscopy (FTIR) analysis. It was confirmed that the yield of TRS increased from 129.82 mg/g in 14 h from pectinase treatment alone to 352.44 mg/g by combined sonication and enzymatic treatment within 12 h. As a result, the combination method was found to be effective for the selective degradation of S. quadricauda CASA CC202 cell wall. This study will form a base for our future works, where this will help to enhance the digestibility and availability of nutraceutically important proteins.

  7. 78 FR 64144 - 30-Day Notice of Proposed Information Collection: Section 202 Supportive Housing for the Elderly...

    Science.gov (United States)

    2013-10-25

    ... the Elderly Application Submission Requirements AGENCY: Office of the Chief Information Officer, HUD... Title of Information Collection: Section 202 Supportive Housing for the Elderly Application Submission... in determining applicant eligibility and ability to develop housing for the elderly within statutory...

  8. LPIC-2 Linux Professional Institute Certification Study Guide Exams 201 and 202

    CERN Document Server

    Smith, Roderick W

    2011-01-01

    The first book to cover the LPIC-2 certification Linux allows developers to update source code freely, making it an excellent, low-cost, secure alternative to alternate, more expensive operating systems. It is for this reason that the demand for IT professionals to have an LPI certification is so strong. This study guide provides unparalleled coverage of the LPIC-2 objectives for exams 201 and 202. Clear and concise coverage examines all Linux administration topics while practical, real-world examples enhance your learning process. On the CD, you'll find the Sybex Test Engine, electronic flash

  9. Observing and Reducing IFUs: INTEGRAL and PMAS—Properties of the Ionized Gas in HH 202

    Directory of Open Access Journals (Sweden)

    Luis López-Martín

    2014-01-01

    Full Text Available The reduction of integral field spectroscopy (IFS data requires several stages and many repetitive operations to convert raw data into, typically, a large number of spectra. Instead there are several semiautomatic data reduction tools and here we present this data reduction process using some of the Image Reduction and Analysis Facility (IRAF tasks devoted to reduce spectroscopic data. After explaining the whole process, we illustrate the power of this instrumental technique with some results obtained for the object HH202 in the Orion Nebula (Mesa-Delgado et al., 2009.

  10. OPTIMIZATION OF PROCESSING PARAMETERS IN ELECTROCHEMICAL MACHINING OF AISI 202 USING RESPONSE SURFACE METHODOLOGY

    Directory of Open Access Journals (Sweden)

    V. SATHIYAMOORTHY

    2015-06-01

    Full Text Available This paper attempts to optimize the predominated machining parameters in Electro Chemical Machining (ECM of AISI 202 Austenitic stainless steel using Response Surface Methodology (RSM. The chosen material has been used in railway rolling stock. The selected influencing parameters are applied voltage, electrolyte discharge rate with three levels and tool feed rate with four levels. Thirty six experiments were conducted through design of experiments and central composite design in RSM was applied to identify the optimum conditions which turn into the best Material Removal Rate (MRR and Surface roughness (SR. The experimental analyses reveal that applied voltage of 16 V, tool feed rate of 0.54 mm/min and electrolyte discharge rate of 10 L/min would be the optimum values in ECM of AISI 202 under the selected conditions. For checking the optimality of the developed equation, MRR of 298.276 mm3/min and surface roughness Ra of 2.05 µm were predicted at applied voltage of 12.5 V, tool feed rate of 0.54 mm/min and electrolyte discharge rate of 11.8 L/min with composite desirability of 98.05%. Confirmatory tests showed that the actual performance at the optimum conditions were 291.351 mm3/min and 2.17 µm. The deviation from the predicted performance is less than 6% which proves the composite desirability of the developed models for MRR and surface roughness.

  11. Basal Cell Carcinomas in Gorlin Syndrome: A Review of 202 Patients

    Directory of Open Access Journals (Sweden)

    Elizabeth A. Jones

    2011-01-01

    Full Text Available Gorlin syndrome (Naevoid Basal Cell Carcinoma Syndrome is a rare autosomal dominant syndrome caused by mutations in the PTCH gene with a birth incidence of approximately 1 in 19,000. Patients develop multiple basal cell carcinomas of the skin frequently in early life and also have a predisposition to additional malignancies such as medulloblastoma. Gorlin Syndrome patients also have developmental defects such as bifid ribs and other complications such as jaw keratocysts. We studied the incidence and frequency of basal cell carcinomas in 202 Gorlin syndrome patients from 62 families and compared this to their gender and mutation type. Our data suggests that the incidence of basal cell carcinomas is equal between males and females and the mutation type cannot be used to predict disease burden.

  12. Optimization of process parameters of ECM by RSM on AISI 202 steel

    Directory of Open Access Journals (Sweden)

    P. Alex John Britto

    2015-12-01

    Full Text Available The machining of complex shaped designs was difficult earlier, but with the advent of the newer machining processes incorporating in it electrical, chemical & mechanical processes, manufacturing has redefined itself. Especially, the Electrochemical Machining (ECM process is used to machine the hard to cut materials without producing heat and friction. Hence, in this work, the ECM process has been chosen to machine SS AISI 202 steel. This study establishes the effect of process parameters such as voltage, current and concentration of electrolyte on the responses on material removal rate (MRR. In this work, second-order quadratic models were developed for MRR, considering the electrolyte concentration, voltage and current as the machining parameters, using central composite design. The developed models were used for Response Surface Methodology (RSM optimization by desirability function approach to determine the optimum machining parameters.

  13. 7 CFR 202.44 - Proceedings under section 305(b) to determine whether foreign alfalfa or red clover seed is not...

    Science.gov (United States)

    2010-01-01

    ... foreign alfalfa or red clover seed is not adapted for general agricultural use in the United States. 202...) FEDERAL SEED ACT FEDERAL SEED ACT RULES OF PRACTICE Rules Applicable to Other Proceedings § 202.44 Proceedings under section 305(b) to determine whether foreign alfalfa or red clover seed is not adapted for...

  14. Synthetic brominated furanone F202 prevents biofilm formation by potentially human pathogenic Escherichia coli O103:H2 and Salmonella ser. Agona on abiotic surfaces

    Science.gov (United States)

    Vestby, LK; Johannesen, KCS; Witsø, IL; Habimana, O; Scheie, AA; Urdahl, AM; Benneche, T; Langsrud, S; Nesse, LL

    2014-01-01

    Aims Investigate the use of a synthetic brominated furanone (F202) against the establishment of biofilm by Salmonella ser. Agona and E. coli O103:H2 under temperature conditions relevant for the food and feed industry as well as under temperature conditions optimum for growth. Methods and Results Effect of F202 on biofilm formation by Salmonella ser. Agona and E. coli O103:H2 was evaluated using a microtiter plate assay and confocal microscopy. Effect of F202 on bacterial motility was investigated using swimming and swarming assays. Influence on flagellar synthesis by F202 was examined by flagellar staining. Results showed that F202 inhibited biofilm formation without being bactericidal. F202 was found to affect both swimming and swarming motility without, however, affecting the expression of flagella. Conclusions F202 showed its potential as a biofilm inhibitor of Salmonella ser. Agona and E. coli O103:H2 under temperature conditions relevant for the feed and food industry as well as temperatures optimum for growth. One potential mode of action of F202 was found to be by targeting flagellar function. Significance and Impact of the Study The present study gives valuable new knowledge to the potential use of furanones as a tool in biofilm management in the food and feed industry. PMID:24118802

  15. 41 CFR 302-10.202 - Am I entitled to any other allowances when I transport my mobile home by POV?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 4 2010-07-01 2010-07-01 false Am I entitled to any other allowances when I transport my mobile home by POV? 302-10.202 Section 302-10.202 Public Contracts and Property Management Federal Travel Regulation System RELOCATION ALLOWANCES TRANSPORTATION AND...

  16. 25 CFR 900.202 - What should a self-determination contractor or a contractor's employee do on receiving such a claim?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false What should a self-determination contractor or a contractor's employee do on receiving such a claim? 900.202 Section 900.202 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR, AND INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES CONTRACTS...

  17. Affordable headphones for accessible screening audiometry: An evaluation of the Sennheiser HD202 II supra-aural headphone.

    Science.gov (United States)

    Van der Aerschot, Mathieu; Swanepoel, De Wet; Mahomed-Asmail, Faheema; Myburgh, Herman Carel; Eikelboom, Robert Henry

    2016-11-01

    Evaluation of the Sennheiser HD 202 II supra-aural headphones as an alternative headphone to enable more affordable hearing screening. Study 1 measured the equivalent threshold sound pressure levels (ETSPL) of the Sennheiser HD 202 II. Study 2 evaluated the attenuation of the headphones. Study 3 determined headphone characteristics by analyzing the total harmonic distortion (THD), frequency response and force of the headband. Twenty-five participants were included in study 1 and 15 in study 2 with ages ranging between 18 and 25. No participants were involved in study 3. The Sennheiser HD 202 II ETSPLs (250-16000 Hz) showed no significant effects on ETSPL for ear laterality, gender or age. Attenuation was not significantly different (p > 0.01) to TDH 39 except at 8000 Hz (p 3%. Sennheiser HD 202 II supra-aural headphones can be used as an affordable headphone for screening audiometry provided reported MPANLs, maximum intensities and ETSPL values are employed.

  18. Search for Charged Higgs Bosons in $e^{+} e^{-}$ Collisions at $\\sqrt{s}$=189-202 GeV

    CERN Document Server

    Abdallah, J.; Adam, W.; Adye, T.; Adzic, P.; Albrecht, Z.; Alderweireld, T.; Alekseev, G.D.; Alemany, R.; Allmendinger, T.; Allport, P.P.; Almehed, S.; Amaldi, U.; Amapane, N.; Amato, S.; Anashkin, E.; Anassontzis, E.G.; Andersson, P.; Andreazza, A.; Andringa, S.; Anjos, N.; Antilogus, P.; Apel, W.D.; Arnoud, Y.; Asman, B.; Augustin, J.E.; Augustinus, A.; Baillon, P.; Ballestrero, A.; Bambade, P.; Barao, F.; Barbiellini, G.; Barbier, R.; Bardin, D.Yu.; Barker, G.J.; Baroncelli, A.; Battaglia, M.; Baubillier, M.; Becks, K.H.; Begalli, M.; Behrmann, A.; Bellunato, T.; Belokopytov, Yu.; Belous, K.; Benekos, N.C.; Benvenuti, A.C.; Berat, C.; Berggren, M.; Berntzon, L.; Bertrand, D.; Besancon, M.; Besson, N.; Bilenky, Mikhail S.; Bloch, D.; Blom, H.M.; Bol, L.; Bonesini, M.; Boonekamp, M.; Booth, P.S.L.; Borisov, G.; Bosio, C.; Botner, O.; Boudinov, E.; Bouquet, B.; Bowcock, T.J.V.; Boyko, I.; Bozovic, I.; Bozzo, M.; Bracko, M.; Branchini, P.; Brenner, R.A.; Brodet, E.; Bruckman, P.; Brunet, J.M.; Bugge, L.; Buschmann, P.; Caccia, M.; Calvi, M.; Camporesi, T.; Canale, V.; Carena, F.; Carroll, L.; Caso, C.; Castillo Gimenez, M.V.; Cattai, A.; Cavallo, F.R.; Chapkin, M.; Charpentier, P.; Checchia, P.; Chelkov, G.A.; Chierici, R.; Shlyapnikov, P.; Chochula, P.; Chorowicz, V.; Chudoba, J.; Cieslik, K.; Collins, P.; Contri, R.; Cortina, E.; Cosme, G.; Cossutti, F.; Costa, M.; Crawley, H.B.; Crennell, D.; Croix, J.; Cuevas Maestro, J.; Czellar, S.; D'Hondt, J.; Dalmau, J.; Davenport, M.; Da Silva, W.; Della Ricca, G.; Delpierre, P.; Demaria, N.; De Angelis, A.; De Boer, W.; De Clercq, C.; De Lotto, B.; De Min, A.; De Paula, L.; Dijkstra, H.; Di Ciaccio, L.; Doroba, K.; Dracos, M.; Drees, J.; Dris, M.; Eigen, G.; Ekelof, T.; Ellert, M.; Elsing, M.; Engel, J.P.; Espirito Santo, M.C.; Fanourakis, G.; Fassouliotis, D.; Feindt, M.; Fernandez, J.; Ferrer, A.; Ferrer-Ribas, E.; Ferro, F.; Firestone, A.; Flagmeyer, U.; Foeth, H.; Fokitis, E.; Fontanelli, F.; Franek, B.; Frodesen, A.G.; Fruhwirth, R.; Fulda-Quenzer, F.; Fuster, J.; Gamba, D.; Gamblin, S.; Gandelman, M.; Garcia, C.; Gaspar, C.; Gaspar, M.; Gasparini, U.; Gavillet, P.; Gazis, Evangelos; Gele, D.; Geralis, T.; Ghodbane, N.; Gil Botella, Ines; Glege, F.; Gokieli, R.; Golob, B.; Gomez-Ceballos, G.; Goncalves, P.; Gonzalez Caballero, I.; Gopal, G.; Gorn, L.; Guz, Yu.; Gracco, V.; Grahl, J.; Graziani, E.; Grosdidier, G.; Grzelak, K.; Guy, J.; Haag, C.; Hahn, F.; Hahn, S.; Haider, S.; Hallgren, A.; Hamacher, K.; Hamilton, K.; Hansen, J.; Harris, F.J.; Haug, S.; Hauler, F.; Hedberg, V.; Heising, S.; Hernandez, J.J.; Herquet, P.; Herr, H.; Hertz, O.; Higon, E.; Holmgren, S.O.; Holt, P.J.; Hoorelbeke, S.; Houlden, M.; Hrubec, J.; Hughes, G.J.; Hultqvist, K.; Jackson, John Neil; Jacobsson, R.; Jalocha, P.; Jarlskog, C.; Jarlskog, G.; Jarry, P.; Jean-Marie, B.; Jeans, D.; Johansson, Erik Karl; Jonsson, P.; Joram, C.; Juillot, P.; Jungermann, L.; Kapusta, Frederic; Karafasoulis, K.; Katsanevas, S.; Katsoufis, E.C.; Keranen, R.; Kernel, G.; Kersevan, B.P.; Khokhlov, Yu.A.; Khomenko, B.A.; Khovansky, N.N.; Kiiskinen, A.; King, B.; Kinvig, A.; Kjaer, N.J.; Klapp, O.; Kluit, P.; Kokkinias, P.; Kostyukhin, V.; Kourkoumelis, C.; Kuznetsov, O.; Krammer, M.; Kriznic, E.; Krumshtein, Z.; Kubinec, P.; Kucharczyk, M.; Kurowska, J.; Lamsa, J.W.; Laugier, J.P.; Leder, G.; Ledroit, Fabienne; Leinonen, L.; Leisos, A.; Leitner, R.; Lemonne, J.; Lenzen, G.; Lepeltier, V.; Lesiak, T.; Lethuillier, M.; Libby, J.; Liebig, W.; Liko, D.; Lipniacka, A.; Lippi, I.; Loken, J.G.; Lopes, J.H.; Lopez, J.M.; Lopez-Fernandez, R.; Loukas, D.; Lutz, P.; Lyons, L.; MacNaughton, J.; Mahon, J.R.; Maio, A.; Malek, A.; Maltezos, S.; Malychev, V.; Mandl, F.; Marco, J.; Marco, R.; Marechal, B.; Margoni, M.; Marin, J.C.; Mariotti, C.; Markou, A.; Martinez-Rivero, C.; Marti i Garcia, S.; Masik, J.; Mastroyiannopoulos, N.; Matorras, F.; Matteuzzi, C.; Matthiae, G.; Mazzucato, F.; Mazzucato, M.; McCubbin, M.; McKay, R.; McNulty, R.; Merle, E.; Meroni, C.; Meyer, W.T.; Myagkov, A.; Migliore, E.; Mirabito, L.; Mitaroff, W.A.; Mjornmark, U.; Moa, T.; Moch, M.; Monig, Klaus; Monge, M.R.; Montenegro, J.; Moraes, D.; Morettini, P.; Morton, G.; Muller, U.; Munich, K.; Mulders, M.; Mundim, L.M.; Murray, W.J.; Muryn, B.; Myatt, G.; Myklebust, T.; Nassiakou, M.; Navarria, F.L.; Nawrocki, K.; Negri, P.; Nemecek, S.; Neufeld, N.; Nicolaidou, R.; Niezurawski, P.; Nikolenko, M.; Nomokonov, V.; Nygren, A.; Obraztsov, V.; Olshevsky, A.G.; Onofre, A.; Orava, R.; Osterberg, K.; Ouraou, A.; Oyanguren, A.; Paganoni, M.; Paiano, S.; Pain, R.; Paiva, R.; Palacios, J.; Palka, H.; Papadopoulou, T.D.; Pape, L.; Parkes, C.; Parodi, F.; Parzefall, U.; Passeri, A.; Passon, O.; Peralta, L.; Perepelitsa, V.; Pernicka, M.; Perrotta, A.; Petridou, C.; Petrolini, A.; Phillips, H.T.; Pierre, F.; Pimenta, M.; Piotto, E.; Podobnik, T.; Poireau, V.; Pol, M.E.; Polok, G.; Poropat, P.; Pozdnyakov, V.; Privitera, P.; Pukhaeva, N.; Pullia, A.; Radojicic, D.; Ragazzi, S.; Rahmani, H.; Ratoff, P.N.; Read, Alexander L.; Rebecchi, P.; Redaelli, Nicola Giuseppe; Regler, M.; Rehn, J.; Reid, D.; Reinhardt, R.; Renton, P.B.; Resvanis, L.K.; Richard, F.; Ridky, J.; Rinaudo, G.; Ripp-Baudot, Isabelle; Romero, A.; Ronchese, P.; Rosenberg, E.I.; Rosinsky, P.; Rovelli, T.; Ruhlmann-Kleider, V.; Ruiz, A.; Saarikko, H.; Sacquin, Y.; Sadovsky, A.; Sajot, G.; Salmi, L.; Salt, J.; Sampsonidis, D.; Sannino, M.; Savoy-Navarro, A.; Schwanda, C.; Schwemling, P.; Schwering, B.; Schwickerath, U.; Scuri, Fabrizio; Seager, P.; Sedykh, Yu.; Segar, A.M.; Sekulin, R.; Sette, G.; Shellard, R.C.; Siebel, M.; Simard, L.; Simonetto, F.; Sisakian, A.N.; Smadja, G.; Smirnova, O.; Smith, G.R.; Sokolov, A.; Solovianov, O.; Sopczak, A.; Sosnowski, R.; Spassoff, T.; Spiriti, E.; Squarcia, S.; Stanescu, C.; Stanitzki, M.; Stocchi, A.; Strauss, J.; Strub, R.; Stugu, B.; Szczekowski, M.; Szeptycka, M.; Tabarelli, T.; Taffard, A.; Tegenfeldt, F.; Terranova, F.; Timmermans, Jan; Tinti, N.; Tkachev, L.G.; Tobin, M.; Todorova, S.; Tome, B.; Tonazzo, A.; Tortora, L.; Tortosa, P.; Treille, D.; Tristram, G.; Trochimczuk, M.; Troncon, C.; Turluer, M.L.; Tyapkin, I.A.; Tyapkin, P.; Tzamarias, S.; Ullaland, O.; Uvarov, V.; Valenti, G.; Vallazza, E.; Vander Velde, C.; Van Dam, Piet; Van Den Boeck, W.; Van Doninck, Walter; Van Eldik, J.; Van Lysebetten, A.; Van Remortel, N.; Van Vulpen, I.; Vegni, G.; Ventura, L.; Venus, W.; Verbeure, F.; Verdier, P.; Verlato, M.; Vertogradov, L.S.; Verzi, V.; Vilanova, D.; Vitale, L.; Vlasov, E.; Vodopianov, A.S.; Voulgaris, G.; Vrba, V.; Wahlen, H.; Washbrook, A.J.; Weiser, C.; Wicke, D.; Wickens, J.H.; Wilkinson, G.R.; Winter, M.; Witek, M.; Wolf, G.; Yi, J.; Yushchenko, O.; Zalewska, A.; Zalewski, P.; Zavrtanik, D.; Zevgolatakos, E.; Zimine, N.I.; Zinchenko, A.; Zoller, P.; Zumerle, G.; Zupan, M.

    2002-01-01

    A search for pair-produced charged Higgs bosons was performed in the high energy data collected by the DELPHI detector at LEP II at centre-of-mass energies from 189~GeV to 202~GeV\\@. The three different final states, $\\tau \

  19. An abundance of rare functional variants in 202 drug target genes sequenced in 14.002 people

    DEFF Research Database (Denmark)

    Nelson, Matthew R.; Wegmann, Daniel; Ehm, Margaret G.

    2012-01-01

    Rare genetic variants contribute to complex disease risk; however, the abundance of rare variants in human populations remains unknown. We explored this spectrum of variation by sequencing 202 genes encoding drug targets in 14,002 individuals. We find rare variants are abundant (1 every 17 bases)...

  20. 5 CFR 894.202 - If I enroll for self plus one, may I decide which family member to cover?

    Science.gov (United States)

    2010-01-01

    ... MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL EMPLOYEES DENTAL AND VISION INSURANCE PROGRAM Coverage and Types of Enrollment § 894.202 If I enroll for self plus one, may I decide which... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false If I enroll for self plus one, may I...

  1. β-delayed γ-ray spectroscopy of 203,204Au and 200-202Pt

    Science.gov (United States)

    Morales, A. I.; Benlliure, J.; Górska, M.; Grawe, H.; Verma, S.; Regan, P. H.; Podolyák, Zs.; Pietri, S.; Kumar, R.; Casarejos, E.; Algora, A.; Alkhomashi, N.; Álvarez-Pol, H.; Benzoni, G.; Blazhev, A.; Boutachkov, P.; Bruce, A. M.; Cáceres, L. S.; Cullen, I. J.; Denis Bacelar, A. M.; Doornenbal, P.; Estévez-Aguado, M. E.; Farrelly, G.; Fujita, Y.; Garnsworthy, A. B.; Gelletly, W.; Gerl, J.; Grebosz, J.; Hoischen, R.; Kojouharov, I.; Kurz, N.; Lalkovski, S.; Liu, Z.; Mihai, C.; Molina, F.; Mücher, D.; Prokopowicz, W.; Rubio, B.; Schaffner, H.; Steer, S. J.; Tamii, A.; Tashenov, S.; Valiente-Dobón, J. J.; Walker, P. M.; Wollersheim, H. J.; Woods, P. J.

    2013-07-01

    The β decay of five heavy, neutron-rich nuclei, 203,204Pt and 200-202Ir, has been investigated following relativistic cold fragmentation reactions of lead projectiles using the FRS+RISING setup at GSI. This paper reports on the study of the low-lying states in the decay daughter nuclei 203,204Au and 200-202Pt. The characteristic γ rays for each nucleus have been determined using β-delayed γ-ray spectroscopy. Tentative level schemes, relative intensities, and apparent β feedings are provided. These data are compared with shell-model calculations, which indicate a substantial contribution to the total β strength from high-energy first-forbidden β-decay transitions in this mass region.

  2. Search for Single Top Production in $e^{+}e^{-}$ Collisions at $\\sqrt{s}$ = 189 - 202 GeV

    CERN Document Server

    Barate, R; Ghez, P; Goy, C; Jézéquel, S; Lees, J P; Martin, F; Merle, E; Minard, M N; Pietrzyk, B; Alemany, R; Bravo, S; Casado, M P; Chmeissani, M; Crespo, J M; Fernández, E; Fernández-Bosman, M; Garrido, L; Graugès-Pous, E; Juste, A; Martínez, M; Merino, G; Miquel, R; Mir, L M; Morawitz, P; Pacheco, A; Riu, I; Ruiz, H; Colaleo, A; Creanza, D; De Palma, M; Iaselli, Giuseppe; Maggi, G; Maggi, M; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Abbaneo, D; Boix, G; Buchmüller, O L; Cattaneo, M; Cerutti, F; Ciulli, V; Davies, G; Dissertori, G; Drevermann, H; Forty, Roger W; Frank, M; Gianotti, F; Greening, T C; Halley, A W; Hansen, J B; Harvey, J; Janot, P; Jost, B; Kado, M; Leroy, O; Maley, P; Mato, P; Minten, Adolf G; Moutoussi, A; Ranjard, F; Rolandi, Luigi; Schlatter, W D; Schmitt, M; Schneider, O; Spagnolo, P; Tejessy, W; Teubert, F; Tournefier, E; Valassi, Andrea; Wright, A E; Ajaltouni, Ziad J; Badaud, F; Chazelle, G; Deschamps, O; Dessagne, S; Falvard, A; Ferdi, C; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Pascolo, J M; Perret, P; Podlyski, F; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Rensch, B; Wäänänen, A; Daskalakis, G; Kyriakis, A; Markou, C; Simopoulou, Errietta; Vayaki, Anna; Blondel, A; Brient, J C; Machefert, F P; Rougé, A; Swynghedauw, M; Tanaka, R; Videau, H L; Focardi, E; Parrini, G; Zachariadou, K; Corden, M; Georgiopoulos, C H; Antonelli, A; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Chiarella, V; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Chalmers, M; Kennedy, J; Lynch, J G; Negus, P; O'Shea, V; Räven, B; Smith, D; Teixeira-Dias, P; Thompson, A S; Ward, J J; Cavanaugh, R J; Dhamotharan, S; Geweniger, C; Hanke, P; Hepp, V; Kluge, E E; Leibenguth, G; Putzer, A; Tittel, K; Werner, S; Wunsch, M; Beuselinck, R; Binnie, David M; Cameron, W; Dornan, Peter J; Girone, M; Goodsir, S M; Marinelli, N; Martin, E B; Nash, J; Nowell, J; Przysiezniak, H; Sciabà, A; Sedgbeer, J K; Thompson, J C; Thomson, E; Williams, M D; Ghete, V M; Girtler, P; Kneringer, E; Kuhn, D; Rudolph, G; Bowdery, C K; Buck, P G; Ellis, G; Finch, A J; Foster, F; Hughes, G; Jones, R W L; Robertson, N A; Smizanska, M; Williams, M I; Giehl, I; Hölldorfer, F; Jakobs, K; Kleinknecht, K; Kröcker, M; Müller, A S; Nürnberger, H A; Quast, G; Renk, B; Rohne, E; Sander, H G; Schmeling, S; Wachsmuth, H W; Zeitnitz, C; Ziegler, T; Bonissent, A; Carr, J; Coyle, P; Ealet, A; Fouchez, D; Payre, P; Rousseau, D; Tilquin, A; Aleppo, M; Antonelli, M; Gilardoni, S S; Ragusa, F; Büscher, V; Dietl, H; Ganis, G; Hüttmann, K; Lütjens, G; Mannert, C; Männer, W; Moser, H G; Schael, S; Settles, Ronald; Seywerd, H C J; Stenzel, H; Wiedenmann, W; Wolf, G; Azzurri, P; Boucrot, J; Callot, O; Chen, S; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Jacholkowska, A; Lefrançois, J; Serin, L; Veillet, J J; Videau, I; De Vivie de Régie, J B; Zerwas, D; Bagliesi, G; Boccali, T; Bozzi, C; Calderini, G; Dell'Orso, R; Ferrante, I; Giassi, A; Gregorio, A; Ligabue, F; Marrocchesi, P S; Messineo, A; Palla, Fabrizio; Rizzo, G; Sanguinetti, G; Sguazzoni, G; Tenchini, Roberto; Venturi, A; Verdini, P G; Blair, G A; Coles, J; Cowan, G D; Green, M G; Hutchcroft, D E; Jones, L T; Medcalf, T; Strong, J A; Botterill, David R; Clifft, R W; Edgecock, T R; Norton, P R; Tomalin, I R; Bloch-Devaux, B; Colas, P; Fabbro, B; Faïf, G; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Rander, J; Renardy, J F; Rosowsky, A; Seager, P; Trabelsi, A; Tuchming, B; Vallage, B; Black, S N; Dann, J H; Loomis, C; Kim, H Y; Konstantinidis, N P; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Cartwright, S L; Combley, F; Hodgson, P N; Lehto, M H; Thompson, L F; Affholderbach, K; Böhrer, A; Brandt, S; Grupen, Claus; Hess, J; Misiejuk, A; Prange, G; Sieler, U; Borean, C; Giannini, G; Gobbo, B; Pütz, J; Rothberg, J E; Wasserbaech, S R; Williams, R W; Armstrong, S R; Elmer, P; Ferguson, D P S; Gao, Y; González, S; Hayes, O J; Hu, H; Jin, S; Kile, J; McNamara, P A; Nielsen, J; Orejudos, W; Pan, Y B; Saadi, Y; Scott, I J; Walsh, J; Von Wimmersperg-Töller, J H; Wu Sau Lan; Wu, X; Zobernig, G

    2000-01-01

    The single top production via flavour changing neutral currents in the reactions ee -> t c/u is searched for in approximately 411 pb-1 of data collected by ALEPH at centre-of-mass energies in the range between 189 and 202 GeV. In total, 58 events are selected in the data to be compared with 50.3 expected from Standard Model backgrounds. No deviation from the Standard Model expectation is observed. A 95\\%~CL upper limit of 0.72 pb on the single top production cross section at 202 GeV is derived assuming a top mass of 174 GeV/c^2 and a 100% branching ratio of the top decay into bW. A model dependent limit on the flavour-changing couplings kZ and kg is obtained by combining all centre-of-mass energies.

  3. Headspace vapor characterization of Hanford waste tank 241-B-202: Results from samples collected on 7/18/96

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, B.L.; Evans, J.C.; Pool, K.H.; Olsen, K.B.; Fruchter, J.S.; Silvers, K.L.

    1997-01-01

    This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-B-202 (Tank B-202) at the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank farm operations. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNNL). A summary of the inorganic analytes, permanent gases, and total non-methane organic compounds is listed in a table. Detailed descriptions of the analytical results appear in the appendices.

  4. Headspace vapor characterization of Hanford waste Tank 241-C-202: Results from samples collected on 06/25/96

    Energy Technology Data Exchange (ETDEWEB)

    Pool, K.H.; Evans, J.C.; Thomas, B.L.; Olsen, K.B.; Fruchter, J.S.; Silvers, K.L.

    1997-01-01

    This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-C-202 (Tank C-202) at the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank farm operations. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNNL). Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Analyte concentrations were based on analytical results and, where appropriate, on sample volumes provided by WHC. A summary of the inorganic analytes, permanent gases, and total non-methane organic compounds is listed in a table. Detailed descriptions of the analytical results appear in the appendices.

  5. Search for single top production in e+e- collisions at /sqrt(s)=189-/202 GeV

    Science.gov (United States)

    Barate, R.; Decamp, D.; Ghez, P.; Goy, C.; Jezequel, S.; Lees, J.-P.; Martin, F.; Merle, E.; Minard, M.-N.; Pietrzyk, B.; Przysiezniak, H.; Alemany, R.; Casado, M. P.; Chmeissani, M.; Crespo, J. M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, Ll.; Graugés, E.; Juste, A.; Martinez, M.; Merino, G.; Miquel, R.; Mir, Ll. M.; Morawitz, P.; Pacheco, A.; Park, I. C.; Riu, I.; Colaleo, A.; Creanza, D.; de Palma, M.; Iaselli, G.; Maggi, G.; Maggi, M.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Becker, U.; Boix, G.; Cattaneo, M.; Cerutti, F.; Ciulli, V.; Dissertori, G.; Drevermann, H.; Forty, R. W.; Frank, M.; Gianotti, F.; Greening, T. C.; Halley, A. W.; Hansen, J. B.; Harvey, J.; Janot, P.; Jost, B.; Lehraus, I.; Leroy, O.; Loomis, C.; Maley, P.; Mato, P.; Minten, A.; Moutoussi, A.; Ranjard, F.; Rolandi, L.; Schlatter, D.; Schmitt, M.; Schneider, O.; Spagnolo, P.; Tejessy, W.; Teubert, F.; Tomalin, I. R.; Tournefier, E.; Wright, A. E.; Ajaltouni, Z.; Badaud, F.; Chazelle, G.; Deschamps, O.; Dessagne, S.; Falvard, A.; Ferdi, C.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Nilsson, B. S.; Rensch, B.; Wäänänen, A.; Daskalakis, G.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Blondel, A.; Brient, J.-C.; Machefert, F.; Rougé, A.; Swynghedauw, M.; Tanaka, R.; Valassi, A.; Videau, H.; Focardi, E.; Parrini, G.; Zachariadou, K.; Cavanaugh, R.; Corden, M.; Georgiopoulos, C.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Chiarella, V.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Chalmers, M.; Curtis, L.; Lynch, J. G.; Negus, P.; O'Shea, V.; Raeven, B.; Raine, C.; Smith, D.; Teixeira-Dias, P.; Thompson, A. S.; Ward, J. J.; Buchmüller, O.; Dhamotharan, S.; Geweniger, C.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E. E.; Putzer, A.; Sommer, J.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Dornan, P. J.; Girone, M.; Goodsir, S.; Marinelli, N.; Martin, E. B.; Nash, J.; Nowell, J.; Sciabà, A.; Sedgbeer, J. K.; Thomson, E.; Williams, M. D.; Ghete, V. M.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Bowdery, C. K.; Buck, P. G.; Ellis, G.; Finch, A. J.; Foster, F.; Hughes, G.; Jones, R. W. L.; Robertson, N. A.; Smizanska, M.; Williams, M. I.; Giehl, I.; Hölldorfer, F.; Jakobs, K.; Kleinknecht, K.; Kröcker, M.; Müller, A.-S.; Nürnberger, H.-A.; Quast, G.; Renk, B.; Rohne, E.; Sander, H.-G.; Schmeling, S.; Wachsmuth, H.; Zeitnitz, C.; Ziegler, T.; Aubert, J. J.; Benchouk, C.; Bonissent, A.; Carr, J.; Coyle, P.; Ealet, A.; Fouchez, D.; Motsch, F.; Payre, P.; Rousseau, D.; Talby, M.; Thulasidas, M.; Tilquin, A.; Aleppo, M.; Antonelli, M.; Ragusa, F.; Büscher, V.; Dietl, H.; Ganis, G.; Hüttmann, K.; Lütjens, G.; Mannert, C.; Männer, W.; Moser, H.-G.; Schael, S.; Settles, R.; Seywerd, H.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Azzurri, P.; Boucrot, J.; Callot, O.; Chen, S.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Jacholkowska, A.; Kado, M.; Lefrançois, J.; Serin, L.; Veillet, J.-J.; Videau, I.; de Vivie de Régie, J.-B.; Zerwas, D.; Bagliesi, G.; Bettarini, S.; Boccali, T.; Bozzi, C.; Calderini, G.; Dell'Orso, R.; Ferrante, I.; Giassi, A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Sguazzoni, G.; Tenchini, R.; Vannini, C.; Venturi, A.; Verdini, P. G.; Blair, G. A.; Coles, J.; Cowan, G.; Green, M. G.; Hutchcroft, D. E.; Jones, L. T.; Medcalf, T.; Strong, J. A.; von Wimmersperg-Toeller, J. H.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Norton, P. R.; Thompson, J. C.; Bloch-Devaux, B.; Colas, P.; Fabbro, B.; Faïf, G.; Lançon, E.; Lemaire, M.-C.; Locci, E.; Perez, P.; Rander, J.; Renardy, J.-F.; Rosowsky, A.; Trabelsi, A.; Tuchming, B.; Vallage, B.; Black, S. N.; Dann, J. H.; Kim, H. Y.; Konstantinidis, N.; Litke, A. M.; McNeil, M. A.; Taylor, G.; Booth, C. N.; Cartwright, S.; Combley, F.; Hodgson, P. N.; Kelly, M. S.; Lehto, M.; Thompson, L. F.; Affholderbach, K.; Böhrer, A.; Brandt, S.; Grupen, C.; Hess, J.; Misiejuk, A.; Prange, G.; Sieler, U.; Giannini, G.; Gobbo, B.; Putz, J.; Rothberg, J.; Wasserbaech, S.; Williams, R. W.; Armstrong, S. R.; Elmer, P.; Ferguson, D. P. S.; Gao, Y.; González, S.; Hayes, O. J.; Hu, H.; Jin, S.; McNamara, P. A., III; Nielsen, J.; Orejudos, W.; Pan, Y. B.; Saadi, Y.; Scott, I. J.; Walsh, J.; Wu, S. L.; Wu, X.; Zobernig, G.

    2000-11-01

    Single top production via flavour changing neutral currents in the reactions e+e--->t¯c/u is searched for in approximately 411 pb-1 of data collected by ALEPH at centre-of-mass energies in the range between 189 and 202 GeV. In total, 58 events are selected in the data to be compared with 50.3 expected from Standard Model backgrounds. No deviation from the Standard Model expectation is observed. Upper limits at 95% CL on single top production cross sections at /sqrt(s)=189-/202 GeV are derived. A model-dependent limit on the sum of branching ratios /BR(t-->Zc)+BR(t-->Zu)<17% is obtained.

  6. Immunogenicity of hydrolysate formulas in children (part 1). Analysis of 202 reactions.

    Science.gov (United States)

    Cantani, A; Micera, M

    2000-01-01

    Cow's milk protein hydrolyzed formulas appeared in the 1940s with the aim of decreasing or eliminating the allergenicity of cow's milk proteins, in addition to reducing the risk of sensitization. In recent years, the so-called "hypoallergenic" formulas have been developed. The use of such hydrolyzed formulas is based on the premise that predigested proteins, when fed as amino acids and peptides, provide nutrients in a nonantigenic form. Thus, protein hydrolyzed formulas have been classified as hypoallergenic. These formulas are processed by heat and enzymatic hydrolysis, and the conformational and sequential structures are more or less changed. The formulas contain peptides of lower molecular weight than the native protein source, which are thought to be less immunogenic. Hydrolyzed formulas appear to be nutritionally adequate and infants generally gain weight until they refuse the formula because of its bad taste. However, caution should be taken when such formulas are given for prolonged periods since no data are available on nutritional assessment of infants exclusively fed hydrolyzed formulas for several months. In this paper we report and discuss more than 202 reactions to different hydrolyzed formulas, including cases of anaphylactic shock and apparent life-threatening events. The cross-reactivity between different hydrolyzed formulas and cow's milk proteins, and the potential immunogenicity of such formulas are discussed. We conclude that none of the hydrolyzed formulas are nonallergenic, both for allergic children and for high-risk babies. Moreover, we suggest that double-blind placebo-controlled food challenge studies in larger cohorts of babies evaluated with well-defined and well-validated diagnostic methods may establish a more reliable prevalence of allergy to hydrolyzed formulas.

  7. Arp 202: a TDG formed in a parent's extended dark matter halo?

    Science.gov (United States)

    Scott, T. C.; Lagos, P.; Ramya, S.; Sengupta, C.; Paudel, S.; Sahu, D. K.; Misra, K.; Woo, J.-H.; Sohn, B. W.

    2018-03-01

    We report on H α + [N II] imaging of the Arp 202 interacting pair and its tidal dwarf galaxy (TDG) candidate as well as a GMOS long slit spectrum from the TDG candidate, observed with the Gemini North telescope. Our H α + [N II] imaging reveals the TDG to have an elongated structure, ˜ 1.9 kpc in length with the two principal star-forming knots at either end. Our observations also show the TDG candidate has a recessional VH α ˜ 3032 km s-1, within 100 km s-1 of the parent pair's mean velocity and an oxygen abundance of 12+log(O/H) = 8.10±0.41. The TDG's oxygen abundance is in good agreement with that of a star-forming region in NGC 2719A, one of the parent galaxies, which has an estimated oxygen abundance of 12+log(O/H) = 8.05 ± 0.41. The TDG's VH α and oxygen abundance confirm previous results validating the candidate as a TDG. The absence of detectable emission from the TDG in Spitzer 3.6 and 4.5 μm images together with the lack of absorption lines and weak continuum in the spectrum is consistent with absence the of an old population (≳0.5 Gyr). The location of the TDG within the interaction debris and the absence of indicators of an old stellar population in the TDG is consistent with a scenario in which the TDG is formed from H I stripped from the parent galaxies and within the extended dark matter halo of one of the parents as proposed by Bournaud et al. and Duc et al.

  8. SAR202 Genomes from the Dark Ocean Predict Pathways for the Oxidation of Recalcitrant Dissolved Organic Matter.

    Science.gov (United States)

    Landry, Zachary; Swan, Brandon K; Herndl, Gerhard J; Stepanauskas, Ramunas; Giovannoni, Stephen J

    2017-04-18

    Deep-ocean regions beyond the reach of sunlight contain an estimated 615 Pg of dissolved organic matter (DOM), much of which persists for thousands of years. It is thought that bacteria oxidize DOM until it is too dilute or refractory to support microbial activity. We analyzed five single-amplified genomes (SAGs) from the abundant SAR202 clade of dark-ocean bacterioplankton and found they encode multiple families of paralogous enzymes involved in carbon catabolism, including several families of oxidative enzymes that we hypothesize participate in the degradation of cyclic alkanes. The five partial genomes encoded 152 flavin mononucleotide/F420-dependent monooxygenases (FMNOs), many of which are predicted to be type II Baeyer-Villiger monooxygenases (BVMOs) that catalyze oxygen insertion into semilabile alicyclic alkanes. The large number of oxidative enzymes, as well as other families of enzymes that appear to play complementary roles in catabolic pathways, suggests that SAR202 might catalyze final steps in the biological oxidation of relatively recalcitrant organic compounds to refractory compounds that persist. IMPORTANCE Carbon in the ocean is massively sequestered in a complex mixture of biologically refractory molecules that accumulate as the chemical end member of biological oxidation and diagenetic change. However, few details are known about the biochemical machinery of carbon sequestration in the deep ocean. Reconstruction of the metabolism of a deep-ocean microbial clade, SAR202, led to postulation of new biochemical pathways that may be the penultimate stages of DOM oxidation to refractory forms that persist. These pathways are tied to a proliferation of oxidative enzymes. This research illuminates dark-ocean biochemistry that is broadly consequential for reconstructing the global carbon cycle. Copyright © 2017 Landry et al.

  9. Search for Excited Leptons in $e^+ e^-$ Interactions at $\\sqrt{s}$=192 - 202 GeV

    CERN Document Server

    Acciarri, M.; Adriani, O.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Ambrosi, G.; Anderhub, H.; Andreev, Valery P.; Angelescu, T.; Anselmo, F.; Arefev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Bajo, A.; Baksay, L.; Balandras, A.; Baldew, S.V.; Banerjee, S.; Banerjee, Sw.; Barczyk, A.; Barillere, R.; Bartalini, P.; Basile, M.; Batalova, N.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berbeco, R.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Bhattacharya, S.; Biasini, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brochu, F.; Buffini, A.; Buijs, A.; Burger, J.D.; Burger, W.J.; Cai, X.D.; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.M.; Casaus, J.; Castellini, G.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Cesaroni, F.; Chamizo, M.; Chang, Y.H.; Chaturvedi, U.K.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Civinini, C.; Clare, I.; Clare, R.; Coignet, G.; Colino, N.; Costantini, S.; Cotorobai, F.; de la Cruz, B.; Csilling, A.; Cucciarelli, S.; Dai, T.S.; van Dalen, J.A.; D'Alessandro, R.; de Asmundis, R.; Deglon, P.; Degre, A.; Deiters, K.; della Volpe, D.; Delmeire, E.; Denes, P.; DeNotaristefani, F.; De Salvo, A.; Diemoz, M.; Dierckxsens, M.; van Dierendonck, D.; Dionisi, C.; Dittmar, M.; Dominguez, A.; Doria, A.; Dova, M.T.; Duchesneau, D.; Dufournaud, D.; Duinker, P.; Duran, I.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Erne, F.C.; Ewers, A.; Extermann, P.; Fabre, M.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisk, I.; Forconi, G.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gau, S.S.; Gentile, S.; Gheordanescu, N.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; van Gulik, R.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hasan, A.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hidas, P.; Hirschfelder, J.; Hofer, H.; Holzner, G.; Hoorani, H.; Hou, S.R.; Hu, Y.; Iashvili, I.; Jin, B.N.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Khan, R.A.; Kafer, D.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, D.; Kim, J.K.; Kirkby, Jasper; Kiss, D.; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopal, M.; Kopp, A.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Krenz, W.; Kruger, A.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Lee, H.J.; Le Goff, J.M.; Leiste, R.; Levtchenko, P.; Li, C.; Likhoded, S.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Lubelsmeyer, K.; Luci, C.; Luckey, David; Lugnier, L.; Luminari, L.; Lustermann, W.; Ma, W.G.; Maity, M.; Malgeri, L.; Malinin, A.; Mana, C.; Mangeol, D.; Mans, J.; Marian, G.; Martin, J.P.; Marzano, F.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; von der Mey, M.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Moulik, T.; Muanza, G.S.; Muijs, A.J.M.; Musicar, B.; Musy, M.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Niessen, T.; Nisati, A.; Kluge, Hannelies; Ofierzynski, R.; Organtini, G.; Oulianov, A.; Palomares, C.; Pandoulas, D.; Paoletti, S.; Paolucci, P.; Paramatti, R.; Park, H.K.; Park, I.H.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Petersen, B.; Piccolo, D.; Pierella, F.; Pieri, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Postema, H.; Pothier, J.; Prokofev, D.O.; Prokofiev, D.; Quartieri, J.; Rahal-Callot, G.; Rahaman, M.A.; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Ranieri, R.; Raspereza, A.; Raven, G.; Razis, P.; Ren, D.; Rescigno, M.; Reucroft, S.; Riemann, S.; Riles, Keith; Rodin, J.; Roe, B.P.; Romero, L.; Rosca, A.; Rosier-Lees, S.; Roth, Stefan; Rosenbleck, C.; Rubio, J.A.; Ruggiero, G.; Rykaczewski, H.; Saremi, S.; Sarkar, S.; Salicio, J.; Sanchez, E.; Sanders, M.P.; Schafer, C.; Schegelsky, V.; Schmidt-Kaerst, S.; Schmitz, D.; Schopper, H.; Schotanus, D.J.; Schwering, G.; Sciacca, C.; Seganti, A.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Siedenburg, T.; Son, D.; Smith, B.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stone, A.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Sushkov, S.; Suter, H.; Swain, J.D.; Szillasi, Z.; Sztaricskai, T.; Tang, X.W.; Tauscher, L.; Taylor, L.; Tellili, B.; Timmermans, Charles; Ting, Samuel C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Uchida, Y.; Ulbricht, J.; Valente, E.; Vesztergombi, G.; Vetlitsky, I.; Vicinanza, D.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobev, I.; Vorobyov, A.A.; Vorvolakos, A.; Wadhwa, M.; Wallraff, W.; Wang, M.; Wang, X.L.; Wang, Z.M.; Weber, A.; Weber, M.; Wienemann, P.; Wilkens, H.; Wu, S.X.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yamamoto, J.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Ye, J.B.; Yeh, S.C.; Zalite, An.; Zalite, Yu.; Zhang, Z.P.; Zhu, G.Y.; Zhu, R.Y.; Zichichi, A.; Zilizi, G.; Zimmermann, B.; Zoller, M.

    2001-01-01

    Excited leptons are searched for using the L3 detector at LEP. The data collected at centre-of-mass energies in the range from 192 up to 202 GeV correspond to a total luminosity of 233 $\\rm pb^{-1}$. No evidence of either pair production of excited leptons, nor of single production is found. From the searches for pair produced excited leptons, lower mass limits close to the kinematic limit are set. From the searches for singly produced excited leptons, upper limits on their couplings are derived in the mass range up to 200 GeV.

  10. Study of Z Boson Pair Production in $e^+ e^-$ Interactions at $\\sqrt{s}$ = 192-202 GeV

    CERN Document Server

    Acciarri, M.; Adriani, O.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Ambrosi, G.; Anderhub, H.; Andreev, Valery P.; Angelescu, T.; Anselmo, F.; Arefev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Bajo, A.; Baksay, L.; Balandras, A.; Baldew, S.V.; Banerjee, S.; Barczyk, A.; Barillere, R.; Bartalini, P.; Basile, M.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berbeco, R.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Bhattacharya, S.; Biasini, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brochu, F.; Buffini, A.; Buijs, A.; Burger, J.D.; Burger, W.J.; Cai, X.D.; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.M.; Casaus, J.; Castellini, G.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Cesaroni, F.; Chamizo, M.; Chang, Y.H.; Chaturvedi, U.K.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Civinini, C.; Clare, I.; Clare, R.; Coignet, G.; Colino, N.; Conventi, F.; Costantini, S.; Cotorobai, F.; de la Cruz, B.; Csilling, A.; Cucciarelli, S.; Dai, T.S.; van Dalen, J.A.; D'Alessandro, R.; de Asmundis, R.; Deglon, P.; Degre, A.; Deiters, K.; Della Pietra, M.; della Volpe, D.; Delmeire, E.; Denes, P.; DeNotaristefani, F.; De Salvo, A.; Diemoz, M.; Dierckxsens, M.; van Dierendonck, D.; Dionisi, C.; Dittmar, M.; Dominguez, A.; Doria, A.; Dova, M.T.; Duchesneau, D.; Dufournaud, D.; Duinker, P.; Duran, I.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Erne, F.C.; Extermann, P.; Fabre, M.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisk, I.; Forconi, G.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gau, S.S.; Gentile, S.; Gheordanescu, N.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; van Gulik, R.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hasan, A.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hidas, P.; Hirschfelder, J.; Hofer, H.; Holzner, G.; Hoorani, H.; Hou, S.R.; Hu, Y.; Iashvili, I.; Jin, B.N.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Khan, R.A.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, D.; Kim, J.K.; Kirkby, Jasper; Kiss, D.; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopal, M.; Kopp, A.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Krenz, W.; Kruger, A.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Lee, H.J.; Le Goff, J.M.; Leiste, R.; Levtchenko, P.; Li, C.; Likhoded, S.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Lubelsmeyer, K.; Luci, C.; Luckey, David; Lugnier, L.; Luminari, L.; Lustermann, W.; Ma, W.G.; Maity, M.; Malgeri, L.; Malinin, A.; Mana, C.; Mangeol, D.; Mans, J.; Marian, G.; Martin, J.P.; Marzano, F.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; von der Mey, M.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Moulik, T.; Muanza, G.S.; Muijs, A.J.M.; Musicar, B.; Musy, M.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Niessen, T.; Nisati, A.; Kluge, Hannelies; Ofierzynski, R.; Organtini, G.; Oulianov, A.; Palomares, C.; Pandoulas, D.; Paoletti, S.; Paolucci, P.; Paramatti, R.; Park, H.K.; Park, I.H.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Petersen, B.; Piccolo, D.; Pierella, F.; Pieri, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Postema, H.; Pothier, J.; Prokofev, D.O.; Prokofev, D.; Quartieri, J.; Rahal-Callot, G.; Rahaman, M.A.; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Ranieri, R.; Raspereza, A.; Raven, G.; Razis, P.; Ren, D.; Rescigno, M.; Reucroft, S.; Riemann, S.; Riles, Keith; Rodin, J.; Roe, B.P.; Romero, L.; Rosca, A.; Rosier-Lees, S.; Rubio, J.A.; Ruggiero, G.; Rykaczewski, H.; Saremi, S.; Sarkar, S.; Salicio, J.; Sanchez, E.; Sanders, M.P.; Sarakinos, M.E.; Schafer, C.; Schegelsky, V.; Schmidt-Kaerst, S.; Schmitz, D.; Schopper, H.; Schotanus, D.J.; Schwering, G.; Sciacca, C.; Seganti, A.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Siedenburg, T.; Son, D.; Smith, B.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stone, A.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Suter, H.; Swain, J.D.; Szillasi, Z.; Sztaricskai, T.; Tang, X.W.; Tauscher, L.; Taylor, L.; Tellili, B.; Timmermans, Charles; Ting, Samuel C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Uchida, Y.; Ulbricht, J.; Valente, E.; Vesztergombi, G.; Vetlitsky, I.; Vicinanza, D.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobev, I.; Vorobov, A.A.; Vorvolakos, A.; Wadhwa, M.; Wallraff, W.; Wang, M.; Wang, X.L.; Wang, Z.M.; Weber, A.; Weber, M.; Wienemann, P.; Wilkens, H.; Wu, S.X.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yamamoto, J.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Ye, J.B.; Yeh, S.C.; Zalite, A.; Zalite, Yu.; Zhang, Z.P.; Zhu, G.Y.; Zhu, R.Y.; Zichichi, A.; Zilizi, G.; Zimmermann, B.; Zoller, M.

    2001-01-01

    The cross section for the production of Z boson pairs is measured using the data collected by the L3 detector at LEP in 1999 in $\\rm e^+e^-$ collisions at centre--of--mass energies ranging from 192 GeV up to 202 GeV. Events in all the visible final states are selected, measuring the cross section of this process. The special case of final states containing b quarks is also investigated. All results are in agreement with the Standard Model predictions.

  11. $\\alpha_{S}$ Evolution from 35 GeV to 202 GeV and Flavour Independence

    CERN Document Server

    Biebel, O.

    2000-01-01

    Determinations of the strong coupling constant alpha_S at centre-of-mass energies of 192 through 202 GeV at LEP are presented. The energy evolution of alpha_S is in agreement with the prediction of QCD. The combined investigation of OPAL and JADE data in the energy range of 35 through 189 GeV yields alpha_S(m_Z)=0.1187^{+0.0034}_{-0.0019}. The strenght of the strong coupling is flavour independent if quark mass effects are taken into account.

  12. Transposon insertion sequencing reveals T4SS as the major genetic trait for conjugation transfer of multi-drug resistance pEIB202 from Edwardsiella.

    Science.gov (United States)

    Liu, Yang; Gao, Yanan; Liu, Xiaohong; Liu, Qin; Zhang, Yuanxing; Wang, Qiyao; Xiao, Jingfan

    2017-05-12

    Conjugation is a major type of horizontal transmission of genes that involves transfer of a plasmid into a recipient using specific conjugation machinery, which results in an extended spectrum of bacterial antibiotics resistance. However, there is inadequate knowledge about the regulator and mechanisms that control the conjugation processes, especially in an aquaculture environment where a cocktail of antibiotics may be present. Here, we investigated these with pEIB202, a typical multi-drug resistant IncP plasmid encoding tetracycline, streptomycin, sulfonamide and chloramphenicol resistance in fish pathogen Edwardsiella piscicida strain EIB202. We used transposon insertion sequencing (TIS) to identify genes that are responsible for conjugation transfer of pEIB202. All ten of the plasmid-borne type IV secretion system (T4SS) genes and a putative lipoprotein p007 were identified to play an important role in pEIB202 horizontal transfer. Antibiotics appear to modulate conjugation frequencies by repressing T4SS gene expression. In addition, we identified topA gene, which encodes topoisomerase I, as an inhibitor of pEIB202 transfer. Furthermore, the RNA-seq analysis of the response regulator EsrB encoded on the chromosome also revealed its essential role in facilitating the conjugation by upregulating the T4SS genes. Collectively, our screens unraveled the genetic basis of the conjugation transfer of pEIB202 and the influence of horizontally acquired EsrB on this process. Our results will improve the understanding of the mechanism of plasmid conjugation processes that facilitate dissemination of antibiotic resistance especially in aquaculture industries.

  13. IVS-II-648/649 (-T) (HBB: c.316-202del) Triggers a Novel β-Thalassemia Phenotype.

    Science.gov (United States)

    Azimi, Azam; Alibakhshi, Reza; Hayati, Hasibeh; Tahmasebi, Soosan; Alimoradi, Sasan

    2017-01-01

    Thalassemia is the most common inherited disorder in Iran. There are approximately 800 different genomic alterations of the β-globin gene described in the HbVar database. In this study, we identified a novel mutation in a 21-year-old woman [IVS-II-648/649 (-T); HBB: c.316-202del)] and describe its clinical implications. Two other members of this family, all with hematological and clinical features associated with β-thalassemia (β-thal), also carried this mutation. The molecular diagnosis of the β-globin gene mutation was performed by direct sequencing. Based on the observed β-thal phenotype and in silico analysis results, we concluded that this novel β-globin gene mutation was associated with the mild phenotype of β-thal.

  14. 76 FR 24832 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes, A330-300...

    Science.gov (United States)

    2011-05-03

    ...-201, -202, -203, - 223, and -243 Airplanes, A330-300 Series Airplanes, A340-200 Series Airplanes, and A340-300 Series Airplanes AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of... some rudders fitted on A330 and A340-200/-300 aeroplanes. An extended de-bonding, if not detected and...

  15. Corrigendum to ;Numerical dissipation control in high order shock-capturing schemes for LES of low speed flows; [J. Comput. Phys. 307 (2016) 189-202

    Science.gov (United States)

    Kotov, D. V.; Yee, H. C.; Wray, A. A.; Sjögreen, Björn; Kritsuk, A. G.

    2018-01-01

    The authors regret for the typographic errors that were made in equation (4) and missing phrase after equation (4) in the article ;Numerical dissipation control in high order shock-capturing schemes for LES of low speed flows; [J. Comput. Phys. 307 (2016) 189-202].

  16. Intracellular transport of acid beta-glucosidase and lysosome-associated membrane proteins is affected in Gaucher's disease (G202R mutation)

    NARCIS (Netherlands)

    Zimmer, K. P.; le Coutre, P.; Aerts, H. M.; Harzer, K.; Fukuda, M.; O'Brien, J. S.; Naim, H. Y.

    1999-01-01

    Gaucher's disease (GD) is caused by an inherited deficiency of acid beta-glucosidase with storage of glucosylceramides in the lysosomes of macrophages. This study identifies a G202R mutation in the acid beta-glucosidase gene in an infant with severe neuronopathic (type 2) GD and only slightly

  17. Quality of Life in Patients With Brain Metastases Using the EORTC QLQ-BN20+2 and QLQ-C15-PAL

    Energy Technology Data Exchange (ETDEWEB)

    Caissie, Amanda; Nguyen, Janet; Chen, Emily; Zhang Liying [Rapid Response Radiotherapy Program, Odette Cancer Centre, Sunnybrook Health Sciences Centre, University of Toronto, Toronto, Ontario (Canada); Sahgal, Arjun [Rapid Response Radiotherapy Program, Odette Cancer Centre, Sunnybrook Health Sciences Centre, University of Toronto, Toronto, Ontario (Canada); Department of Radiation Oncology, Princess Margaret Hospital, University of Toronto, Toronto, Ontario (Canada); Clemons, Mark [Department of Medical Oncology, Ottawa Hospital Cancer Centre, Ottawa, Ontario (Canada); Kerba, Marc [Department of Radiation Oncology, Tom Baker Cancer Centre, Calgary, Alberta (Canada); Arnalot, Palmira Foro [Parc de Salut Mar Hospital de l' Esperanca, Barcelona (Spain); Danjoux, Cyril; Tsao, May; Barnes, Elizabeth; Holden, Lori [Rapid Response Radiotherapy Program, Odette Cancer Centre, Sunnybrook Health Sciences Centre, University of Toronto, Toronto, Ontario (Canada); Danielson, Brita [Department of Radiation Oncology, Cross Cancer Institute, Edmonton, Alberta (Canada); Chow, Edward, E-mail: edward.chow@sunnybrook.ca [Rapid Response Radiotherapy Program, Odette Cancer Centre, Sunnybrook Health Sciences Centre, University of Toronto, Toronto, Ontario (Canada)

    2012-07-15

    Purpose: The 20-item European Organisation for Research and Treatment of Cancer Quality of Life Questionnaire-Brain Neoplasm (QLQ-BN20) is a validated quality-of-life (QOL) questionnaire for patients with primary brain tumors. The European Organisation for Research and Treatment of Cancer Quality of Life Questionnaire-Core 15 Palliative (QLQ-C15-PAL) core palliative questionnaire is a 15-item version of the core 30-item QLQ-C30 and was developed to decrease the burden on patients with advanced cancer. The combination of the QLQ-BN20 and QLQ-C30 to assess QOL may be too burdensome for patients. The primary aim of this study was to assess QOL in patients before and after treatment for brain metastases using the QLQ-BN20+2 and QLQ-C15-PAL, a version of the QLQ-BN20 questionnaire with 2 additional questions assessing cognitive functioning that were not addressed in the QLQ-C15-PAL. Methods and Materials: Patients with brain metastases completed the QLQ-C15-PAL and QLQ-BN20+2 questionnaires to assess QOL before and 1 month after radiation. Linear regression analysis was used to assess changes in QOL scores over time, as well as to explore associations between the QLQ-BN20+2 and QLQ-C15-PAL scales, patient demographics, and clinical variables. Spearman correlation assessed associations between the QLQ-BN20+2 and QLQ-C15-PAL scales. Results: Among 108 patients, the majority (55%) received whole-brain radiotherapy only, with 65% of patients completing follow-up at 1 month after treatment. The most prominent symptoms at baseline were future uncertainty (QLQ-BN20+2) and fatigue (QLQ-C15-PAL). After treatment, significant improvement was seen for the QLQ-C15-PAL insomnia scale, as well as the QLQ-BN20+2 scales of future uncertainty, visual disorder, and concentration difficulty. Baseline Karnofsky Performance Status was negatively correlated to QLQ-BN20+2 motor dysfunction but positively related to QLQ-C15-PAL physical functioning and QLQ-BN20+2 cognitive functioning at

  18. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  19. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  20. Carrier redistribution between different potential sites in semipolar (202¯1) InGaN quantum wells studied by near-field photoluminescence

    KAUST Repository

    Marcinkevičius, S.

    2014-09-15

    © 2014 AIP Publishing LLC. Scanning near-field photoluminescence (PL) spectroscopy at different excitation powers was applied to study nanoscale properties of carrier localization and recombination in semipolar (202¯1) InGaN quantum wells (QWs) emitting in violet, blue, and green-yellow spectral regions. With increased excitation power, an untypical PL peak energy shift to lower energies was observed. The shift was attributed to carrier density dependent carrier redistribution between nm-scale sites of different potentials. Near-field PL scans showed that in (202¯1) QWs the in-plane carrier diffusion is modest, and the recombination properties are uniform, which is advantageous for photonic applications.

  1. Search for the Standard Model Higgs boson in $e^+ e^-$ collisions at $\\sqrt{s}$ up to 202 GeV

    CERN Document Server

    Acciarri, M.; Adriani, O.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Ambrosi, G.; Anderhub, H.; Andreev, Valery P.; Angelescu, T.; Anselmo, F.; Arefev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Bajo, A.; Baksay, L.; Balandras, A.; Baldew, S.V.; Banerjee, S.; Banerjee, Sw.; Barczyk, A.; Barillere, R.; Bartalini, P.; Basile, M.; Batalova, N.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berbeco, R.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Bhattacharya, S.; Biasini, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brochu, F.; Buffini, A.; Buijs, A.; Burger, J.D.; Burger, W.J.; Cai, X.D.; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.M.; Casaus, J.; Castellini, G.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Cesaroni, F.; Chamizo, M.; Chang, Y.H.; Chaturvedi, U.K.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Civinini, C.; Clare, I.; Clare, R.; Coignet, G.; Colino, N.; Costantini, S.; Cotorobai, F.; de la Cruz, B.; Csilling, A.; Cucciarelli, S.; Dai, T.S.; van Dalen, J.A.; D'Alessandro, R.; de Asmundis, R.; Deglon, P.; Degre, A.; Deiters, K.; della Volpe, D.; Delmeire, E.; Denes, P.; DeNotaristefani, F.; De Salvo, A.; Diemoz, M.; Dierckxsens, M.; van Dierendonck, D.; Dionisi, C.; Dittmar, M.; Dominguez, A.; Doria, A.; Dova, M.T.; Duchesneau, D.; Dufournaud, D.; Duinker, P.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Erne, F.C.; Ewers, A.; Extermann, P.; Fabre, M.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisk, I.; Forconi, G.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gau, S.S.; Gentile, S.; Gheordanescu, N.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; van Gulik, R.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hasan, A.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hidas, P.; Hirschfelder, J.; Hofer, H.; Holzner, G.; Hoorani, H.; Hou, S.R.; Hu, Y.; Iashvili, I.; Jin, B.N.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Khan, R.A.; Kafer, D.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, D.; Kim, J.K.; Kirkby, Jasper; Kiss, D.; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopal, M.; Kopp, A.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Krenz, W.; Kruger, A.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Lee, H.J.; Le Goff, J.M.; Leiste, R.; Levtchenko, P.; Li, C.; Likhoded, S.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Lubelsmeyer, K.; Luci, C.; Luckey, David; Lugnier, L.; Luminari, L.; Lustermann, W.; Ma, W.G.; Maity, M.; Malgeri, L.; Malinin, A.; Mana, C.; Mangeol, D.; Mans, J.; Marian, G.; Martin, J.P.; Marzano, F.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; von der Mey, M.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Moulik, T.; Muanza, G.S.; Muijs, A.J.M.; Musicar, B.; Musy, M.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Niessen, T.; Nisati, A.; Kluge, Hannelies; Ofierzynski, R.; Organtini, G.; Oulianov, A.; Palomares, C.; Pandoulas, D.; Paoletti, S.; Paolucci, P.; Paramatti, R.; Park, H.K.; Park, I.H.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Petersen, B.; Piccolo, D.; Pierella, F.; Pieri, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Postema, H.; Pothier, J.; Prokofev, D.O.; Prokofiev, D.; Quartieri, J.; Rahal-Callot, G.; Rahaman, M.A.; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Ranieri, R.; Raspereza, A.; Raven, G.; Razis, P.; Ren, D.; Rescigno, M.; Reucroft, S.; Riemann, S.; Riles, Keith; Rodin, J.; Roe, B.P.; Romero, L.; Rosca, A.; Rosier-Lees, S.; Roth, Stefan; Rosenbleck, C.; Roux, B.; Rubio, J.A.; Ruggiero, G.; Rykaczewski, H.; Saremi, S.; Sarkar, S.; Salicio, J.; Sanchez, E.; Sanders, M.P.; Schafer, C.; Schegelsky, V.; Schmidt-Kaerst, S.; Schmitz, D.; Schopper, H.; Schotanus, D.J.; Schwering, G.; Sciacca, C.; Seganti, A.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Siedenburg, T.; Son, D.; Smith, B.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stone, A.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Sushkov, S.; Suter, H.; Swain, J.D.; Szillasi, Z.; Sztaricskai, T.; Tang, X.W.; Tauscher, L.; Taylor, L.; Tellili, B.; Teyssier, D.; Timmermans, Charles; Ting, Samuel C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Uchida, Y.; Ulbricht, J.; Valente, E.; Vesztergombi, G.; Vetlitsky, I.; Vicinanza, D.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobev, I.; Vorobov, A.A.; Vorvolakos, A.; Wadhwa, M.; Wallraff, W.; Wang, M.; Wang, X.L.; Wang, Z.M.; Weber, A.; Weber, M.; Wienemann, P.; Wilkens, H.; Wu, S.X.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yamamoto, J.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Ye, J.B.; Yeh, S.C.; Zalite, A.; Zalite, Yu.; Zhang, Z.P.; Zhu, G.Y.; Zhu, R.Y.; Zichichi, A.; Zilizi, G.; Zimmermann, B.; Zoller, M.

    2001-01-01

    The Standard Model Higgs boson is searched for in 233.2 pb-1 of data collected by the L3 detector at centre of mass energies from 192 GeV to 202 GeV. These data are consistent with the expectations of Standard Model processes and no evidence of a Higgs signal is observed. A lower limit on the mass of the Standard Model Higgs boson of 107.0 GeV is set at the 95% confidence level.

  2. Thr202Ala in thyA Is a Marker for the Latin American Mediterranean Lineage of the Mycobacterium tuberculosis Complex Rather than Para-Aminosalicylic Acid Resistance

    KAUST Repository

    Feuerriegel, S.

    2010-08-30

    Single nucleotide polymorphisms (SNPs) involved in the development of resistance represent powerful markers for the rapid detection of first- and second-line resistance in clinical Mycobacterium tuberculosis complex (MTBC) isolates. However, the association between particular mutations and phenotypic resistance is not always clear-cut, and phylogenetic SNPs have been misclassified as resistance markers in the past. In the present study, we investigated the utility of a specific polymorphism in thyA (Thr202Ala) as a marker for resistance to para-aminosalicyclic acid (PAS). Sixty-three PAS-susceptible MTBC strains comprising all major phylogenetic lineages, reference strain H37Rv, and 135 multidrug-resistant (MDR) strains from Germany (comprising 8 PAS-resistant isolates) were investigated for the presence of Thr202Ala. In both strain collections, the Thr202Ala SNP was found exclusively in strains of the Latin American Mediterranean (LAM) lineage irrespective of PAS resistance. Furthermore, PAS MICs (0.5 mg/liter) for selected LAM strains (all containing the SNP) and non-LAM strains (not containing the SNP), as well as the results of growth curve analyses performed in liquid 7H9 medium in the presence of increasing PAS concentrations (0 to 2.0 mg/liter), were identical. In conclusion, our data demonstrate that the Thr202Ala polymorphism in thyA is not a valid marker for PAS resistance but, instead, represents a phylogenetic marker for the LAM lineage of the M. tuberculosis complex. These findings challenge some of the previous understanding of PAS resistance and, as a consequence, warrant further in-depth investigations of the genetic variation in PAS-resistant clinical isolates and spontaneous mutants.

  3. LL-202, a newly synthesized flavonoid, inhibits tumor growth via inducing G(2)/M phase arrest and cell apoptosis in MCF-7 human breast cancer cells in vitro and in vivo.

    Science.gov (United States)

    Tao, Lei; Fu, Rong; Wang, Xiaoping; Yao, Jing; Zhou, Yuxin; Dai, Qinsheng; Li, Zhiyu; Lu, Na; Wang, Weiyun

    2014-07-03

    We recently established that LL-202, a newly synthesized flavonoid, exhibited obvious anticancer effects against human breast cells in vivo and in vitro. The underlying mechanism of its anticancer activity remains to be elucidated. In this study, we demonstrated that LL-202 inhibited the growth and proliferation of human breast cancer MCF-7 cells in a concentration and time-dependent manner. We reported that LL-202 induced both mitochondrial- and death-receptor-mediated apoptosis, which were characterized by the dissipation of mitochondrial membrane potential (ΔΨm), cytochrome c (Cyt c) release from mitochondria to cytosol, the activation of several caspases and induction of poly (ADP-ribose) polymerase (PARP) and Bid cleavage. N-acetylcysteine (NAC), a general ROS scavenger, partly blocked the LL-202-induced ROS levels and apoptosis. In addition, LL-202 induced arrest in cell cycle progression at G2/M phase in MCF-7 cells. After the treatment with LL-202, the expression of cell cycle-related proteins, such as cyclin B1, cyclin A, and p-CDK1 (Thr161) were down-regulated, whereas the expression of p21(WAF1/Cip1) and p-CDK1 (Thr14/Tyr15) were up-regulated. Finally, in vivo studies, LL-202 significantly suppressed the growth of MCF-7 breast cancer xenograft tumors in a dose-dependent manner with low systemic toxicity. In conclusion, the results showed that LL-202 had significant anticancer effects against human breast cells via the induction of apoptosis and G2/M phase arrest and it may be a novel anticancer agent for treatment of breast cancer. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  4. Search for Neutral Higgs Bosons of the Minimal Supersymmetric Standard Model in $e^+ e^-$ Interactions at $\\sqrt{s}$=192-202 GeV

    CERN Document Server

    Acciarri, M.; Adriani, O.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Ambrosi, G.; Anderhub, H.; Andreev, Valery P.; Angelescu, T.; Anselmo, F.; Arefev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Bajo, A.; Baksay, L.; Balandras, A.; Baldew, S.V.; Banerjee, S.; Banerjee, Sw.; Barczyk, A.; Barillere, R.; Bartalini, P.; Basile, M.; Batalova, N.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berbeco, R.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Bhattacharya, S.; Biasini, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brochu, F.; Buffini, A.; Buijs, A.; Burger, J.D.; Burger, W.J.; Cai, X.D.; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.M.; Casaus, J.; Castellini, G.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Cesaroni, F.; Chamizo, M.; Chang, Y.H.; Chaturvedi, U.K.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Civinini, C.; Clare, I.; Clare, R.; Coignet, G.; Colino, N.; Costantini, S.; Cotorobai, F.; de la Cruz, B.; Csilling, A.; Cucciarelli, S.; Dai, T.S.; van Dalen, J.A.; D'Alessandro, R.; de Asmundis, R.; Deglon, P.; Degre, A.; Deiters, K.; della Volpe, D.; Delmeire, E.; Denes, P.; DeNotaristefani, F.; De Salvo, A.; Diemoz, M.; Dierckxsens, M.; van Dierendonck, D.; Dionisi, C.; Dittmar, M.; Dominguez, A.; Doria, A.; Dova, M.T.; Duchesneau, D.; Dufournaud, D.; Duinker, P.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Erne, F.C.; Ewers, A.; Extermann, P.; Fabre, M.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisk, I.; Forconi, G.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gau, S.S.; Gentile, S.; Gheordanescu, N.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; van Gulik, R.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hasan, A.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hidas, P.; Hirschfelder, J.; Hofer, H.; Holzner, G.; Hoorani, H.; Hou, S.R.; Hu, Y.; Iashvili, I.; Jin, B.N.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Khan, R.A.; Kafer, D.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, D.; Kim, J.K.; Kirkby, Jasper; Kiss, D.; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopal, M.; Kopp, A.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Krenz, W.; Kruger, A.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Lee, H.J.; Le Goff, J.M.; Leiste, R.; Levtchenko, P.; Li, C.; Likhoded, S.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Lubelsmeyer, K.; Luci, C.; Luckey, David; Lugnier, L.; Luminari, L.; Lustermann, W.; Ma, W.G.; Maity, M.; Malgeri, L.; Malinin, A.; Mana, C.; Mangeol, D.; Mans, J.; Marian, G.; Martin, J.P.; Marzano, F.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; von der Mey, M.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Moulik, T.; Muanza, G.S.; Muijs, A.J.M.; Musicar, B.; Musy, M.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Niessen, T.; Nisati, A.; Kluge, Hannelies; Ofierzynski, R.; Organtini, G.; Oulianov, A.; Palomares, C.; Pandoulas, D.; Paoletti, S.; Paolucci, P.; Paramatti, R.; Park, H.K.; Park, I.H.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Petersen, B.; Piccolo, D.; Pierella, F.; Pieri, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Postema, H.; Pothier, J.; Prokofev, D.O.; Prokofiev, D.; Quartieri, J.; Rahal-Callot, G.; Rahaman, M.A.; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Ranieri, R.; Raspereza, A.; Raven, G.; Razis, P.; Ren, D.; Rescigno, M.; Reucroft, S.; Riemann, S.; Riles, Keith; Rodin, J.; Roe, B.P.; Romero, L.; Rosca, A.; Rosier-Lees, S.; Roth, Stefan; Rosenbleck, C.; Roux, B.; Rubio, J.A.; Ruggiero, G.; Rykaczewski, H.; Saremi, S.; Sarkar, S.; Salicio, J.; Sanchez, E.; Sanders, M.P.; Schafer, C.; Schegelsky, V.; Schmidt-Kaerst, S.; Schmitz, D.; Schopper, H.; Schotanus, D.J.; Schwering, G.; Sciacca, C.; Seganti, A.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Siedenburg, T.; Son, D.; Smith, B.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stone, A.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Sushkov, S.; Suter, H.; Swain, J.D.; Szillasi, Z.; Sztaricskai, T.; Tang, X.W.; Tauscher, L.; Taylor, L.; Tellili, B.; Teyssier, D.; Timmermans, Charles; Ting, Samuel C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Uchida, Y.; Ulbricht, J.; Valente, E.; Vesztergombi, G.; Vetlitsky, I.; Vicinanza, D.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobev, I.; Vorobov, A.A.; Vorvolakos, A.; Wadhwa, M.; Wallraff, W.; Wang, M.; Wang, X.L.; Wang, Z.M.; Weber, A.; Weber, M.; Wienemann, P.; Wilkens, H.; Wu, S.X.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yamamoto, J.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Ye, J.B.; Yeh, S.C.; Zalite, A.; Zalite, Yu.; Zhang, Z.P.; Zhu, G.Y.; Zhu, R.Y.; Zichichi, A.; Zilizi, G.; Zimmermann, B.; Zoller, M.

    2001-01-01

    A search for the lightest neutral CP-even and the neutral CP-odd Higgs bosons of the Minimal Supersymmetric Standard Model is performed using 233.2 pb-1 of integrated luminosity collected with the L3 detector at LEP at centre-of-mass energies 192-202 GeV. No signal is observed and lower mass limits are given as a function of tan(beta) for two scalar top mixing hypotheses. For tan(beta) greater than 0.8, they are mh > 83.4 GeV and mA > 83.8 GeV at 95 % confidence level.

  5. Z Boson Pair Production in e^+ e^- Collisions at √s between 183 and 202, GeV with the OPAL detector at LEP

    Science.gov (United States)

    Kim, Dae Hwan; Strom, David

    2000-05-01

    A study of Z boson pair production in e^+ e^- annihilation at center-of-mass energies between 183, GeV and 202, GeV is reported. Final states containing only leptons, (l l l l and l l ν ν), quark and lepton pairs, (qq l l, qq ν ν) and the all-hadronic final state (qqqq) are considered. In all states with at least one Z boson decaying hadronically, q barq and b barb final states are considered separately using lifetime and event-shape tags, thereby improving the cross-section measurement. Limits on anomalous ZZγ and ZZZ couplings are derived.

  6. Search for a Scalar Top almost degenerate with the lightest Neutralino in $e^{+}e^{-}$ Collisions at $\\sqrt{s}$ up to 202 GeV

    CERN Document Server

    Barate, R; Ghez, P; Goy, C; Jézéquel, S; Lees, J P; Martin, F; Merle, E; Minard, M N; Pietrzyk, B; Bravo, S; Casado, M P; Chmeissani, M; Crespo, J M; Fernández, E; Fernández-Bosman, M; Garrido, L; Graugès-Pous, E; López, J; Martínez, M; Merino, G; Miquel, R; Mir, L M; Pacheco, A; Paneque, D; Ruiz, H; Colaleo, A; Creanza, D; De Filippis, N; De Palma, M; Iaselli, Giuseppe; Maggi, G; Maggi, M; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Abbaneo, D; Boix, G; Buchmüller, O L; Cattaneo, M; Cerutti, F; Dissertori, G; Drevermann, H; Forty, Roger W; Frank, M; Gianotti, F; Greening, T C; Hansen, J B; Harvey, J; Janot, P; Jost, B; Kado, M; Lemaître, V; Maley, P; Mato, P; Minten, Adolf G; Moutoussi, A; Ranjard, F; Rolandi, Luigi; Schlatter, W D; Schmitt, M; Schneider, O; Spagnolo, P; Tejessy, W; Teubert, F; Tournefier, E; Valassi, Andrea; Ward, J J; Wright, A E; Ajaltouni, Ziad J; Badaud, F; Chazelle, G; Deschamps, O; Dessagne, S; Falvard, A; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Pascolo, J M; Perret, P; Podlyski, F; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Wäänänen, A; Daskalakis, G; Kyriakis, A; Markou, C; Simopoulou, Errietta; Vayaki, Anna; Blondel, A; Brient, J C; Machefert, F P; Rougé, A; Swynghedauw, M; Tanaka, R; Videau, H L; Focardi, E; Parrini, G; Zachariadou, K; Antonelli, A; Antonelli, M; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Chiarella, V; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Chalmers, M; Halley, A W; Kennedy, J; Lynch, J G; Negus, P; O'Shea, V; Räven, B; Smith, D; Teixeira-Dias, P; Thompson, A S; Cavanaugh, R J; Dhamotharan, S; Geweniger, C; Hanke, P; Hepp, V; Kluge, E E; Leibenguth, G; Putzer, A; Tittel, K; Werner, S; Wunsch, M; Beuselinck, R; Binnie, David M; Cameron, W; Davies, G; Dornan, Peter J; Girone, M; Marinelli, N; Nowell, J; Przysiezniak, H; Sedgbeer, J K; Thompson, J C; Thomson, E; White, R; Ghete, V M; Girtler, P; Kneringer, E; Kuhn, D; Rudolph, G; Bowdery, C K; Buck, P G; Clarke, D P; Ellis, G; Finch, A J; Foster, F; Hughes, G; Jones, R W L; Robertson, N A; Smizanska, M; Giehl, I; Hölldorfer, F; Jakobs, K; Kleinknecht, K; Kröcker, M; Müller, A S; Nürnberger, H A; Quast, G; Renk, B; Rohne, E; Sander, H G; Schmeling, S; Wachsmuth, H W; Zeitnitz, C; Ziegler, T; Bonissent, A; Carr, J; Coyle, P; Curtil, C; Ealet, A; Fouchez, D; Leroy, O; Kachelhoffer, T; Payre, P; Rousseau, D; Tilquin, A; Aleppo, M; Gilardoni, S S; Ragusa, F; Dietl, H; Ganis, G; Heister, A; Hüttmann, K; Lütjens, G; Mannert, C; Männer, W; Moser, H G; Schael, S; Settles, Ronald; Stenzel, H; Wiedenmann, W; Wolf, G; Azzurri, P; Boucrot, J; Callot, O; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Jacholkowska, A; Serin, L; Veillet, J J; Videau, I; De Vivie de Régie, J B; Zerwas, D; Bagliesi, G; Boccali, T; Calderini, G; Ciulli, V; Foà, L; Giammanco, A; Giassi, A; Ligabue, F; Messineo, A; Palla, Fabrizio; Rizzo, G; Sanguinetti, G; Sciabà, A; Sguazzoni, G; Tenchini, Roberto; Venturi, A; Verdini, P G; Blair, G A; Coles, J; Cowan, G D; Green, M G; Hutchcroft, D E; Jones, L T; Medcalf, T; Strong, J A; Von Wimmersperg-Töller, J H; Clifft, R W; Edgecock, T R; Norton, P R; Tomalin, I R; Bloch-Devaux, B; Boumediene, D E; Colas, P; Fabbro, B; Faïf, G; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Rander, J; Renardy, J F; Rosowsky, A; Seager, P; Trabelsi, A; Tuchming, B; Vallage, B; Black, S N; Dann, J H; Loomis, C; Kim, H Y; Konstantinidis, N P; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Cartwright, S L; Combley, F; Hodgson, P N; Lehto, M H; Thompson, L F; Affholderbach, K; Böhrer, A; Brandt, S; Grupen, Claus; Hess, J; Misiejuk, A; Prange, G; Sieler, U; Borean, C; Giannini, G; Gobbo, B; He, H; Pütz, J; Rothberg, J E; Wasserbaech, S R; Armstrong, S R; Cranmer, K; Elmer, P; Ferguson, D P S; Gao, Y; González, S; Hayes, O J; Hu, H; Jin, S; Kile, J; McNamara, P A; Nielsen, J; Orejudos, W; Pan, Y B; Saadi, Y; Scott, I J; Walsh, J; Wu, J; Wu Sau Lan; Wu, X; Zobernig, G

    2000-01-01

    Data collected at centre-of-mass energies from 189 GeV to 202 GeV by the ALEPH detector at LEP, corresponding to an integrated luminosity of 411 pb-1, are analysed in a search for the scalar top in the decay channels 'stop -> c/u neutralino' for small mass differences between the stop and the lightest neutralino. No evidence for deviations from the Standard Model expectation is found and a lower limit of 59 GeV/c**2 is set for the stop mass, independent of the stop to neutralino mass difference and of the stop lifetime.

  7. Search for a scalar top almost degenerate with the lightest neutralino in e+e- collisions at /sqrt(s) up to 202 GeV

    Science.gov (United States)

    Barate, R.; Decamp, D.; Ghez, P.; Goy, C.; Jezequel, S.; Lees, J.-P.; Martin, F.; Merle, E.; Minard, M.-N.; Pietrzyk, B.; Bravo, S.; Casado, M. P.; Chmeissani, M.; Crespo, J. M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, L.; Graugés, E.; Lopez, J.; Martinez, M.; Merino, G.; Miquel, R.; Mir, L. M.; Pacheco, A.; Paneque, D.; Ruiz, H.; Colaleo, A.; Creanza, D.; De Filippis, N.; de Palma, M.; Iaselli, G.; Maggi, G.; Maggi, M.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Boix6, G.; Buchmüller, O.; Cattaneo, M.; Cerutti, F.; Dissertori, G.; Drevermann, H.; Forty, R. W.; Frank, M.; Gianotti, F.; Greening, T. C.; Hansen, J. B.; Harvey, J.; Janot, P.; Jost, B.; Kado, M.; Lemaitre, V.; Maley, P.; Mato, P.; Minten, A.; Moutoussi, A.; Ranjard, F.; Rolandi, L.; Schlatter, D.; Schmitt, M.; Schneider, O.; Spagnolo, P.; Tejessy, W.; Teubert, F.; Tournefier, E.; Valassi, A.; Ward, J. J.; Wright, A. E.; Ajaltouni, Z.; Badaud, F.; Chazelle, G.; Deschamps, O.; Dessagne, S.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.-C.; Pallin, D.; Pascolo, J. M.; Perret, P.; Podlyski, F.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Nilsson, B. S.; Wäänänen, A.; Daskalakis, G.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Blondel, A.; Brient, J.-C.; Machefert, F.; Rougé, A.; Swynghedauw, M.; Tanaka, R.; Videau, H.; Focardi, E.; Parrini, G.; Zachariadou, K.; Antonelli, A.; Antonelli, M.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Chiarella, V.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Chalmers, M.; Halley, A. W.; Kennedy, J.; Lynch, J. G.; Negus, P.; O'Shea, V.; Raeven, B.; Smith, D.; Teixeira-Dias, P.; Thompson, A. S.; Cavanaugh, R.; Dhamotharan, S.; Geweniger, C.; Hanke, P.; Hepp, V.; Kluge, E. E.; Leibenguth, G.; Putzer, A.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Davies, G.; Dornan, P. J.; Girone, M.; Marinelli, N.; Nowell, J.; Przysiezniak, H.; Sedgbeer, J. K.; Thompson, J. C.; Thomson, E.; White, R.; Ghete, V. M.; Girtler, P.; Kneringer, E.; Kuhn, D.; Rudolph, G.; Bowdery, C. K.; Buck, P. G.; Clarke, D. P.; Ellis, G.; Finch, A. J.; Foster, F.; Hughes, G.; Jones, R. W. L.; Robertson, N. A.; Smizanska, M.; Giehl, I.; Hölldorfer, F.; Jakobs, K.; Kleinknecht, K.; Kröcker, M.; Müller, A.-S.; Nürnberger, H.-A.; Quast, G.; Renk, B.; Rohne, E.; Sander, H.-G.; Schmeling, S.; Wachsmuth, H.; Zeitnitz, C.; Ziegler, T.; Bonissent, A.; Carr, J.; Coyle, P.; Curtil, C.; Ealet, A.; Fouchez, D.; Leroy, O.; Kachelhoffer, T.; Payre, P.; Rousseau, D.; Tilquin, A.; Aleppo, M.; Gilardoni, S.; Ragusa, F.; Dietl, H.; Ganis, G.; Heister, A.; Hüttmann, K.; Lütjens, G.; Mannert, C.; Männer, W.; Moser, H.-G.; Schael, S.; Settles, R.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Azzurri, P.; Boucrot, J.; Callot, O.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, P.; Jacholkowska, A.; Serin, L.; Veillet, J.-J.; Videau, I.; de Vivie de Régie, J.-B.; Zerwas, D.; Bagliesi, G.; Boccali, T.; Calderini, G.; Ciulli, V.; Foà, L.; Giammanco, A.; Giassi, A.; Ligabue, F.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Sciabà, A.; Sguazzoni, G.; Tenchini, R.; Venturi, A.; Verdini, P. G.; Blair, G. A.; Coles, J.; Cowan, G.; Green, M. G.; Hutchcroft, D. E.; Jones, L. T.; Medcalf, T.; Strong, J. A.; von Wimmersperg-Toeller, J. H.; Clifft, R. W.; Edgecock, T. R.; Norton, P. R.; Tomalin, I. R.; Bloch-Devaux, B.; Boumediene, D.; Colas, P.; Fabbro, B.; Faïf, G.; Lançon, E.; Lemaire, M.-C.; Locci, E.; Perez, P.; Rander, J.; Renardy, J.-F.; Rosowsky, A.; Seager, P.; Trabelsi, A.; Tuchming, B.; Vallage, B.; Black, S. N.; Dann, J. H.; Loomis, C.; Kim, H. Y.; Konstantinidis, N.; Litke, A. M.; McNeil, M. A.; Taylor, G.; Booth, C. N.; Cartwright, S.; Combley, F.; Hodgson, P. N.; Lehto, M.; Thompson, L. F.; Affholderbach, K.; Böhrer, A.; Brandt, S.; Grupen, C.; Hess, J.; Misiejuk, A.; Prange, G.; Sieler, U.; Borean, C.; Giannini, G.; Gobbo, B.; He, H.; Putz, J.; Rothberg, J.; Wasserbaech, S.; Armstrong, S. R.; Cranmer, K.; Elmer, P.; Ferguson, D. P. S.; Gao, Y.; González, S.; Hayes, O. J.; Hu, H.; Jin, S.; Kile, J.; McNamara, P. A., III; Nielsen, J.; Orejudos, W.; Pan, Y. B.; Saadi, Y.; Scott, I. J.; Walsh, J.; Wu, J.; Wu, S. L.; Wu, X.; Zobernig, G.

    2000-09-01

    Data collected at centre-of-mass energies from 189 GeV to 202 GeV by the ALEPH detector at LEP corresponding to an integrated luminosity of 411 pb-1, are analysed in a search for the scalar top in the decay channels t~-->c/uχ for small mass differences between the stop and the lightest neutralino. No evidence for deviations from the Standard Model expectation is found and a lower limit of 59 GeV/c2 is set for the stop mass, independent of the stop to neutralino mass difference and of the stop lifetime.

  8. Search for Charged Higgs Bosons in $e^{+}e^{-}$ Collisions at Centre-of-Mass Energies up to 202 GeV

    CERN Document Server

    Acciarri, M.; Adriani, O.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Ambrosi, G.; Anderhub, H.; Andreev, Valery P.; Angelescu, T.; Anselmo, F.; Arefiev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Bajo, A.; Baksay, L.; Balandras, A.; Baldew, S.V.; Banerjee, S.; Barczyk, A.; Barillere, R.; Bartalini, P.; Basile, M.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berbeco, R.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Bhattacharya, S.; Biasini, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brochu, F.; Buffini, A.; Buijs, A.; Burger, J.D.; Burger, W.J.; Cai, X.D.; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.M.; Casaus, J.; Castellini, G.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Cesaroni, F.; Chamizo, M.; Chang, Y.H.; Chaturvedi, U.K.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Civinini, C.; Clare, I.; Clare, R.; Coignet, G.; Colino, N.; Costantini, S.; Cotorobai, F.; de la Cruz, B.; Csilling, A.; Cucciarelli, S.; Dai, T.S.; van Dalen, J.A.; D'Alessandro, R.; de Asmundis, R.; Deglon, P.; Degre, A.; Deiters, K.; della Volpe, D.; Delmeire, E.; Denes, P.; DeNotaristefani, F.; De Salvo, A.; Diemoz, M.; Dierckxsens, M.; van Dierendonck, D.; Dionisi, C.; Dittmar, M.; Dominguez, A.; Doria, A.; Dova, M.T.; Duchesneau, D.; Dufournaud, D.; Duinker, P.; Duran, I.; El Momouni, H.; Engler, A.; Eppling, F.J.; Erne, F.C.; Extermann, P.; Fabre, M.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisk, I.; Forconi, G.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gau, S.S.; Gentile, S.; Gheordanescu, N.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; van Gukik, R.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hasan, A.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hidas, P.; Hirschfelder, J.; Hofer, H.; Holzner, G.; Hoorani, H.; Hou, S.R.; Hu, Y.; Iashvili, I.; Jin, B.N.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Khan, R.A.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, D.; Kim, J.K.; Kirkby, Jasper; Kiss, D.; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopp, A.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Krenz, W.; Kruger, A.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Lee, H.J.; Le Goff, J.M.; Leiste, R.; Levtchenko, P.; Li, C.; Likhoded, S.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Lubelsmeyer, K.; Luci, C.; Luckey, David; Lugnier, L.; Luminari, L.; Lustermann, W.; Ma, W.G.; Maity, M.; Malgeri, L.; Malinin, A.; Mana, C.; Mangeol, D.; Mans, J.; Marian, G.; Martin, J.P.; Marzano, F.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; von der Mey, M.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Moulik, T.; Muanza, G.S.; Muijs, A.J.M.; Musicar, B.; Musy, M.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Niessen, T.; Nisati, A.; Kluge, Hannelies; Ofierzynski, R.; Organtini, G.; Oulianov, A.; Palomares, C.; Pandoulas, D.; Paoletti, S.; Paolucci, P.; Paramatti, R.; Park, H.K.; Park, I.H.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Petersen, B.; Piccolo, D.; Pierella, F.; Pieri, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Postema, H.; Pothier, J.; Prokofiev, D.O.; Prokofiev, D.; Quartieri, J.; Rahal-Callot, G.; Rahaman, M.A.; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Ranieri, R.; Raspereza, A.; Raven, G.; Razis, P.; Ren, D.; Rescigno, M.; Reucroft, S.; Riemann, S.; Riles, Keith; Rodin, J.; Roe, B.P.; Romero, L.; Rosca, A.; Rosier-Lees, S.; Rubio, J.A.; Ruggiero, G.; Rykaczewski, H.; Saremi, S.; Sarkar, S.; Salicio, J.; Sanchez, E.; Sanders, M.P.; Sarakinos, M.E.; Schafer, C.; Schegelsky, V.; Schmidt-Kaerst, S.; Schmitz, D.; Schopper, H.; Schotanus, D.J.; Schwering, G.; Sciacca, C.; Seganti, A.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Siedenburg, T.; Son, D.; Smith, B.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stone, A.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Suter, H.; Swain, J.D.; Szillasi, Z.; Sztaricskai, T.; Tang, X.W.; Tauscher, L.; Taylor, L.; Tellili, B.; Timmermans, Charles; Ting, Samuel C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Uchida, Y.; Ulbricht, J.; Valente, E.; Vesztergombi, G.; Vetlitsky, I.; Vicinanza, D.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobiev, I.; Vorobov, A.A.; Vorvolakos, A.; Wadhwa, M.; Wallraff, W.; Wang, M.; Wang, X.L.; Wang, Z.M.; Weber, A.; Weber, M.; Wienemann, P.; Wilkens, H.; Wu, S.X.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yamamoto, J.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Ye, J.B.; Yeh, S.C.; Zalite, An.; Zalite, Yu.; Zhang, Z.P.; Zhu, G.Y.; Zhu, R.Y.; Zichichi, A.; Zilizi, G.; Zimmermann, B.; Zoller, M.

    2000-01-01

    A search for pair-produced charged Higgs bosons is performed with the L3 detector at LEP using data collected at centre-of-mass energies between 192 and 202 GeV, corresponding to an integrated luminosity of 233.2 pb^-1. Decays into a charm and a strange quark or into a tau lepton and its neutrino are considered. The observed events are consistent with the expectations from Standard Model background processes. Including data taken at lower centre-of-mass energies, lower limits on the charged Higgs mass are derived at the 95% confidence level. They vary from 67.4 to 79.9GeV as a function of the H^+/- --> tau nu branching ratio.

  9. Measurements of the Cross Sections for Open Charm and Beauty Production in $\\gamma\\gamma$ Collisions at $\\sqrt{s}$ = 189-202 GeV

    CERN Document Server

    Acciarri, M.; Adriani, O.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Ambrosi, G.; Anderhub, H.; Andreev, Valery P.; Angelescu, T.; Anselmo, F.; Arefev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Bajo, A.; Baksay, L.; Balandras, A.; Baldew, S.V.; Banerjee, S.; Banerjee, Sw.; Barczyk, A.; Barillere, R.; Bartalini, P.; Basile, M.; Batalova, N.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berbeco, R.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Bhattacharya, S.; Biasini, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brochu, F.; Buffini, A.; Buijs, A.; Burger, J.D.; Burger, W.J.; Cai, X.D.; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.M.; Casaus, J.; Castellini, G.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Cesaroni, F.; Chamizo, M.; Chang, Y.H.; Chaturvedi, U.K.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Civinini, C.; Clare, I.; Clare, R.; Coignet, G.; Colino, N.; Costantini, S.; Cotorobai, F.; de la Cruz, B.; Csilling, A.; Cucciarelli, S.; Dai, T.S.; van Dalen, J.A.; D'Alessandro, R.; de Asmundis, R.; Deglon, P.; Degre, A.; Deiters, K.; della Volpe, D.; Delmeire, E.; Denes, P.; DeNotaristefani, F.; De Salvo, A.; Diemoz, M.; Dierckxsens, M.; van Dierendonck, D.; Dionisi, C.; Dittmar, M.; Dominguez, A.; Doria, A.; Dova, M.T.; Duchesneau, D.; Dufournaud, D.; Duinker, P.; Duran, I.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Erne, F.C.; Ewers, A.; Extermann, P.; Fabre, M.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisk, I.; Forconi, G.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gau, S.S.; Gentile, S.; Gheordanescu, N.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; van Gulik, R.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hasan, A.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hidas, P.; Hirschfelder, J.; Hofer, H.; Holzner, G.; Hoorani, H.; Hou, S.R.; Hu, Y.; Iashvili, I.; Jin, B.N.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Khan, R.A.; Kafer, D.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, D.; Kim, J.K.; Kirkby, Jasper; Kiss, D.; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopal, M.; Kopp, A.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Krenz, W.; Kruger, A.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Lee, H.J.; Le Goff, J.M.; Leiste, R.; Levtchenko, P.; Li, C.; Likhoded, S.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Lubelsmeyer, K.; Luci, C.; Luckey, David; Lugnier, L.; Luminari, L.; Lustermann, W.; Ma, W.G.; Maity, M.; Malgeri, L.; Malinin, A.; Mana, C.; Mangeol, D.; Mans, J.; Marian, G.; Martin, J.P.; Marzano, F.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; von der Mey, M.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Moulik, T.; Muanza, G.S.; Muijs, A.J.M.; Musicar, B.; Musy, M.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Niessen, T.; Nisati, A.; Kluge, Hannelies; Ofierzynski, R.; Organtini, G.; Oulianov, A.; Palomares, C.; Pandoulas, D.; Paoletti, S.; Paolucci, P.; Paramatti, R.; Park, H.K.; Park, I.H.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Petersen, B.; Piccolo, D.; Pierella, F.; Pieri, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Postema, H.; Pothier, J.; Prokofev, D.O.; Prokofiev, D.; Quartieri, J.; Rahal-Callot, G.; Rahaman, M.A.; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Ranieri, R.; Raspereza, A.; Raven, G.; Razis, P.; Ren, D.; Rescigno, M.; Reucroft, S.; Riemann, S.; Riles, Keith; Rodin, J.; Roe, B.P.; Romero, L.; Rosca, A.; Rosier-Lees, S.; Roth, Stefan; Rosenbleck, C.; Rubio, J.A.; Ruggiero, G.; Rykaczewski, H.; Saremi, S.; Sarkar, S.; Salicio, J.; Sanchez, E.; Sanders, M.P.; Schafer, C.; Schegelsky, V.; Schmidt-Kaerst, S.; Schmitz, D.; Schopper, H.; Schotanus, D.J.; Schwering, G.; Sciacca, C.; Seganti, A.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Siedenburg, T.; Son, D.; Smith, B.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stone, A.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Sushkov, S.; Suter, H.; Swain, J.D.; Szillasi, Z.; Sztaricskai, T.; Tang, X.W.; Tauscher, L.; Taylor, L.; Tellili, B.; Timmermans, Charles; Ting, Samuel C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Uchida, Y.; Ulbricht, J.; Valente, E.; Vesztergombi, G.; Vetlitsky, I.; Vicinanza, D.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobev, I.; Vorobov, A.A.; Vorvolakos, A.; Wadhwa, M.; Wallraff, W.; Wang, M.; Wang, X.L.; Wang, Z.M.; Weber, A.; Weber, M.; Wienemann, P.; Wilkens, H.; Wu, S.X.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yamamoto, J.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Ye, J.B.; Yeh, S.C.; Zalite, An.; Zalite, Yu.; Zhang, Z.P.; Zhu, G.Y.; Zhu, R.Y.; Zichichi, A.; Zilizi, G.; Zimmermann, B.; Zoller, M.

    2001-01-01

    The production of c and b quarks in gamma-gamma collisions is studied with the L3 detector at LEP with 410 pb^-1 of data, collected at centre-of-mass energies from 189 GeV to 202 GeV. Hadronic final states containing c and b quarks are identified by detecting electrons or muons from their semileptonic decays. The cross sections sigma(e+e- -> e+e- c c~ X) and sigma(e+e- -> e+e- b b~ X) are measured and compared to next-to-leading order perturbative QCD calculations. The cross section of b production is measured in gamma-gamma collisions for the first time. It is in excess of the QCD prediction by a factor of three.

  10. Hb Alesha [β67(E11)Val→Met (GTG>ATG); HBB: c.202G > A] Found in a Chinese Girl.

    Science.gov (United States)

    Jiang, Hua; Yan, Jin-Mei; Zhou, Jian-Ying; Li, Dong-Zhi

    2016-11-01

    Mutations that cause destabilization of the hemoglobin (Hb) tetramer are a rare cause of hemolytic anemia. In contrast to the hemolytic anemia caused by enzyme deficiencies, a dominant mode of inheritance characterizes the unstable Hbs. Hb Alesha [β67(E11)Val→Met; HBB: c.202G>A] is caused by a G>A mutation at codon 67 of the β-globin gene, resulting in a valine to methionine substitution at helix E11. This replacement disrupts the apolar bonds between valine and the heme group, producing an unstable Hb and severe hemolysis. We report this rare hemoglobinopathy in a Chinese girl with severe hemolytic anemia, splenomegaly and frequent requirement for red blood cell (RBC) transfusions.

  11. Structural and preliminary molecular dynamics studies of the Rhodobacter sphaeroides reaction center and its mutant form L(M196)H + H(M202)L

    Science.gov (United States)

    Klyashtorny, V. G.; Fufina, T. Yu.; Vasilieva, L. G.; Shuvalov, V. A.; Gabdulkhakov, A. G.

    2014-07-01

    Pigment-protein interactions are responsible for the high efficiency of the light-energy transfer and conversion in photosynthesis. The reaction center (RC) from the purple bacterium Rhodobacter sphaeroides is the most convenient model for studying the mechanisms of primary processes of photosynthesis. Site-directed mutagenesis can be used to study the effect of the protein environment of electron-transfer cofactors on the optical properties, stability, pigment composition, and functional activity of RC. The preliminary analysis of RC was performed by computer simulation of the amino acid substitutions L(M196)H + H(M202)L at the pigment-protein interface and by estimating the stability of the threedimensional structure of the mutant RC by the molecular dynamics method. The doubly mutated reaction center was overexpressed, purified, and crystallized. The three-dimensional structure of this mutant was determined by X-ray crystallography and compared with the molecular dynamics model.

  12. Getting a grip on illusions: replicating Stöttinger et al [Exp Brain Res (2010) 202:79-88] results with 3-D objects.

    Science.gov (United States)

    Stöttinger, Elisabeth; Pfusterschmied, Jürgen; Wagner, Herbert; Danckert, James; Anderson, Britt; Perner, Josef

    2012-01-01

    Studies using visual illusions to demonstrate a dissociation within the visual system can provide relevant and decisive data only if certain methodological points are taken into account. Although, our previous work (Stöttinger et al. in Exp Brain Res 202:88-97, 2010) followed these points, the task made use of only 2-D stimuli which may raise doubts concerning the nature of grasping in that experiment. We therefore replicated the study using a 3-D version of the empty space illusion. Consistent with the earlier study, that used 2-D stimuli, we found that grip aperture followed actual target size independent of illusory effects, while perceived length, as indicated by finger-thumb span, clearly was subject to the illusion. Therefore, the prior results cannot be due to the use of 2-D stimuli. Together, these two studies provide clear evidence for the perception versus action hypothesis.

  13. CLL Exosomes Modulate the Transcriptome and Behaviour of Recipient Stromal Cells and Are Selectively Enriched in miR-202-3p

    Science.gov (United States)

    Farahani, Mosavar; Rubbi, Carlos; Liu, Luning; Slupsky, Joseph R.; Kalakonda, Nagesh

    2015-01-01

    Bi-directional communication with the microenvironment is essential for homing and survival of cancer cells with implications for disease biology and behaviour. In chronic lymphocytic leukemia (CLL), the role of the microenvironment on malignant cell behaviour is well described. However, how CLL cells engage and recruit nurturing cells is poorly characterised. Here we demonstrate that CLL cells secrete exosomes that are nanovesicles originating from the fusion of multivesicular bodies with the plasma membrane, to shuttle proteins, lipids, microRNAs (miR) and mRNAs to recipient cells. We characterise and confirm the size (50–100 nm) and identity of the CLL-derived exosomes by Electron microscopy (EM), Atomic force microscopy (AFM), flow cytometry and western blotting using both exosome- and CLL-specific markers. Incubation of CLL-exosomes, derived either from cell culture supernatants or from patient plasma, with human stromal cells shows that they are readily taken up into endosomes, and induce expression of genes such as c-fos and ATM as well as enhance proliferation of recipient HS-5 cells. Furthermore, we show that CLL exosomes encapsulate abundant small RNAs and are enriched in certain miRs and specifically hsa-miR-202-3p. We suggest that such specific packaging of miR-202-3p into exosomes results in enhanced expression of ‘suppressor of fused’ (Sufu), a Hedgehog (Hh) signalling intermediate, in the parental CLL cells. Thus, our data show that CLL cells secrete exosomes that alter the transcriptome and behaviour of recipient cells. Such communication with microenvironment is likely to have an important role in CLL disease biology. PMID:26509439

  14. A long-term study on the clinical effects of mechanical widening of cheek teeth diastemata for treatment of periodontitis in 202 horses (2008-2011).

    Science.gov (United States)

    Dixon, P M; Ceen, S; Barnett, T; O'Leary, J M; Parkin, T D; Barakzai, S

    2014-01-01

    Cheek teeth diastemata are a common cause of painful periodontal disease in horses, but there is limited objective information on their treatment. To assess the long-term response to diastema widening in clinically affected horses. Retrospective study. Medical records from cases of cheek teeth diastemata treated by diastema widening referred to the University of Edinburgh Equine Hospital from 2008 to 2011 were analysed. During this period, 302 horses were diagnosed with clinically significant cheek teeth diastemata, of which 202, median age 11 years, with severe associated periodontitis were treated by widening of 674 problematic diastemata; 89.8% between mandibular cheek teeth and 10.2% between maxillary cheek teeth, with a mean of 1.5 treatments performed per case. These 202 cases showed quidding in 76.2%; weight loss in 33.2%; bitting problems in 20.1% and halitosis in 10.9%, with 5.4% being asymptomatic. Follow-up of 92% of treated cases, a mean of 20.8 months after their initial treatment, showed that 72.6% had complete remission of clinical signs that was permanent (for the duration of this study) in 50.5% and temporary in 22%. A partial response was obtained in 17.2%, no response was obtained in 4.3%, and owners were unsure of response in 5.9%. Clinical improvement was sometimes delayed, with 19% taking >4 weeks following treatment for improvement. Inappropriate sites were burred in individual teeth of 6 horses, causing iatrogenic pulpar exposure in 2 cases, but following treatment none developed clinical signs of apical infection. Diastema widening is an effective but potentially invasive treatment for horses with cheek teeth diastemata with severe periodontitis. Diastema widening by trained personnel is suitable for advanced cases of cheek teeth diastema, but many cases require repeated treatments. © 2013 EVJ Ltd.

  15. CLL Exosomes Modulate the Transcriptome and Behaviour of Recipient Stromal Cells and Are Selectively Enriched in miR-202-3p.

    Science.gov (United States)

    Farahani, Mosavar; Rubbi, Carlos; Liu, Luning; Slupsky, Joseph R; Kalakonda, Nagesh

    2015-01-01

    Bi-directional communication with the microenvironment is essential for homing and survival of cancer cells with implications for disease biology and behaviour. In chronic lymphocytic leukemia (CLL), the role of the microenvironment on malignant cell behaviour is well described. However, how CLL cells engage and recruit nurturing cells is poorly characterised. Here we demonstrate that CLL cells secrete exosomes that are nanovesicles originating from the fusion of multivesicular bodies with the plasma membrane, to shuttle proteins, lipids, microRNAs (miR) and mRNAs to recipient cells. We characterise and confirm the size (50-100 nm) and identity of the CLL-derived exosomes by Electron microscopy (EM), Atomic force microscopy (AFM), flow cytometry and western blotting using both exosome- and CLL-specific markers. Incubation of CLL-exosomes, derived either from cell culture supernatants or from patient plasma, with human stromal cells shows that they are readily taken up into endosomes, and induce expression of genes such as c-fos and ATM as well as enhance proliferation of recipient HS-5 cells. Furthermore, we show that CLL exosomes encapsulate abundant small RNAs and are enriched in certain miRs and specifically hsa-miR-202-3p. We suggest that such specific packaging of miR-202-3p into exosomes results in enhanced expression of 'suppressor of fused' (Sufu), a Hedgehog (Hh) signalling intermediate, in the parental CLL cells. Thus, our data show that CLL cells secrete exosomes that alter the transcriptome and behaviour of recipient cells. Such communication with microenvironment is likely to have an important role in CLL disease biology.

  16. Depth profile of production yields of {sup nat}Pb(p, xn) {sup 206,205,204,203,202,201}Bi nuclear reactions

    Energy Technology Data Exchange (ETDEWEB)

    Mokhtari Oranj, Leila [Division of Advanced Nuclear Engineering, POSTECH, Pohang 37673 (Korea, Republic of); Jung, Nam-Suk; Kim, Dong-Hyun; Lee, Arim; Bae, Oryun [Pohang Accelerator Laboratory, POSTECH, Pohang 37673 (Korea, Republic of); Lee, Hee-Seock, E-mail: lee@postech.ac.kr [Pohang Accelerator Laboratory, POSTECH, Pohang 37673 (Korea, Republic of)

    2016-11-01

    Experimental and simulation studies on the depth profiles of production yields of {sup nat}Pb(p, xn) {sup 206,205,204,203,202,201}Bi nuclear reactions were carried out. Irradiation experiments were performed at the high-intensity proton linac facility (KOMAC) in Korea. The targets, irradiated by 100-MeV protons, were arranged in a stack consisting of natural Pb, Al, Au foils and Pb plates. The proton beam intensity was determined by activation analysis method using {sup 27}Al(p, 3p1n){sup 24}Na, {sup 197}Au(p, p1n){sup 196}Au, and {sup 197}Au(p, p3n){sup 194}Au monitor reactions and also by Gafchromic film dosimetry method. The yields of produced radio-nuclei in the {sup nat}Pb activation foils and monitor foils were measured by HPGe spectroscopy system. Monte Carlo simulations were performed by FLUKA, PHITS/DCHAIN-SP, and MCNPX/FISPACT codes and the calculated data were compared with the experimental results. A satisfactory agreement was observed between the present experimental data and the simulations.

  17. Depth profiles of production yields of natPb(p, xn206,205,204,203,202 Bi reactions using 100-MeV proton beam

    Directory of Open Access Journals (Sweden)

    Oranj Leila Mokhtari

    2017-01-01

    Full Text Available In this study, results of the experimental study on the depth profiles of production yields of 206,205,204,203,202Bi radio-nuclei in the natural Pb target irradiated by a 100-MeV proton beam are presented. Irradiation was performed at proton linac facility (KOMAC in Korea. The target, irradiated by 100-MeV protons, was arranged in a stack consisting of natural Pb, Al, Au foils and Pb plates. The proton beam intensity was determined by activation analysis method using 27Al(p, 3p1n24Na, 197Au(p, p1n196Au, and 197Au(p, p3n194Au monitor reactions and also using dosimetry method by a Gafchromic film. The production yields of produced Bi radio-nuclei in the natural Pb foils and monitor reactions were measured by gamma-ray spectroscopy. Monte Carlo simulations were performed by FLUKA, PHITS, and MCNPX codes and compared with the measurements in order to verify validity of physical models and nuclear data libraries in the Monte Carlo codes. A fairly good agreement was observed between the present experimental data and the simulations by FLUKA, PHITS, and MCNPX. However, physical models and the nuclear data relevant to the end of range of protons in the codes need to be improved.

  18. DIVORCE PROCEEDINGS, IN LIGHT OF THE NEW PROVISIONS OF LAW NO. 202/2010 REGARDING SOME MEASURES FOR ACCELERATING THE RESOLUTION PROCESS

    Directory of Open Access Journals (Sweden)

    IOANA PADURARIU

    2011-04-01

    Full Text Available Law no. 202/2010 regarding some measures for accelerating the resolution process establishes procedural rules with immediate effect, meant to streamline judicial procedures, and to expeditiously resolve processes, regulating specific legislative measures, which aim mainly to simplify solving cases. In matters of divorce, a first change is that, unlike the previous situation, the divorce case by agreement will be judged in the council chamber. Also, according to the above mentioned law, if the conditions for dissolution by agreement are accomplished, we can divorce not only in front of the court, but also to the notary public or officer of civil status, opportunity that did not existed in past. Another novelty is the express possibility to demand resolution through mediation for divorce, specifying that the parties can not only refuse the judge's recommendation to seek mediation, but that the parties can refuse mediation session even after information. Regarding mediation, the law brings news on divorce. Under that legislation, divorce can be made by the parties even when the couple has minor children and agree to the mediation process.

  19. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  20. Endovascular Treatment of Pelvic Congestion Syndrome: Visual Analog Scale (VAS) Long-Term Follow-up Clinical Evaluation in 202 Patients

    Energy Technology Data Exchange (ETDEWEB)

    Laborda, Alicia, E-mail: alaborda@unizar.es; Medrano, Joaquin, E-mail: oauieao@gmail.com [University of Zaragoza, Group of Research in Minimally Invasive Techniques Research (GITMI) (Spain); Blas, Ignacio de, E-mail: deblas@unizar.es [University of Zaragoza, Edificio Hospital Veterinario, Department of Animal Pathology (Unit of Infectious Diseases and Epidemiology) (Spain); Urtiaga, Ignacio, E-mail: info@doctorurtiaga.com [Hospital Clinico Universitario ' Lozano Blesa' , Department of Vascular Surgery (Spain); Carnevale, Francisco Cesar, E-mail: fcarnevale@uol.com.br [University of Sao Paulo, Medical School, Interventional Radiology (Brazil); Gregorio, Miguel A. de, E-mail: mgregori@unizar.es [University of Zaragoza, Group of Research in Minimally Invasive Techniques Research (GITMI) (Spain)

    2013-08-01

    PurposeThis study was designed to evaluate the clinical outcome and patients' satisfaction after a 5 year follow-up period for pelvic congestion syndrome (PCS) coil embolization in patients who suffered from chronic pelvic pain that initially consulted for lower limb venous insufficiency.MethodsA total of 202 patients suffering from chronic pelvic pain were recruited prospectively in a single center (mean age 43.5 years; range 27-57) where they were being treated for lower limb varices. Inclusion criteria were: lower limb varices and chronic pelvic pain (>6 months), >6 mm pelvic venous caliber in ultrasonography, and venous reflux or presence of communicating veins. Both ovarian and hypogastric veins were targeted for embolization. Pain level was assessed before and after embolotherapy and during follow-up using a visual analog scale (VAS). Technical and clinical success and recurrence of leg varices were studied. Patients completed a quality questionnaire. Clinical follow-up was performed at 1, 3, and 6 months and every year for 5 years.ResultsTechnical success was 100 %. Clinical success was achieved in 168 patients (93.85 %), with complete disappearance of symptoms in 60 patients (33.52 %). Pain score (VAS) was 7.34 {+-} 0.7 preprocedural versus 0.78 {+-} 1.2 at the end of follow-up (P < 0.0001). Complications were: groin hematoma (n = 6), coil migration (n = 4), and reaction to contrast media (n = 1). Twenty-three cases presented abdominal pain after procedure. In 24 patients (12.5 %), there was recurrence of their leg varices within the follow-up. The mean degree of patients' satisfaction was 7.4/9.ConclusionsCoil embolization of PCS is an effective and safe procedure, with high clinical success rate and degree of satisfaction.

  1. An Extended Structure-Activity Relationship of Nondioxin-Like PCBs Evaluates and Supports Modeling Predictions and Identifies Picomolar Potency of PCB 202 Towards Ryanodine Receptors.

    Science.gov (United States)

    Holland, Erika B; Feng, Wei; Zheng, Jing; Dong, Yao; Li, Xueshu; Lehmler, Hans-Joachim; Pessah, Isaac N

    2017-01-01

    Nondioxin-like polychlorinated biphenyls (NDL PCBs) activate ryanodine-sensitive Ca(2+ )channels (RyRs) and this activation has been associated with neurotoxicity in exposed animals. RyR-active congeners follow a distinct structure-activity relationship and a quantitative structure-activity relationship (QSAR) predicts that a large number of PCBs likely activate the receptor, which requires validation. Additionally, previous structural based conclusions have been established using receptor ligand binding assays but the impact of varying PCB structures on ion channel gating behavior is not understood. We used [(3)H]Ryanodine ([(3)H]Ry) binding to assess the RyR-activity of 14 previously untested PCB congeners evaluating the predictability of the QSAR. Congeners determined to display widely varying potency were then assayed with single channel voltage clamp analysis to assess direct influences on channel gating kinetics. The RyR-activity of individual PCBs assessed in in vitro assays followed the general pattern predicted by the QSAR but binding and lipid bilayer experiments demonstrated higher potency than predicted. Of the 49 congeners tested to date, tetra-ortho PCB 202 was found to be the most potent RyR-active congener increasing channel open probability at 200 pM. Shifting meta-substitutions to the para-position resulted in a > 100-fold reduction in potency as seen with PCB 197. Non-ortho PCB 11 was found to lack activity at the receptor supporting a minimum mono-ortho substitution for PCB RyR activity. These findings expand and support previous SAR assessments; where out of the 49 congeners tested to date 42 activate the receptor demonstrating that the RyR is a sensitive and common target of PCBs. © The Author 2016. Published by Oxford University Press on behalf of the Society of Toxicology. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  2. Millimeter- and submillimeter-wave surveys of Orion A emission lines in the ranges 200.7-202.3, 203.7-205.3, and 330-360 GHz

    Science.gov (United States)

    Jewell, P. R.; Hollis, J. M.; Lovas, F. J.; Snyder, L. E.

    1989-01-01

    A continuous spectral line survey of the Orion A position from 330.5 to 360.1 GHz was carried out. This survey covers nearly the entire 870 micron atmospheric window accessible from ground-based observations. Approximately 160 distinct spectral features composed of about 180 lines were detected, 29 of which could not be readily identified. In addition, Orion A from 200.7 to 202.3 GHz and from 203.7 to 205.3 GHz and 42 distinct new spectral lines were detected, including four that are unidentified at present. These data sets are the first thorough survey results in these spectral regions. The new interstellar lines in the survey bands are tabulated and displayed graphically. Moreover, the data are being made available to the Astronomical Data Center at the Goddard Space Flight Center for distribution by request to the astronomical community.

  3. Seeing laser scalpel: a novel monolithic high-power diode pumped Tm:YAG laser system at 2.02 μm with double-clad fiber combined OCT

    Science.gov (United States)

    Messner, Manuel; Heinrich, Arne; Hagen, Clemens; Unterrainer, Karl

    2017-02-01

    We report on a novel monolithic high-power diode pumped Tm:YAG laser at 2.02 μm. The pulsed laser generates average output power and pulse energy of beyond 90W and 900mJ in 400 μs pulses, respectively. This wavelength allows usage of standard fused silica fibers and optics, a price competitive solution for minimally-invasive endoscopic surgery. Recent developments in double-clad fiber combiners enable a rugged delivery system for the laser and the OCT ideal for a seeing laser scalpel. This gives the possibility to detect in-depth underlying tissue not yet ablated by the laser in a 2D or 3D fashion with micrometer resolution.

  4. Comparison of 68Ga-OPS202 (68Ga-NODAGA-JR11) and 68Ga-DOTATOC (68Ga-Edotreotide) PET/CT in Patients with Gastroenteropancreatic Neuroendocrine Tumors: Evaluation of Sensitivity in a Prospective Phase II Imaging Study.

    Science.gov (United States)

    Nicolas, Guillaume P; Schreiter, Nils; Kaul, Felix; Uiters, John; Bouterfa, Hakim; Kaufmann, Jens; Erlanger, Tobias E; Cathomas, Richard; Christ, Emanuel; Fani, Melpomeni; Wild, Damian

    2017-11-30

    Radiolabeled somatostatin receptor (sst) agonists are integral to the diagnosis of gastroenteropancreatic neuroendocrine tumors (GEP-NETs), but detection rates, especially of liver metastases, remain disappointing even with PET/CT. 68Ga-OPS202 (68Ga-NODAGA-JR11), a novel radiolabeled sst antagonist with a high affinity for sst2, has the potential to perform better than sst agonists. Here we present the results of the Phase II component of a Phase I/II study, which evaluated the sensitivity of 68Ga-OPS202 PET/CT compared with the reference compound, 68Ga-DOTATOC (sst agonist). Methods: Patients received a single intravenous administration of 68Ga-DOTATOC (15 µg peptide) and 68Ga-OPS202 (15 µg peptide at visit 1; 50 µg peptide at visit 2) with an activity of 150 MBq. Whole-body PET/CT acquisitions were performed 1 h post injection on the same calibrated PET/CT scanner. Diagnostic efficacy measures were compared against contrast medium-enhanced CT or MRI as gold standard. Two independent blinded experts read the scans and both outcomes were combined for analysis. Results: Twelve consecutive patients with G1 or G2 GEP-NETs took part in this prospective study. Image contrast for matched malignant liver lesions was significantly higher for 68Ga-OPS202 scans than for the 68Ga-DOTATOC scan: median of the mean [interquartile] tumor-to-normal-liver SUVmax ratios for 15 µg and 50 µg 68Ga-OPS202 (5.3 [2.9 - 5.7] and 4.3 [3.4 - 6.3], respectively) were significantly higher than for 68Ga-DOTATOC (1.9 [1.4 - 2.9]; P = 0.004 and P = 0.008, respectively). The higher tumor-to-background ratio of 68Ga-OPS202 resulted not only in a higher detection rate of liver metastases, but also in a significantly higher lesion-based overall sensitivity with the antagonist than with 68Ga-DOTATOC PET/CT: 94% and 88% for 50 µg and 15 µg 68Ga-OPS202 and 59% for 15 µg 68Ga-DOTATOC, respectively (pPET/CT and 68Ga DOTATOC PET/CT were similar (approximately 98%). There were no significant

  5. Coinheritance of Hb Bristol-Alesha [β67(E11)Val→Met; HBB: c.202G>A] and the α212 Patchwork Allele in a Brazilian Child with Severe Congenital Hemolytic Anemia.

    Science.gov (United States)

    Pedroso, Gisele A; Kimura, Elza M; Santos, Magnun N N; Albuquerque, Dulcinéia M; Ferruzzi, Jucilane L H; Jorge, Susan E; Costa, Fernando F; Saad, Sara T O; Sonati, Maria F

    2017-05-01

    Hb Bristol-Alesha [HBB: c.202G>A; β 67 Val>Met] is a rare structural variant of hemoglobin (Hb) resulting from a GTG>ATG substitution at codon 67 of the β-globin gene that leads to the replacement of valine by methionine in the corresponding position of the β-globin chain. The methionine residue is subsequently modified to aspartic acid [β67(E11)Val-Met→Asp], possibly by autoxidation mechanisms. This substitution prevents normal non-polar binding of Val67 to the heme group, resulting in molecular instability and severe hemolysis. We identified Hb Bristol-Alesha (in the heterozygous state), as the cause of severe congenital hemolytic anemia in an 11-month-old girl of mixed (native Indian and European) ethnic origin from the Midwestern region of Brazil, whose parents were clinically and hematologically normal. The mutation on the β-globin gene was found to have been coinherited with the α212 patchwork allele.

  6. New hardware and software platform for experiments on a HUBER-5042 X-ray diffractometer with a DISPLEX DE-202 helium cryostat in the temperature range of 20-300 K

    Science.gov (United States)

    Dudka, A. P.; Antipin, A. M.; Verin, I. A.

    2017-09-01

    Huber-5042 diffractometer with a closed-cycle Displex DE-202 helium cryostat is a unique scientific instrument for carrying out X-ray diffraction experiments when studying the single crystal structure in the temperature range of 20-300 K. To make the service life longer and develop new experimental techniques, the diffractometer control is transferred to a new hardware and software platform. To this end, a modern computer; a new detector reader unit; and new control interfaces for stepper motors, temperature controller, and cryostat vacuum pumping system are used. The system for cooling the X-ray tube, the high-voltage generator, and the helium compressor and pump for maintaining the desired vacuum in the cryostat are replaced. The system for controlling the primary beam shutter is upgraded. A biological shielding is installed. The new program tools, which use the Linux Ubuntu operating system and SPEC constructor, include a set of drivers for control units through the aforementioned interfaces. A program for searching reflections from a sample using fast continuous scanning and a priori information about crystal is written. Thus, the software package for carrying out the complete cycle of precise diffraction experiment (from determining the crystal unit cell to calculating the integral reflection intensities) is upgraded. High quality of the experimental data obtained on this equipment is confirmed in a number of studies in the temperature range from 20 to 300 K.

  7. Determination of the $e^+ e^- \\to \\gamma \\gamma(\\gamma)$ cross-section at centre-of-mass energies ranging from 189 GeV to 202 GeV

    CERN Document Server

    Abreu, P.; Adye, T.; Adzic, P.; Albrecht, Z.; Alderweireld, T.; Alekseev, G.D.; Alemany, R.; Allmendinger, T.; Allport, P.P.; Almehed, S.; Amaldi, U.; Amapane, N.; Amato, S.; Anassontzis, E.G.; Andersson, P.; Andreazza, A.; Andringa, S.; Antilogus, P.; Apel, W.D.; Arnoud, Y.; Asman, B.; Augustin, J.E.; Augustinus, A.; Baillon, P.; Ballestrero, A.; Bambade, P.; Barao, F.; Barbiellini, G.; Barbier, R.; Bardin, D.Yu.; Barker, G.J.; Baroncelli, A.; Battaglia, M.; Baubillier, M.; Becks, K.H.; Begalli, M.; Behrmann, A.; Beilliere, P.; Belokopytov, Yu.; Belous, K.; Benekos, N.C.; Benvenuti, A.C.; Berat, C.; Berggren, M.; Berntzon, L.; Bertrand, D.; Besancon, M.; Bilenky, Mikhail S.; Bizouard, M.A.; Bloch, D.; Blom, H.M.; Bonesini, M.; Boonekamp, M.; Booth, P.S.L.; Borisov, G.; Bosio, C.; Botner, O.; Boudinov, E.; Bouquet, B.; Bourdarios, C.; Bowcock, T.J.V.; Boyko, I.; Bozovic, I.; Bozzo, M.; Bracko, M.; Branchini, P.; Brenner, R.A.; Bruckman, P.; Brunet, J.M.; Bugge, L.; Buran, T.; Buschbeck, B.; Buschmann, P.; Cabrera, S.; Caccia, M.; Calvi, M.; Camporesi, T.; Canale, V.; Carena, F.; Carroll, L.; Castillo Gimenez, M.V.; Cattai, A.; Cavallo, F.R.; Chapkin, M.; Charpentier, P.; Checchia, P.; Chelkov, G.A.; Chierici, R.; Shlyapnikov, P.; Chochula, P.; Chorowicz, V.; Chudoba, J.; Cieslik, K.; Collins, P.; Contri, R.; Cortina, E.; Cosme, G.; Cossutti, F.; Costa, M.; Crawley, H.B.; Crennell, D.; Crosetti, G.; Cuevas Maestro, J.; Czellar, S.; D'Hondt, J.; Dalmau, J.; Davenport, M.; Da Silva, W.; Della Ricca, G.; Delpierre, P.; Demaria, N.; De Angelis, A.; De Boer, W.; De Clercq, C.; De Lotto, B.; De Min, A.; De Paula, L.; Dijkstra, H.; Di Ciaccio, L.; Dolbeau, J.; Doroba, K.; Dracos, M.; Drees, J.; Dris, M.; Eigen, G.; Ekelof, T.; Ellert, M.; Elsing, M.; Engel, J.P.; Espirito Santo, M.C.; Fanourakis, G.; Fassouliotis, D.; Feindt, M.; Fernandez, J.; Ferrer, A.; Ferrer-Ribas, E.; Ferro, F.; Firestone, A.; Flagmeyer, U.; Foeth, H.; Fokitis, E.; Fontanelli, F.; Franek, B.; Frodesen, A.G.; Fruhwirth, R.; Fulda-Quenzer, F.; Fuster, J.; Galloni, A.; Gamba, D.; Gamblin, S.; Gandelman, M.; Garcia, C.; Gaspar, C.; Gaspar, M.; Gasparini, U.; Gavillet, P.; Gazis, Evangelos; Gele, D.; Geralis, T.; Ghodbane, N.; Gil Botella, Ines; Glege, F.; Gokieli, R.; Golob, B.; Gomez-Ceballos, G.; Goncalves, P.; Gonzalez Caballero, I.; Gopal, G.; Gorn, L.; Guz, Yu.; Gracco, V.; Grahl, J.; Graziani, E.; Gris, P.; Grosdidier, G.; Grzelak, K.; Guy, J.; Haag, C.; Hahn, F.; Hahn, S.; Haider, S.; Hajduk, Z.; Hallgren, A.; Hamacher, K.; Hansen, J.; Harris, F.J.; Hauler, F.; Hedberg, V.; Heising, S.; Hernandez, J.J.; Herquet, P.; Herr, H.; Higon, E.; Holmgren, S.O.; Holt, P.J.; Hoorelbeke, S.; Houlden, M.; Hrubec, J.; Huber, M.; Hughes, G.J.; Hultqvist, K.; Jackson, John Neil; Jacobsson, R.; Jalocha, P.; Janik, R.; Jarlskog, C.; Jarlskog, G.; Jarry, P.; Jean-Marie, B.; Jeans, D.; Johansson, Erik Karl; Jonsson, P.; Joram, C.; Juillot, P.; Jungermann, L.; Kapusta, Frederic; Karafasoulis, K.; Katsanevas, S.; Katsoufis, E.C.; Keranen, R.; Kernel, G.; Kersevan, B.P.; Khokhlov, Yu.A.; Khomenko, B.A.; Khovansky, N.N.; Kiiskinen, A.; King, B.; Kinvig, A.; Kjaer, N.J.; Klapp, O.; Kluit, P.; Kokkinias, P.; Kostyukhin, V.; Kourkoumelis, C.; Kuznetsov, O.; Krammer, M.; Kriznic, E.; Krumshtein, Z.; Kubinec, P.; Kucewicz, W.; Kurowska, J.; Kurvinen, K.; Lamsa, J.W.; Lane, D.W.; Lapin, V.; Laugier, J.P.; Lauhakangas, R.; Leder, G.; Ledroit, Fabienne; Leinonen, L.; Leisos, A.; Leitner, R.; Lemonne, J.; Lenzen, G.; Lepeltier, V.; Lethuillier, M.; Libby, J.; Liebig, W.; Liko, D.; Lipniacka, A.; Lippi, I.; Lorstad, B.; Loken, J.G.; Lopes, J.H.; Lopez, J.M.; Lopez-Fernandez, R.; Loukas, D.; Lutz, P.; Lyons, L.; MacNaughton, J.; Mahon, J.R.; Maio, A.; Malek, A.; Maltezos, S.; Malychev, V.; Mandl, F.; Marco, J.; Marco, R.; Marechal, B.; Margoni, M.; Marin, J.C.; Mariotti, C.; Markou, A.; Martinez-Rivero, C.; Marti i Garcia, S.; Masik, J.; Mastroyiannopoulos, N.; Matorras, F.; Matteuzzi, C.; Matthiae, G.; Mazzucato, F.; Mazzucato, M.; McCubbin, M.; McKay, R.; McNulty, R.; McPherson, G.; Merle, E.; Meroni, C.; Meyer, W.T.; Myagkov, A.; Migliore, E.; Mirabito, L.; Mitaroff, W.A.; Mjornmark, U.; Moa, T.; Moch, M.; Moller, Rasmus; Monig, Klaus; Monge, M.R.; Moraes, D.; Morettini, P.; Morton, G.; Muller, U.; Munich, K.; Mulders, M.; Mulet-Marquis, C.; Mundim, L.M.; Muresan, R.; Murray, W.J.; Muryn, B.; Myatt, G.; Myklebust, T.; Naraghi, F.; Nassiakou, M.; Navarria, F.L.; Nawrocki, K.; Negri, P.; Neufeld, N.; Nicolaidou, R.; Nielsen, B.S.; Niezurawski, P.; Nikolenko, M.; Nomokonov, V.; Nygren, A.; Oblakowska Mucha, A.; Obraztsov, V.; Olshevsky, A.G.; Onofre, A.; Orava, R.; Orazi, G.; Osterberg, K.; Ouraou, A.; Oyanguren, A.; Paganoni, M.; Paiano, S.; Pain, R.; Paiva, R.; Palacios, J.; Papadopoulou, T.D.; Pape, L.; Parkes, C.; Parodi, F.; Parzefall, U.; Passeri, A.; Passon, O.; Pavel, T.; Pegoraro, M.; Peralta, L.; Pernicka, M.; Perrotta, A.; Petridou, C.; Petrolini, A.; Phillips, H.T.; Pierre, F.; Pimenta, M.; Piotto, E.; Podobnik, T.; Poireau, V.; Pol, M.E.; Polok, G.; Poropat, P.; Pozdnyakov, V.; Privitera, P.; Pukhaeva, N.; Pullia, A.; Radojicic, D.; Ragazzi, S.; Rahmani, H.; Rames, J.; Ratoff, P.N.; Read, Alexander L.; Rebecchi, P.; Redaelli, Nicola Giuseppe; Regler, M.; Rehn, J.; Reid, D.; Reinertsen, P.; Reinhardt, R.; Renton, P.B.; Resvanis, L.K.; Richard, F.; Ridky, J.; Rinaudo, G.; Ripp-Baudot, Isabelle; Romero, A.; Ronchese, P.; Rosenberg, E.I.; Rosinsky, P.; Roudeau, P.; Rovelli, T.; Ruhlmann-Kleider, V.; Ruiz, A.; Saarikko, H.; Sacquin, Y.; Sadovsky, A.; Sajot, G.; Salt, J.; Sampsonidis, D.; Sannino, M.; Savoy-Navarro, A.; Schwemling, P.; Schwering, B.; Schwickerath, U.; Scuri, Fabrizio; Seager, P.; Sedykh, Yu.; Segar, A.M.; Seibert, N.; Sekulin, R.; Sette, G.; Shellard, R.C.; Siebel, M.; Simard, L.; Simonetto, F.; Sisakian, A.N.; Smadja, G.; Smirnova, O.; Smith, G.R.; Solovianov, O.; Sopczak, A.; Sosnowski, R.; Spassoff, T.; Spiriti, E.; Squarcia, S.; Stanescu, C.; Stanitzki, M.; Stevenson, K.; Stocchi, A.; Strauss, J.; Strub, R.; Stugu, B.; Szczekowski, M.; Szeptycka, M.; Tabarelli, T.; Taffard, A.; Tegenfeldt, F.; Terranova, F.; Timmermans, Jan; Tinti, N.; Tkachev, L.G.; Tobin, M.; Todorova, S.; Tome, B.; Tonazzo, A.; Tortora, L.; Tortosa, P.; Transtromer, G.; Treille, D.; Tristram, G.; Trochimczuk, M.; Troncon, C.; Turluer, M.L.; Tyapkin, I.A.; Tyapkin, P.; Tzamarias, S.; Ullaland, O.; Uvarov, V.; Valenti, G.; Vallazza, E.; Van Dam, Piet; Van Den Boeck, W.; Van Eldik, J.; Van Lysebetten, A.; Van Remortel, N.; Van Vulpen, I.; Vegni, G.; Ventura, L.; Venus, W.; Verbeure, F.; Verdier, P.; Verlato, M.; Vertogradov, L.S.; Verzi, V.; Vilanova, D.; Vitale, L.; Vlasov, E.; Vodopianov, A.S.; Voulgaris, G.; Vrba, V.; Wahlen, H.; Washbrook, A.J.; Weiser, C.; Wicke, D.; Wickens, J.H.; Wilkinson, G.R.; Winter, M.; Wolf, G.; Yi, J.; Yushchenko, O.; Zalewska, A.; Zalewski, P.; Zavrtanik, D.; Zevgolatakos, E.; Zimine, N.I.; Zinchenko, A.; Zoller, P.; Zumerle, G.; Zupan, M.

    2000-01-01

    A test of the QED process \\eeintogg(\\fot) is reported. The data analysed were collected with the DELPHI detector in 1998 and 1999 at the highest ener\\-gies achieved at LEP, reaching 202 GeV in the centre-of-mass. The total integrated luminosity amounts to 375.7 pb$^{-1}$. The differential and total cross-sections for the process $e^+e^- \\to \\gamma \\gamma$ were measured, and found to be in agreement with the QED prediction. 95\\% Confidence Level (C.L.) lower limits on the QED cut-off parameters of $\\rm \\Lambda_+ >$ 330 GeV and $\\rm \\Lambda_{-}>$ 320 GeV were derived. A 95\\% C.L. lower bound on the mass of an excited electron of 311 $\\rm GeV/c^2$ (for $\\lambda_{\\gamma}$ =1) was obtained. s-channel virtual graviton exchange was searched for, resulting in 95\\% C.L. lower limits on the string mass scale, $\\rm M_S$: $\\rm M_S > 713 \\, GeV/c^2$ ( $\\lambda=1$) and $\\rm M_S > 691 \\,GeV/c^2$ ($\\lambda = -1$).

  8. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  9. 19 CFR 202.2 - Applications.

    Science.gov (United States)

    2010-04-01

    ... of the applicant, an advantage or disadvantage in competition, and any other information which the... relates may be filed by any firm, association of firms, or corporation engaged in the production of a...

  10. 40 CFR 96.202 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... energy generated by any specified unit and pays its proportional amount of such unit's total costs... thermal energy produced by the cogeneration unit. Unit means a stationary, fossil-fuel-fired boiler or combustion turbine or other stationary, fossil-fuel-fired combustion device. Unit operating day means a...

  11. 40 CFR 97.202 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... energy generated by any specified unit and pays its proportional amount of such unit's total costs... thermal energy produced by the cogeneration unit. Unit means a stationary, fossil-fuel-fired boiler or combustion turbine or other stationary, fossil-fuel-fired combustion device. Unit operating day means a...

  12. 14 CFR 1214.202 - Reimbursement policy.

    Science.gov (United States)

    2010-01-01

    ... which require no Shuttle services (power, deployment, etc.), and are for R&D purposes, will be flown on... declaration, the short term call-up option and associated fee will apply. If the desired launch is to occur in... launch date at the mid-point of the designated one-year period. (ii) Once the firmly scheduled launch...

  13. 43 CFR 17.202 - Definitions.

    Science.gov (United States)

    2010-10-01

    ...) Section 504 means section 504 of the Act. (c) Education of the Handicapped Act means that statute as amended by the Education for All Handicapped Children Act of 1975, Public Law 94-142, 20 U.S.C. 1401 et..., organic brain syndrome, emotional or mental illness, and specific learning disabilities. The term...

  14. FCJ-202 Simulated Wars, Virtual Engagements

    Directory of Open Access Journals (Sweden)

    Seimeng Lai

    2016-03-01

    Full Text Available Digital environments that simulate operating environments have often been used by practitioners to develop complex skill sets. Simulation training not only enables them to become proficient in the various actions, movements and procedures but also allows familiarity with a range of different scenarios and contexts. Such training is thus often viewed as an inexpensive, safe and effective alternative, which can allow what was learnt to be transferred and applied to ‘real world’ situations. This paper examines the simulation experiences of soldiers learning to become tank operators. We analyse how, through repetitive interactions with these digital environments, tank operators have learned various habits that shape their actions and motor skills, but also their habituated bodies to think, react and behave in relation to the given combat situations. Through interviews with tank operators from a modern military and from observations of their simulation training, we point out the limits of a phenomenological approach by showing how the virtual, in the Deleuzian sense of that term, forms the necessary backdrop for the acquisition of skilful habits. Thus, this paper establishes that there is an inherent connection between learning and habits that goes beyond representation. Through the Deleuzian understanding of the virtual and its relation to a Ravaissonian understanding of habit, we argue that learning and the gaining of habits are necessarily experimental processes that would produce infinite permutations within our various interactions. This will not only allow us to productively engage with the virtual but also facilitate us to mobilise learning to go beyond the limits placed by representation in all of our interactions.

  15. BDML Metadata: 202 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available //ssbd.qbic.riken.jp/search/4119dc76-dd57-4842-bd1e-902659dfec60/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-151 ... ...tal Dynamics See details in Kyoda et al. (2013) Nucleic Acids Res 41, D732-D737. CC BY-NC-SA 0.150 4119dc76-...dd57-4842-bd1e-902659dfec60 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data/sou

  16. 24 CFR 3280.202 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... affixed to the home's structure including any materials such as paint or wallpaper and the substrate to... outlets, switches, and other devices; (9) Decorative items attached to walls and partitions (i.e., pictures, decorative objects, etc.) constituting no more than 10% of the aggregate wall surface area in any...

  17. 44 CFR 206.202 - Application procedures.

    Science.gov (United States)

    2010-10-01

    ... applicant, assisted by the State as appropriate, will prepare a Project Worksheet (FEMA Form 90-91) for each..., DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Public Assistance Project...) Providing technical advice and assistance to eligible subgrantees; (2) Providing State support for project...

  18. 47 CFR 202.1 - Policies.

    Science.gov (United States)

    2010-10-01

    ... OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL NATIONAL SECURITY AND EMERGENCY... of the Federal Government, with the exception of radio stations in the Aviation Services and certain...) Radio stations in the Aviation Services and those aboard vessels in the Maritime Service will be subject...

  19. 5 CFR 337.202 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... of this chapter. (b) A severe shortage of candidates for a particular position or group of positions... knowledge, skills, and abilities required to perform the job requirements despite extensive recruitment... relocation incentives or special salary rates. (c) A critical hiring need for a particular position or group...

  20. 14 CFR 1251.202 - Employment criteria.

    Science.gov (United States)

    2010-01-01

    ... the recipient, is shown to be job-related for the position in question; and (2) Alternative job... handicap that impairs sensory, manual, or speaking skills, the test results accurately reflect the applicant's or employee's job skills, aptitude, or whatever other factor the test purports to measure...

  1. Publications | Page 202 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Do changes in inheritance legislation improve women's access to physical and human capital? : evidence from India's Hindu succession act ... The threat of the subprime crisis in the United States began to make itself felt in early 2008, with its effects subsequently become global. It is evident that trade linkages have been ...

  2. 48 CFR 49.202 - Profit.

    Science.gov (United States)

    2010-10-01

    ... inventory; (4) Amount and source of capital and extent of risk assumed; (5) Inventive and developmental...) Character and difficulty of subcontracting, including selection, placement, and management of subcontracts... terminated portion of a construction contract, the contracting officer shall— (1) Comply with paragraphs (a...

  3. 7 CFR 760.202 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... dairy cow means a female bovine dairy breed animal used for the purpose of providing milk for human... means any species of aquatic organism grown as food for human consumption, fish raised as feed for fish... dairy cattle means a bovine dairy breed animal used for the purpose of providing milk for human...

  4. 48 CFR 202.101 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... Defense Energy Support Center Defense Security Cooperation Agency Contracting Division Defense Security... Systems Agency, the Defense Intelligence Agency, the Defense Logistics Agency, the Defense Security Cooperation Agency, the Defense Security Service, the Defense Threat Reduction Agency, the Missile Defense...

  5. 40 CFR 59.202 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... bonding adjoining rolls of installed flexible sheet flooring or to fill any minute gaps between and adjoining rolls. Flying bug insecticide means any insecticide product that is designed for use against.... “Nonresilient flooring” includes, but is not limited to, terrazzo, marble, slate, granite, brick, stone, ceramic...

  6. 4 CFR 202.1 - Description.

    Science.gov (United States)

    2010-01-01

    ... entire image is circumscribed by a gold boundary with 18 equally spaced “gear” teeth; that image is...” centered at its top, and the word “BOARD” is centered at its bottom and separated from the top-centered...

  7. 46 CFR 197.202 - Applicability.

    Science.gov (United States)

    2010-10-01

    ... GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE OCCUPATIONAL SAFETY AND HEALTH STANDARDS... issued by the Coast Guard including mobile offshore drilling units regardless of their geographic... advancement of diving equipment and technology; or (3) Performed solely for search and rescue or related...

  8. 47 CFR 2.202 - Bandwidths.

    Science.gov (United States)

    2010-10-01

    ... following terms are employed: Bn = Necessary bandwidth in hertz B = Modulation rate in bauds N = Maximum... modulation frequency in hertz C = Sub-carrier frequency in hertz D = Peak frequency deviation, i.e., half the... in hertz is the time rate of change in phase in radians divided by 2 t = Pulse duration in seconds at...

  9. 46 CFR 11.202 - STCW endorsements.

    Science.gov (United States)

    2010-10-01

    ... GUARD, DEPARTMENT OF HOMELAND SECURITY MERCHANT MARINE OFFICERS AND SEAMEN REQUIREMENTS FOR OFFICER... exempt from application of STCW: (1) Uninspected passenger vessels as defined in 46 U.S.C. 2101(42). (2... mobile offshore drilling units. (5) Vessels operating exclusively on the Great Lakes or on the inland...

  10. 42 CFR 57.202 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... medicine, osteopathic medicine, dentistry, pharmacy, podiatric medicine, optometry, or veterinary medicine... school of medicine, school of dentistry, school of osteopathic medicine, school of pharmacy, school of podiatric medicine, school of optometry, or school of veterinary medicine as defined in section 799(1)(A) of...

  11. 42 CFR 50.202 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... statute, in a correctional or rehabilitative facility, including a mental hospital or other facility for... agencies. The Secretary means the Secretary of Health and Human Services and any other officer or employee...

  12. 202 197 Heavy Metals and Microbial Contamin

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... ABSTRACT: The heavy metal and microbial contaminants levels were evaluated in a commercial polyherbal .... (Cowan and Steel) was carried out to identify ... Statistical Analysis. Analysis of data obtained from this study was done using Excel Microsoft software. Analysis of Variance (ANOVA) was used for.

  13. 42 CFR 438.202 - State responsibilities.

    Science.gov (United States)

    2010-10-01

    ... written strategy for assessing and improving the quality of managed care services offered by all MCOs and PIHPs. (b) Obtain the input of recipients and other stakeholders in the development of the strategy and make the strategy available for public comment before adopting it in final. (c) Ensure that MCOs, PIHPs...

  14. 10 CFR 600.202 - Definitions.

    Science.gov (United States)

    2010-01-01

    ..., insurance claims, and other benefit payments. Accrued income means the sum of: (1) Earnings during a given... used in this part: Accrued expenditures mean the charges incurred by the grantee during a given period... on an accrued expenditure basis, outlays are the sum of actual cash disbursements, the amount of...

  15. 17 CFR 202.5 - Enforcement activities.

    Science.gov (United States)

    2010-04-01

    ..., communications from Federal or State agencies, examination of filings made with the Commission, or otherwise, it... issued or testimony compelled. The Commission may, in its discretion, make such formal investigations and...-regulatory organization of which the person is a member or participant. Unless otherwise ordered by the...

  16. 42 CFR 414.202 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... ostomy bags and supplies directly related to ostomy care, and replacement of such devices and supplies... supplies, ostomy bags, and supplies related to ostomy care that are furnished by an HHA as part of home...

  17. 48 CFR 51.202 - Authorization.

    Science.gov (United States)

    2010-10-01

    ... USE OF GOVERNMENT SOURCES BY CONTRACTORS Contractor Use of Interagency Fleet Management System (IFMS... obtain interagency fleet management system (IFMS) vehicles and related services, if the contracting... from the ownership, maintenance, or use of an interagency fleet management system (IFMS) vehicle; (3...

  18. 12 CFR 202.9 - Notifications.

    Science.gov (United States)

    2010-01-01

    ... the basis of race, color, religion, national origin, sex, marital status, age (provided the applicant... or policies or that the applicant, joint applicant, or similar party failed to achieve a qualifying... application. When an applicant submits an application and the parties contemplate that the applicant will...

  19. Publications | Page 202 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. ... whether and to what extent changes in inheritance legislation impact women''s physical and human capital investments using disaggregated household level data from India.

  20. 5 CFR 530.202 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... performance appraisal system that has been certified under 5 CFR part 430, subpart D, the limitation on... defined at 5 U.S.C. 105. Aggregate compensation means the total of— (1) Basic pay received as an employee of the executive branch or as an employee outside the executive branch to whom the General Schedule...

  1. 37 CFR 202.17 - Renewals

    Science.gov (United States)

    2010-07-01

    ... and may be protected by copyright or neighboring rights in their “source country,” as defined at 17 U... death of the author and with respect to which no copyright assignment or other contract for exploitation of the work occurred during the author's lifetime. (4) For purposes of this section, the term...

  2. 40 CFR 89.202 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... EMISSIONS FROM NEW AND IN-USE NONROAD COMPRESSION-IGNITION ENGINES Averaging, Banking, and Trading... emission credits among engine families within a given manufacturer's product line. Banking means the... future model year averaging or trading as permitted by these regulations. Emission credits represent the...

  3. 40 CFR 90.202 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... EMISSIONS FROM NONROAD SPARK-IGNITION ENGINES AT OR BELOW 19 KILOWATTS Certification Averaging, Banking, and... between engine families within a given manufacturer's product line. Banking means the retention of... trading, for use in future model year averaging or trading as permitted in this part. Emission credits...

  4. 40 CFR 88.202-94 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... would otherwise be required. Banking means the retention of credits, by the manufacturer generating the emissions credits, for use in future model-year certification as permitted by regulation. Sales means...

  5. 5 CFR 724.202 - Notice obligations.

    Science.gov (United States)

    2010-01-01

    ... basis of race, color, religion, sex, national origin, age, disability, marital status or political... you believe that you have been the victim of unlawful discrimination on the basis of race, color, religion, sex, national origin or disability, you must contact an Equal Employment Opportunity (EEO...

  6. 37 CFR 202.12 - Restored copyrights.

    Science.gov (United States)

    2010-07-01

    ... screen. (iv) Pictorial, graphic and sculptural works. With the exception of 3-dimensional works of art... subject of registration. (vi) Motion pictures. If the deposit is a film print (16 or 35 mm), the applicant...

  7. 42 CFR 418.202 - Covered services.

    Science.gov (United States)

    2010-10-01

    ... individual at home. Respite care must be furnished as specified in § 418.108(b). Payment for inpatient care... patient's home while he or she is under hospice care. Medical supplies include those that are part of the written plan of care and that are for palliation and management of the terminal or related conditions. (g...

  8. 7 CFR 400.202 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... and software, data communications hardware and software, and printers utilized with the system. (e... Accepted Accounting Principles (GAAP) and reflect the financial position in the Statement of Financial...

  9. Reference: 202 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available tructure is similar to glycogen. In addition, the residual amylopectin structure in the corresponding mutant lines display... did not lead to a distinctive phenotype. However, Atisa2/Atpu1 double-mutant lines display...direct, function of Iso1 during the synthesis of amylopectin. Mutant lines carrying a defect in AtISA3 dis...play a strong starch-excess phenotype at the end of both the light and the dark pha

  10. 48 CFR 52.202-1 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... Regulation (FAR), the word or term has the same meaning as the definition in FAR 2.101 in effect at the time... section of the FAR where the provision or clause is prescribed provides a different meaning; or (4) The... Index is available via the Internet at http://www.acqnet.gov at the end of the FAR, after the FAR...

  11. 7 CFR 1430.202 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Secretary, shares in the risk of producing milk, and makes contributions (including land, labor, management..., or other business enterprise or other legal entity who is, or whose members are, a citizen of, or...

  12. Integrated Advanced Microwave Sounding Unit-A (AMSU-A). Engineering Test Report: AMSU-A1 EOS Instrument, (S/N 202) Qualification Level Vibration Tests of August/September 1998, (S/O 565632, OC-417) Plus Addendum A

    Science.gov (United States)

    Heffer, R.

    1998-01-01

    The purpose of this report is to present a qualification level vibration testing performed on the S/N 202, EOS AMSU-A1 Instrument was vibration tested to qualification levels per the Ref. 1 shop order. The instrument withstood the 8 g sine sweep test, the 7.5 Grms random vibration test, and the 18.75 g sine burst test in each of the three orthogonal axes. Some loss of transmissibility, however, is seen in the lower reflector after Z-axis random vibration. The test sequence was not without incidence. Failure of Channel 7 in the Limited Performance Test (LPT) performed after completion of the 1 st (X-axis) axis vibration sequence, required replacement of the DRO and subsequent re-testing of the instrument. The post-vibration comprehensive performance test (CPT) was successfully run after completion of the three axes of vibration with the replacement component installed in the instrument. Passing the CPT signified the successful completion of the S/N 202 A1 qualification vibration testing.

  13. 17 CFR 229.202 - (Item 202) Description of registrant's securities.

    Science.gov (United States)

    2010-04-01

    ... take action; (vi) any classification of the Board of Directors, and the impact of such classification... maintenance of any asset ratio or the creation or maintenance of reserves; (5) Provisions restricting the... effects thereof pursuant to sections 1271-1278; (10) The name of the trustee(s) and the nature of any...

  14. 24 CFR 597.202 - Submission of nominations for designation.

    Science.gov (United States)

    2010-04-01

    ... reporting on the use of Empowerment Zone/Enterprise Community Social Service Block Grant funds; and (8... HOUSING AND URBAN DEVELOPMENT COMMUNITY FACILITIES URBAN EMPOWERMENT ZONES AND ENTERPRISE COMMUNITIES...) General. A nomination for designation as an Empowerment Zone and/or Enterprise Community must be submitted...

  15. 37 CFR 202.16 - Preregistration of copyrights.

    Science.gov (United States)

    2010-07-01

    ... work is a videogame, also describe the subject matter of the videogame and the overall object, goal or..., public figure, or other item or occurrence which the photograph is intended to advertise or market. To...

  16. Dicty_cDB: AFI202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mvfwi*cgsrcnsxxcnsissfniktrr*nilxxyitn*wnvykfidytnixiy*xs ykntixkkktisxgxnxdxxxxxmxrgxxxxxxxxxxx--- ---XQXVD...KDSRDNIKIRSSFISSSLFFIK ISIWFFGYSVGQGATAXFAIPYQVSILRPEDKTYXXGILPISGMFINLLITPIXGYIXDH TKTPXGRRRPYLXXGTXXXXXXXXXEAXXXXPXXXXX--- ---xxx...ligxwpfihyqxkplakxwxfgxxllsxxlxxxx Frame C: iniikriwikwnqqhqkpp*hihqniqkvqk*yqkqvvkiv...viilklevalyhhlyfl*k yqygfldivwvkvqqxxlqfhikfqy*dqkikhixxvyyqlvecl*iy*lhqyxdilxii qkhhxeeedhiyxxerxxxxxxxxx...rxhxxxxxxxxx--- ---xxx*lgxgpsfitkxnxwqkxgxlaxxfyrxxxxxsx Homology vs CSM-cDNA Score

  17. 7 CFR 3560.202 - Establishing rents and utility allowances.

    Science.gov (United States)

    2010-01-01

    ... housing tax credit (LIHTC) rents. (d) Utility allowances. In projects where tenants pay the utilities... contributions or rehabilitation loans will not be counted towards reducing rents. (f) Rents for resident manager... rental unit in a housing project when they are acting as a management agent or resident manager as...

  18. All projects related to | Page 202 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: INFORMATION SYSTEMS, INFORMATION POLICY, Internet, ACCESS TO INFORMATION, DEVELOPING COUNTRIES, Economic and social development, CASE STUDIES, POLICY MAKING, RESEARCH CAPACITY, RESEARCH NETWORKS. Region: Argentina, South America, Brazil, India, Kenya, Nigeria, Nepal, ...

  19. 48 CFR 1019.202-70-13 - Developmental assistance.

    Science.gov (United States)

    2010-10-01

    ... developmental assistance a mentor can provide to a protégé include: (a) Management guidance relating to financial management, organizational management, overall business management/planning, business development...

  20. 7 CFR 810.202 - Definition of other terms.

    Science.gov (United States)

    2010-01-01

    ... weathered and contain considerable evidence of mold. (n) Other grains. Black barley, corn, cultivated..., poulard wheat, rice, rye, safflower, sorghum, soybeans, spelt, sunflower seed, sweet corn, triticale, and...

  1. 12 CFR 202.11 - Relation to state law.

    Science.gov (United States)

    2010-01-01

    ...) There is adequate provision for state enforcement. (2) Liability and enforcement. (i) No exemption will extend to the civil liability provisions of section 706 of the Act or the administrative enforcement...

  2. St John's House, 202 Merrion Road, Dublin 4.

    LENUS (Irish Health Repository)

    O'Mahoney, S

    2012-06-01

    AJ Cronin (1896-1981) was a Scottish-born doctor-turned-novelist whose most famous novel is The Citadel, published in 1937. The book describes the struggles of an idealistic young doctor working in Wales and London in the 1920s and 30s. The novel was a global bestseller and its portrayal of a largely ineffective, corruption-ridden system of healthcare is thought to have directly influenced the foundation of the National Health Service in 1948. The Citadel anticipates such phenomena as evidence-based medicine and continuing medical education. This paper argues that the novel was never intended as propaganda for a state-controlled national health service. On the contrary, Cronin was against state control. Analysis of the novel is informed by recent biographical revelations about Cronin and the blurring of the margin between fact and fiction in Cronin\\'s life and work is examined.

  3. 46 CFR 177.202 - Plans and information required.

    Science.gov (United States)

    2010-10-01

    ... with number of circuits and rating of energy consuming devices; (vii) Type of capacity of storage... including: bilge, ballast, hydraulic, sanitary, compressed air, combustible and flammable liquids, vents...

  4. 46 CFR 116.202 - Plans and information required.

    Science.gov (United States)

    2010-10-01

    ... communication panelboards with number of circuits and rating of energy consuming devices; (vii) Type and... systems including: bilge, ballast, hydraulic, sanitary, compressed air, combustible and flammable liquids...

  5. 1935 15' Quad #202 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  6. 45 CFR 73.735-202 - Management officials.

    Science.gov (United States)

    2010-10-01

    ... requirements of this part in all respects and to help employees, special Government employees, and supervisors... Department's counselling and training services regarding conflicts of interest and assuring that employees of...

  7. 5 CFR 362.202 - Announcement, nomination, and selection.

    Science.gov (United States)

    2010-01-01

    ... for, as well as a clear interest in and commitment to, leadership in the analysis and management of... participating agencies the list of Fellows finalists for consideration. Agencies may select and appoint a... leadership (supervisory or managerial), policy, professional, or technical position, in an area relevant to...

  8. 9 CFR 202.112 - Rule 12: Oral hearing.

    Science.gov (United States)

    2010-01-01

    ... immaterial, irrelevant, or unduly repetitious, or which is not of the sort on which responsible persons are... the insertion of such evidence in full and, if the judicial officer decides that the presiding officer...

  9. 202 INFLUENCE OF BUILDING COSTS ON RENTS OF ...

    African Journals Online (AJOL)

    Building, Costs, Rent, Residential, Property, Accommodation. Introduction. Background ... of some unpartitioned floor space which users could finish as their budget allows”. ... rise as indicated below: Table IV: Average Rent Per Annum Paid for Residential Accommodation in Owerri between 1990 and 2005. Accommodation.

  10. 21 CFR 202.1 - Prescription-drug advertisements.

    Science.gov (United States)

    2010-04-01

    ... distributor or other written, printed, or graphic matter containing no representation or suggestion relating... experience adequately documented in medical literature or by other data (to be supplied to the Food and Drug... material in the light of its representations or material with respect to consequences that may result from...

  11. 7 CFR 868.202 - Definition of other terms.

    Science.gov (United States)

    2010-01-01

    ...-milled degree. (g) Objectionable seeds. Seeds other than rice, except seeds of Echinochloa crusgalli... appreciable amount of red bran. (k) Seeds. Whole or broken seeds of any plant other than rice. (l) Smutty... and large broken kernels. Rice (including seeds) that (1) passes over a 6 plate (for southern...

  12. Dicty_cDB: SHH202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s. 82 2e-26 3 BI863585 |BI863585.1 kx46a06.y1 Parastrongyloides trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides...es trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides trichosuri cDNA 5' s...imilar to SW:EF2_CHICK Q90705 ELONGATION FACTOR 2 ;, mRNA sequence. 66 4e-17 3 BI451383 |BI451383.1 kx23e09.y1 Parastrongyloides... trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides trichosuri cDNA 5' similar ...ondii cDNA clone GR__Ea23P22 3', mRNA sequence. 74 1e-18 2 BI863575 |BI863575.1 kx45h07.y1 Parastrongyloid

  13. 41 CFR 101-42.202 - Identification of hazardous materials.

    Science.gov (United States)

    2010-07-01

    ... that manufacturers identify and document potential hazards on material safety data sheets (MSDSs) as... in the HMIS or on a MSDS, contact the procuring agency, the manufacturer, or your technical staff for... shall be maintained in the item record for use in preparation of reports of excess property...

  14. 10 CFR 1050.202 - Allowable acceptance of gifts.

    Science.gov (United States)

    2010-01-01

    ... and retain gifts from foreign governments where the gift is tendered or received as a souvenir or mark... part, an employee may accept gifts of more than minimal value, tendered as a souvenir or mark of...

  15. 50 CFR 223.202 - Steller sea lion.

    Science.gov (United States)

    2010-10-01

    ... 16460 SW Point, Lake Point. 22. Gramp rock 51°29.0 N 178°20.5 W 16460 Whole island. 23. Tag I. 51°33.5 N... EC01JY91.042 EC01JY91.043 EC01JY91.044 (4) Commercial Fishing Operations. The incidental mortality and serious injury of endangered and threatened Steller sea lions in commercial fisheries can be authorized in...

  16. 47 CFR 202.3 - Plans preparation and execution.

    Science.gov (United States)

    2010-10-01

    ... procedures developed pursuant to these regulations. (6) The Director, Central Intelligence Agency, shall plan... assigned responsibilities, including the dissemination of intelligence within the Federal government. (7... documents to implement, establish, guide, describe or explain organizational responsibilities, authorities...

  17. 29 CFR 1603.202 - Administrative law judge.

    Science.gov (United States)

    2010-07-01

    ... EXEMPT STATE AND LOCAL GOVERNMENT EMPLOYEE COMPLAINTS OF EMPLOYMENT DISCRIMINATION UNDER SECTION 304 OF...) Change the time, place or date of the hearing; (b) Enter a default decision against a party failing to appear at a hearing unless the party shows good cause by contacting the administrative law judge and...

  18. Glacial Features (Point) - Quad 202 (NEWBURYPORT EAST, MA-NH)

    Data.gov (United States)

    University of New Hampshire — The Glacial Features (Point) layer describes point features associated with surficial geology. These glacial features include, but are not limited to, delta forsets,...

  19. 48 CFR 832.202-4 - Security for Government financing.

    Science.gov (United States)

    2010-10-01

    ... for Government financing. An offeror's financial condition may be considered adequate security to... exposure to financial crisis, and credit arrangements. (d) A statement of the status of all State, local... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Security for Government...

  20. 24 CFR 570.202 - Eligible rehabilitation and preservation activities.

    Science.gov (United States)

    2010-04-01

    ..., abatement of asbestos hazards, lead-based paint hazard evaluation and reduction, and the correction of code... restrict the mobility and accessibility of elderly or severely disabled persons to buildings and... or to rehabilitate such buildings for housing. (f) Lead-based paint activities. Lead-based paint...

  1. St John's House, 202 Merrion Road, Dublin 4.

    LENUS (Irish Health Repository)

    2011-08-30

    Abstract Before a probiotic bacterium can even begin to fulfill its biological role, it must survive a battery of environmental stresses imposed during food processing and passage through the gastrointestinal tract (GIT). Food processing stresses include extremes in temperature, as well as osmotic, oxidative and food matrix stresses. Passage through the GIT is a hazardous journey for any bacteria with deleterious lows in pH encountered in the stomach to the detergent-like properties of bile in the duodenum. However, bacteria are equipped with an array of defense mechanisms to counteract intracellular damage or to enhance the robustness of the cell to withstand lethal external environments. Understanding these mechanisms in probiotic bacteria and indeed other bacterial groups has resulted in the development of a molecular toolbox to augment the technological and gastrointestinal performance of probiotics. This has been greatly aided by studies which examine the global cellular responses to stress highlighting distinct regulatory networks and which also identify novel mechanisms used by cells to cope with hazardous environments. This review highlights the latest studies which have exploited the bacterial stress response with a view to producing next-generation probiotic cultures and highlights the significance of studies which view the global bacterial stress response from an integrative systems biology perspective.

  2. 37 CFR 202.10 - Pictorial, graphic, and sculptural works.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Pictorial, graphic, and... Pictorial, graphic, and sculptural works. (a) In order to be acceptable as a pictorial, graphic, or..., graphic, or sculptural authorship. (b) A claim to copyright cannot be registered in a print or label...

  3. 17 CFR 200.202 - Offices, and information and submittals.

    Science.gov (United States)

    2010-04-01

    ... ORGANIZATION; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Plan of Organization and Operation Effective... communications with him, by the Regional Director for the area or his acting successor. (b) During emergency conditions, all formal or informal requests, filings, reports, or other submittals shall be submitted to the...

  4. 20 CFR 718.202 - Determining the existence of pneumoconiosis.

    Science.gov (United States)

    2010-04-01

    ... diffusion. (C) Board-certified means certification in radiology or diagnostic roentgenology by the American Board of Radiology, Inc. or the American Osteopathic Association. (D) Board-eligible means the... there is other evidence of pulmonary or respiratory impairment, a Board-certified or Board-eligible...

  5. 5 CFR 950.202 - National/international eligibility requirements.

    Science.gov (United States)

    2010-01-01

    ... eligibility requirements. (a) Certify that it provides or conducts real services, benefits, assistance, or program activities, in 15 or more different states or a foreign country over the 3 year period immediately.... Postal Service, the internet, or a combination thereof. A schedule listing a detailed description of the...

  6. 38 CFR 3.202 - Evidence from foreign countries.

    Science.gov (United States)

    2010-07-01

    ..., marriage, annulment, divorce, or death, provided it bears the signature and seal of the custodian of such... birth, marriage, or death, provided it bears the signature or seal or stamp of the custodian of such...) Photocopies of original documents meeting the requirements of this section will be accepted if they satisfy...

  7. 40 CFR 246.202-3 - Recommended procedures: Market study.

    Science.gov (United States)

    2010-07-01

    ...: (a) Identifying potential purchasers of the recovered corrugated through standard market research... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended procedures: Market study...) SOLID WASTES SOURCE SEPARATION FOR MATERIALS RECOVERY GUIDELINES Requirements and Recommended Procedures...

  8. 37 CFR 202.3 - Registration of copyright.

    Science.gov (United States)

    2010-07-01

    ... ownership of all rights under the copyright initially belonging to the author. 1 1 This category includes a person or organization that has obtained, from the author or from an entity that has obtained ownership... nondramatic literary material that is in the English language, the basic application for the entire group...

  9. Laryngoscopy: appraisal of 202 procedures carried out in two ...

    African Journals Online (AJOL)

    The researchers in a profoma prepared for the study, documented all laryngoscopies done. The data collected were bio-data (age and sex), presenting symptoms/indications for the procedure, types of laryngoscopy and findings at laryngoscopy /biopsy results. The data were entered into SPSS version 14 computer software ...

  10. Dicty_cDB: VSB202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AIKARQVDEEHMISLK LKVGAEAVKAKANEIDNNLHISESAAAIKGAVVERANALDERFQISGFFKSASDMISQQA SNLMKAAEENSTVSPIVNKVSS...AIKARQVDEEHMISLK LKVGAEAVKAKANEIDNNLHISESAAAIKGAVVERANALDERFQISGFFKSASDMISQQA SNLMKAAEENSTVSPIVNKVSS

  11. Dicty_cDB: SLC202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DLYKAGEGKIGTDEKEFIKILTSRSLPHIAAVASEYIKHH KKHSLIKAIDSEFSGSIKTGLIAIVTYALNPYGYFAEILNKSMKGAGTNDNKLIRTVVTQ...DLYKAGEGKIGTDEKEFIKILTSRSLPHIAAVASEYIKHH KKHSLIKAIDSEFSGSIKTGLIAIVTYALNPYGYFAEILNKSMKGAGTNDNKLIRTVVTQ

  12. 9 CFR 202.109 - Rule 9: Depositions.

    Science.gov (United States)

    2010-01-01

    ... has a principal place of business or residence more than 100 miles from the place of the examination... third degree by blood or marriage), employee, attorney, or representative of any party (or an employee... party offering the transcript or recording has tried without success to procure the attendance of the...

  13. 24 CFR 960.202 - Tenant selection policies.

    Science.gov (United States)

    2010-04-01

    ... extremely low income families as provided in paragraph (b) of this section. (ii) Deconcentration of poverty... on the residents or the project environment; (iv) Objective and reasonable policies for selection by... occupancy during the fiscal year of PHA public housing units located in census tracts with a poverty rate of...

  14. 24 CFR 941.202 - Site and neighborhood standards.

    Science.gov (United States)

    2010-04-01

    ...) sufficient, comparable opportunities exist for housing for minority families, in the income range to be...; excessive noise vibration, vehicular traffic, rodent or vermin infestation; or fire hazards. The neighborhood must not be one which is seriously detrimental to family life or in which substandard dwellings or...

  15. Preface: phys. stat. sol. (a) 202/12

    Science.gov (United States)

    Neumann, Wolfgang; Stutzmann, Martin; Hildebrandt, Stefan

    2005-09-01

    The present special issue contains a collection of Original Papers dedicated to Professor Johannes Heydenreich on the occasion of his 75th birthday.Johannes Heydenreich, born on 20 June 1930 in Plauen/Vogtland near Dresden, studied physics at the Pädagogische Hochschule Potsdam, where he obtained his first academic degree Dipl. Phys. in 1958. He received his doctoral degree at the Martin Luther University in Halle in 1961 and the Habilitation degree in 1969. Already during his studies in Potsdam, he showed an interest in electron microscopy due to the influence of his teacher and supervisor Prof. Picht, one of the pioneers in electron optics. His interests were strengthened when Johannes Heydenreich did the experimental work for his Diploma degree at the Institute for Experimental Physics of the University of Halle, where he met Prof. Heinz Bethge for the first time. This was the beginning of a fruitful and longstanding collaboration. In 1962 Johannes Heydenreich joined the team of the later Institute for Solid State Physics and Electron Microscopy of the Academy of Sciences of the GDR, in Halle, for which the basis was laid by Prof. Bethge in 1960.Heydenreich has been working as Assistant Director for many years and played a decisive role in introducing and organising the various techniques of electron microscopy in the institute.The research activities of Prof. Heydenreich covered a broad spectrum over the years. At the beginning of his career he made significant contributions in the field of electron mirror microscopy. After that, his main interests were focused on transmission electron microscopy, ranging from diffraction contrast analysis of crystal defects to high-resolution electron microscopy and image processing. His favourite field was studies of defect-induced phenomena in advanced materials. The so-called Bethge-Heydenreich, the book Electron Microscopy in Solid State Physics, published at first in a German edition in 1982 and later in a revised English edition by Elsevier in 1987, provides an excellent overview both of Heydenreich's work and of the spectrum of the Institute of Solid State Physics and Electron Micros-copy in Halle.The international reputation of this institute was the basis for the transformation of it, after the re-unification of Germany, into the Max Planck Institute of Microstructure Physics, the first institute of the Max Planck Society in the Eastern part of Germany. From the beginning, Prof. Heydenreich was on the Board of Directors and served as the Executive Director from 1993 until his retirement in 1995.During this year, the International Centre of Advanced Materials and Electron Microscopy celebrates its 30th anniversary. The Centre was founded in Halle in 1975 as a Centre of Electron Microscopy for the Eastern countries.A remarkable and time-consuming part of Heydenreich's work was associated with this centre. Young scientists from Eastern Europe were trained in the theoretical and practical aspects of electron microscopy during the annual spring and autumn meetings. All in all, Johannes Heydenreich conducted 35 of these schools! From the beginning, he was a member of the Scientific Council of the Centre, and from 1985 until his retirement he was the Director of the Centre. Nowadays, the Centre acts as a real bridge between East and West largely due to the efforts of Johannes Heydenreich.Furthermore, Johannes Heydenreich had been active as a leading member of various scientific boards for many years. He was a co-editor of several journals covering electron microscopy, solid state physics and crystallography. As a member of the Executive Committee of the European Society for Elec-tron Microscopy (CESEM) for many years, and as a member of the Executive board of the German Soci-ety for Electron Microscopy, Johannes Heydenreich has invested a great deal of time and effort in the welfare of the scientific community.Over the course of nearly three decades, Johannes Heydenreich worked as a Professor at the Universities of Halle and Leipzig. Generations of students have admired his excellent lectures with clear repre-sentation and rigorous scholarship.The scientific work of Johannes Heydenreich was honoured by his election to the Academy of Natural Scientists Leopoldina where he worked as a Secretary of Natural Science for many years. The Technical University of Chemnitz conferred an honory doctors degree on Prof. Heydenreich in recognition of his scientific work. The German Society for Electron Microscopy awarded him Honorary Membership.Wolfgang Neumann especially acknowledges with gratitude the time of inspiring collaboration in Halle.All his friends, colleagues, and students wish him many further years of good health. The Editors of physica status solidi join these wishes and add their gratefulness for his long-standing and continuous engagement as a member of the Advisory and Editorial Board of physica status solidi (a).class="mainSectionHeader" >

  16. 41 CFR 101-39.202 - Contractor authorized services.

    Science.gov (United States)

    2010-07-01

    ... VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.2-GSA Interagency Fleet Management System Services... related GSA Interagency Fleet Management System (IFMS) services solely for official purposes. (b) To the... -leased equipment which is not controlled by a GSA IFMS fleet management center, or for authorized...

  17. Dicty_cDB: CHP202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available culus chromosome 7, clone RP23-311N3, complete sequence. 42 0.18 5 BQ507132 |BQ507132.2 EST614547 Generation...A clone cSTS16L8 5' sequence, mRNA sequence. 42 0.33 2 BQ507131 |BQ507131.1 EST614546 Generation of a set of

  18. Green Hypergolic Bipropellants: H202/Hydrogen-Rich Ionic Liquids

    Science.gov (United States)

    2011-03-04

    unsaturated salts featuring imidazolium, triazolium, pyridinium and other common IL cations, are reduced by BH4-,[6] negatively affecting their thermal...trihexyl-tetradecyl- phosphonium (THTDP) cation has been used to transform fullerenes into RTILs and forms liquids with BH3Cl-.[12, 13] THTDP Cl is also...can lead to serious injuries! General. Starting materials, trihexyltetradecyl- phosphonium chloride, sodium borohydride (≥99%), lithium borohydride

  19. 20 CFR 655.202 - Contents of job offers.

    Science.gov (United States)

    2010-04-01

    ... EMPLOYMENT OF FOREIGN WORKERS IN THE UNITED STATES Labor Certification Process for Logging Employment and Non... is offering, intends to offer, or will afford, to temporary foreign workers. Conversely, no job offer... foreign workers. For example, if the employer intends to advance transportation costs to foreign workers...

  20. Dicty_cDB: SLH202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available r of successful extensions: 0 Number of sequences better than 10.0: 0 Number of HSP's better...of Hits to DB: 0 Number of sequences better than 10.0: 0 Length of query: 182 Length of database: 101,790,75

  1. St John's House, 202 Merrion Road, Dublin 4.

    LENUS (Irish Health Repository)

    Naughton, Corina

    2012-09-19

    AIM: To evaluate the clinical appropriateness and safety of nurse and midwife prescribing practice. BACKGROUND: The number of countries introducing nurse and midwife prescribing is increasing; however, concerns over patient safety remain. DESIGN: A multi-site documentation evaluation was conducted using purposeful and random sampling. The sample included 142 patients\\' records and 208 medications prescribed by 25 Registered Nurse Prescribers. METHODS: Data were extracted from patient and prescription records between March-May 2009. Two expert reviewers applied the modified Medication Appropriate Index tool (8 criteria) to each drug. The percentage of appropriate or inappropriate responses for each criterion was reported. Reviewer concordance was measured using the Cohen\\'s kappa statistic (inter-rater reliability). RESULTS: Nurse or midwife prescribers from eight hospitals working in seventeen different areas of practice were included. The reviewers judged that 95-96% of medicines prescribed were indicated and effective for the diagnosed condition. Criteria relating to dosage, directions, drug-drugs or disease-condition interaction, and duplication of therapy were judged appropriate in 87-92% of prescriptions. Duration of therapy received the lowest value at 76%. Overall, reviewers indicated that between 69 (reviewer 2)-80% (reviewer 1) of prescribing decisions met all eight criteria. CONCLUSION: The majority of nurse and midwife prescribing decisions were deemed safe and clinically appropriate. However, risk of inappropriate prescribing with the potential for drug errors was detected. Continuing education and evaluation of prescribing practice, especially related to drug and condition interactions, is required to maximize appropriate and safe prescribing.

  2. 22 CFR 1203.735-202 - Gifts, entertainment, and favors.

    Science.gov (United States)

    2010-04-01

    ... the gift with the hope or expectation of obtaining advantage or preferment in dealing with the U.S... on a special occasion such as marriage, illness, or retirement. (f) Neither this section nor § 1203...

  3. 47 CFR 73.202 - Table of Allotments.

    Science.gov (United States)

    2010-10-01

    ... Marceline 256A Marquand 295A Moberly 223A MONTANA Bozeman *240C3 Charlo 251C3 Cut Bank 265C1 Lewistown 300C1... Sonora 237C3, 272A Spur 254A, 260C3 Stamford 233A Sweetwater 221C3 Teague 237C3 Turkey 244C2, 269A Van...

  4. Southern Forests: a Journal of Forest Science - Vol 202 (2004)

    African Journals Online (AJOL)

    Modelling maximum canopy conductance and transpiration in Eucalyptus grandis stands not subjected to soil water deficits: scientific paper · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JM Campion, PJ Dye, MC Scholes, 3-11 ...

  5. 12 CFR 202.7 - Rules concerning extensions of credit.

    Science.gov (United States)

    2010-01-01

    ... on the basis of sex, marital status, or any other prohibited basis. (b) Designation of name. A... inchoate rights, or assign earnings. (5) Additional parties. If, under a creditor's standards of creditworthiness, the personal liability of an additional party is necessary to support the credit requested, a...

  6. Laryngoscopy: appraisal of 202 procedures carried out in two ...

    African Journals Online (AJOL)

    user

    effective procedure for ascertaining the causes of laryngeal disorders, pain in the throat and difficulty in swallowing and ... version 14 computer software and analyzed descriptively. Results: There were a .... This is similar with the study done by Olaosun et al9, where preoperative assessment laryngoscopy for thyroidectomy ...

  7. 24 CFR 1003.202 - Eligible rehabilitation and preservation activities.

    Science.gov (United States)

    2010-04-01

    ... Housing and Urban Development (Continued) OFFICE OF ASSISTANT SECRETARY FOR PUBLIC AND INDIAN HOUSING, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT COMMUNITY DEVELOPMENT BLOCK GRANTS FOR INDIAN TRIBES AND ALASKA... grantee to be necessary or appropriate to achieve the grantee's community development objectives; (4...

  8. 48 CFR 811.202 - Maintenance of standardization documents.

    Science.gov (United States)

    2010-10-01

    ... 89, Subsistence, and the IMPS without prior approval from the DSPE. (4) Items of meat, cured pork and... equipment costing less than the simplified acquisition threshold. When purchasing items of perishable... the Institutional Meat Purchase Specifications (IMPS) and the IMPS General Requirements, which have...

  9. Dicty_cDB: VSD202 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KIINDFXXFTXKX*y*fpxix xxkxxxyxmxappnwkxxxrxxxrpfkxxxkxknxxxxxxnxxkixkx*kkkkqettkt...--- ---XRGLXFCRXXFXXGCWDLXFXFXKXLKKXKXXKKKKKIINDFXXFTXKX*y*fpxix xxkxxxyxmxappnwk...xxxrxxxrpfkxxxkxknxxxxxxnxxkixkx*kkkkqettktt ktknknkk*kktrt Frame B: ii*kngwi*tkmgtrfttswrfpkikic*nfnftnsrcl

  10. 5 CFR 2640.202 - Exemptions for interests in securities.

    Science.gov (United States)

    2010-01-01

    ... performed, however, the value of the employee's stock increases to $17,500. When the employee knows that the...) De minimis exemption for matters involving parties. An employee may participate in any particular... by the employee, his spouse or minor children of securities issued by one or more entities affected...

  11. 29 CFR 541.202 - Discretion and independent judgment.

    Science.gov (United States)

    2010-07-01

    ... conducting the operations of the business; whether the employee performs work that affects business... the particular employment situation in which the question arises. Factors to consider when determining... include, but are not limited to: whether the employee has authority to formulate, affect, interpret, or...

  12. 5 CFR 250.202 - Office of Personnel Management responsibilities.

    Science.gov (United States)

    2010-01-01

    ...; and (2) Prescribed metrics, as appropriate, for organizational outcomes, employee perspective, and compliance measures with respect to relevant laws, rules and regulations. (c) Together, the HCAAF and the... performance budgets prepared under OMB Circular A-11; (2) Identifying and closing competency/skill gaps in the...

  13. RCT: 2.02 Communication Systems, Course #33339

    Energy Technology Data Exchange (ETDEWEB)

    Hillmer, Kurt T. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-05-01

    This unit will present an overview of communication systems at LANL. Good communication skills are essential to an RCT. RCTs should develop an ability to communicate, using both verbal and nonverbal media. These skills will ensure that important information is transmitted to the proper individuals in a clear and concise manner.

  14. 27 CFR 20.202 - Losses in transit.

    Science.gov (United States)

    2010-04-01

    ... allowance of the entire quantity lost; or (2) If the loss was due to theft or other unlawful removal, the consignee shall file a claim for allowance of the entire quantity lost, regardless of the quantity or... the quantity actually received. (c) Claims. A claim for allowances of losses of specially denatured...

  15. 32 CFR 202.12 - Administrative support and eligible expenses.

    Science.gov (United States)

    2010-07-01

    ..., administrative expenses for a RAB shall be paid using funds from the Military Component's Environmental... funds. (3) At FUDS, administrative expenses for a RAB shall be paid using funds from the Environmental... specific and benefits the establishment and operation of a RAB. (ii) Relevant to the environmental...

  16. 42 CFR 400.202 - Definitions specific to Medicare.

    Science.gov (United States)

    2010-10-01

    .... GME stands for graduate medical education. Hospital insurance benefits means payments on behalf of... rehabilitation facility, a home health agency, or a hospice that has in effect an agreement to participate in... Retirement Act of 1974 (45 U.S.C. beginning at section 231). Services means medical care or services and...

  17. The CPAT 2.0.2 Domain Model - How CPAT 2.0.2 "Thinks" From an Analyst Perspective.

    Energy Technology Data Exchange (ETDEWEB)

    Waddell, Lucas [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Muldoon, Frank [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Melander, Darryl J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Backlund, Peter [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Henry, Stephen Michael [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Hoffman, Matthew John [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Zwerneman, April Marie [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Lawton, Craig R. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Rice, Roy Eugene [Teledyne Brown Engineering, Huntsville, AL (United States)

    2017-09-01

    To help effectively plan the management and modernization of their large and diverse fleets of vehicles, the Program Executive Office Ground Combat Systems (PEO GCS) and the Program Executive Office Combat Support and Combat Service Support (PEO CS &CSS) commissioned the development of a large - scale portfolio planning optimization tool. This software, the Capability Portfolio Analysis Tool (CPAT), creates a detailed schedule that optimally prioritizes the modernization or replacement of vehicles within the fleet - respecting numerous business rules associated with fleet structure, budgets, industrial base, research and testing, etc., while maximizing overall fleet performance through time. This report contains a description of the organizational fleet structure and a thorough explanation of the business rules that the CPAT formulation follows involving performance, scheduling, production, and budgets. This report, which is an update to the original CPAT domain model published in 2015 (SAND2015 - 4009), covers important new CPAT features. This page intentionally left blank

  18. 49 CFR 571.202 - Standard No. 202; Head restraints; Applicable at the manufacturers option until September 1, 2009.

    Science.gov (United States)

    2010-10-01

    ...) On the exterior profile of the head and torso of a dummy having the weight and seated height of a... SAE Aerospace-Automotive Drawing Standards, sec. 2.3.6, P.E1.01, September 1963. (5) Establish the... form or cylindrical head form having a 165 mm diameter in plan view and a 152 mm height in profile view...

  19. 49 CFR 571.202a - Standard No. 202a; Head restraints; Mandatory applicability begins on September 1, 2009.

    Science.gov (United States)

    2010-10-01

    ... to the seat when occupant loading is applied to the seat back, S5.2.6(a) through (e) may be performed... occurs between the back of the dummy's calves and the front of the seat cushion such that the angle... injury in rear-end and other collisions. S2. Application & incorporation by reference. S2.1Application...

  20. KN202L01: WHOI cruise 202 leg 01 aboard the R/V Knorr from 2011-07-20 - 2011-08-05 (NODC Accession 0082207)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Post-cruise download of raw data from shipboard computer(s) as furnished by the Woods Hole Oceanographic Institution Shipboard Scientific Support Group and archived...

  1. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (202-0612-272217)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  2. 40 CFR 141.202 - Tier 1 Public Notice-Form, manner, and frequency of notice.

    Science.gov (United States)

    2010-07-01

    ... learns of the violation or situation, to determine additional public notice requirements; and (3) Comply... fit the specific situation, but must be designed to reach residential, transient, and non-transient... violations or situations require a Tier 1 public notice? Table 1 of this section lists the violation...

  3. Ma et al., Afr J Tradit Complement Altern Med. (2016) 13(3):197-202 ...

    African Journals Online (AJOL)

    processing methods, utilizes sulfur dioxide generated during sulfur combustion to bleach herbs and control microorganisms, parasites and ... voucher specimens were deposited in the Technology Development Division, School of Chinese Medicine, Hong Kong Baptist ..... This compound can cause skin and eye irritation ...

  4. Page 1 S. Afr. J. Antm. Sci. 7, 201-202 (1977) High feed costs ...

    African Journals Online (AJOL)

    gesta is, however, the most important measure of its value as an animal feed. It appears tlrat in general the. IVOMD of rumen digesta obtained in thrs study was ex- ceptionally low and has therefore very iittle value as a ruminant feed. Treatment with sodium hydroxide or other chemi- cal methods may improve the digestibility ...

  5. Calibration of ground-based lidar instrument WLS7-202

    DEFF Research Database (Denmark)

    Gómez Arranz, Paula; Courtney, Michael

    This report presents the result of the lidar calibration performed for the given WLS7 Windcube at DTU’s test site for large wind turbine at Høvsøre, Denmark. Calibration is here understood as the establishment of a relation between the reference wind speed measurements with measurement uncertaint......This report presents the result of the lidar calibration performed for the given WLS7 Windcube at DTU’s test site for large wind turbine at Høvsøre, Denmark. Calibration is here understood as the establishment of a relation between the reference wind speed measurements with measurement...... uncertainties provided by measurement standard and corresponding lidar wind speed indications with associated measurement uncertainties. The lidar calibration concerns the 10 minute mean wind speed measurements. The comparison of the lidar measurements of the wind direction with that from wind vanes...

  6. 48 CFR 829.202-70 - Tax exemptions for alcohol products.

    Science.gov (United States)

    2010-10-01

    ...). The use of tax-free alcohol, whiskey, beer, wine, and denatured spirits for non-beverage purposes shall include, but is not limited to, medicinal and scientific purposes. (2) The Executive Director and... products. (a) General. (1) VA is permitted to procure spirits to be used for non-beverage purposes free of...

  7. De 1813 a 2016: 202 años de elecciones municipales

    Directory of Open Access Journals (Sweden)

    Eugenia María Zamora Chavarría

    2016-01-01

    Full Text Available A partir de la transcripción de un artículo del historiador costarricense Luis Fernando Sibaja Chacón, con ocasión del bicentenario de las elecciones municipales costarricenses, referido a las primeras elecciones populares llevadas a cabo en Costa Rica, en diciembre de 1813, por así ordenarlo la Constitución de Cádiz; este documento describe los cambios legislativos introducidos en el sistema electoral municipal desde 1998 hasta 2009, tanto en el Código Municipal como en el Código Electoral de 2009. De igual manera, resume las características de la elección municipal que se realizarán en febrero de 2016; particularmente las referidas a la participación ciudadana, al número y nivel territorial de los partidos participantes y, a sus actuales desafíos para integrar los gobiernos locales, dada la importancia del gobierno local como espacio democrático.

  8. 45 CFR 1703.202 - Provisions under which a meeting may be closed.

    Science.gov (United States)

    2010-10-01

    ...) Deprive a person of a right to a fair trial or an impartial adjudication, (iii) Constitute an unwarranted... record compiled by a criminal law enforcement authority in the course of a criminal investigation, or by... in a civil action or proceeding, an action in a foreign court or international tribunal, or an...

  9. FEW PRACTICAL ASPECTS AND PROBLEMS REGARDING LAW NR. 202/2010

    Directory of Open Access Journals (Sweden)

    ALEXANDRA CRISTINA JIPA

    2011-04-01

    Full Text Available We have analyzed the impact the introduction of art. 74¹ penal C. over a certain category of infractions, respectively over the economical nature infractions. Harmonization of such recent norms with the already existent legislative framework rises a series of questions and possible practical problems. Also, we have considered interesting to appreciate if such changes are sufficient or there is not a conflict between the punishments set forth by regulators for each of such infractions. Should the answer be yes, there should be considered the possible conciliation methods.

  10. Spinal Metastases Due to Thyroid Carcinoma : An Analysis of 202 Patients

    NARCIS (Netherlands)

    Kushchayeva, Yevgeniya S.; Kushchayev, Sergiy V.; Carroll, Nancy M.; Felger, Erin A.; Links, Thera P.; Teytelboym, Oleg M.; Bonichon, Francoise; Preul, Mark C.; Sonntag, Volker K. H.; Van Nostrand, Douglas; Burman, Kenneth D.; Boyle, Lisa M.

    2014-01-01

    Background: Spinal metastases (SMs) due to thyroid cancer (TC) are associated with significantly reduced quality of life. The goal of this study is to analyze the clinical manifestations, presentation, and treatments of TC SMs, and to describe specific features of SMs associated with different TC

  11. 17 CFR 202.9 - Small entity enforcement penalty reduction policy.

    Science.gov (United States)

    2010-04-01

    ... business or small organization as defined by Commission rules adopted for the purpose of compliance with... Commission other than civil money penalties, whether or not such other remedy may be characterized as penal...

  12. 7 CFR 1744.202 - Borrowers may make qualified investments without prior approval of the Administrator.

    Science.gov (United States)

    2010-01-01

    ... exceeds the minimum total assets ratio may make a qualified investment, defined in paragraph (b) of this... financial return accruing to such investment, or the borrower's proportionate share of such return; (2... title to any asset acquired with such investment, or the borrower's proportionate share of such title...

  13. 24 CFR 30.45 - Multifamily and section 202 or 811 mortgagors.

    Science.gov (United States)

    2010-04-01

    ... only: (1) Agent employed to manage the property that has an identity of interest and identity of... control. (2) Effective control. The ability to direct, alter, supervise, or otherwise influence the... individual corporation; company; association; partnership; authority; firm; society; trust; state, local...

  14. CALIPSO Lidar L2 Aerosol Layer Data V2-02

    Data.gov (United States)

    National Aeronautics and Space Administration — Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observations (CALIPSO) was launched on April 28, 2006 to study the impact of clouds and aerosols on the Earth’s...

  15. CALIPSO Lidar L2 5 km Cloud Profile Data V2-02

    Data.gov (United States)

    National Aeronautics and Space Administration — Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observations (CALIPSO) was launched on April 28, 2006 to study the impact of clouds and aerosols on the Earth’s...

  16. 48 CFR 19.202-1 - Encouraging small business participation in acquisitions.

    Science.gov (United States)

    2010-10-01

    ... construction and seeks to package or consolidate discrete construction projects and the magnitude of this... construction project cannot be acquired as separate discrete projects; or (v) Bundling is necessary and justified. (3) The 30-day notification process shall occur concurrently with other processing steps required...

  17. SU-C-202-01: Incorporating Time-Dependent Hypoxia in IMRT Planning

    Energy Technology Data Exchange (ETDEWEB)

    Roy, A [Bowling Green State University, Bowling Green, OH (United States); Nohadani, O [Northwestern University Evanston, IL (United States)

    2016-06-15

    Purpose: To incorporate uncertainties in oxygenation of tumor cells into radiation therapy planning via robust optimization. The model is demonstrated using a clinical prostate cancer case. Methods: The tumor oxygenation levels are determined based on pre- and mid-treatment PET scans. To account for oxygenation changes, we use a radio-sensitivity factor for the effective dose necessary to treat hypoxic cells. Due to the unpredictable nature of re-oxygenation of hypoxic cells, the radio-sensitivity factor and its change is modeled to reside in a time-dependent uncertainty set. This uncertainty can adapt to both pre- and mid-treatment scans, resulting in a two-stage robust treatment planning model. We develop a robust counterpart reformulation that transforms the original NP-hard problem into a linear program consisting of finitely many linear constraints, which can be solved efficiently. Results: The robust plan is compared to both the corresponding fractionated plan which ignores hypoxia, and to the commonly practiced dose-escalated plan that uniformly increases dose based on initial oxygen concentrations. For PTV, the robust plan improves D{sub 50}, D{sub 95}, and EUD by 4% on average compared to fractionated, and by 11% compared to the optimal escalated plan. Moreover, the robust plan spared organs at risk similar to the fractionated plan, while the escalated plan led to over 170% increase of Bladder D{sub 30}. Conclusion: The proposed robust adaptive model can improve tumor coverage by increasing dose to hypoxic tumor voxels that is overlooked by common fractionated treatments. In addition, the robust model anticipates the re-oxygenation process, thus reducing the excess dose at later fractions in comparison to uniform dose-escalation methods.

  18. 47 CFR 54.202 - Additional requirements for Commission designation of eligible telecommunications carriers.

    Science.gov (United States)

    2010-10-01

    ...-mounted antenna or other equipment; (3) Adjusting the nearest cell tower; (4) Adjusting network or...) Employing, leasing or constructing an additional cell site, cell extender, repeater, or other similar...

  19. Patient Perception of Imiquimod Treatment for Actinic Keratosis and Superficial Basal Cell Carcinoma in 202 Patients

    NARCIS (Netherlands)

    Waalboer-Spuij, Rick; Holterhues, Cynthia; van Hattem, Simone; Schuttelaar, Marie Louise A.; Gaastra, Menno T. W.; Kuijpers, Danielle I. M.; Hollestein, Loes M.; Nijsten, Tamar E. C.

    2015-01-01

    Objective: To document the impact on patient-reported outcomes and health-related quality of life (HRQoL) of treatment with imiquimod cream in patients with actinic keratosis (AK) and superficial basal cell carcinoma (sBCC). Methods: This open-label, multicenter study included AK and sBCC patients

  20. Lutein and zeaxanthin supplementation reduces H202-induced oxidative damage in human lens epithelial cells

    Science.gov (United States)

    Purpose: Epidemiological studies suggest that dietary intake of lutein and zeaxanthin is inversely related to the risk for senile cataract. The objectives of this work were to investigate the mechanisms by which these nutrients provide anti-cataract effects. We evaluated their modulation of oxid...

  1. 7 CFR 718.202 - Determining the land constituting a farm.

    Science.gov (United States)

    2010-01-01

    ..., DEPARTMENT OF AGRICULTURE FARM MARKETING QUOTAS, ACREAGE ALLOTMENTS, AND PRODUCTION ADJUSTMENT PROVISIONS... responsible for the minor child, unless the parent or guardian has no interest in the minor's farm or...

  2. 37 CFR 202.21 - Deposit of identifying material instead of copies.

    Science.gov (United States)

    2010-07-01

    ... unpublished work that is fixed, or a published work that is published, only as embodied in a soundtrack that... the title of the motion picture, the soundtrack credits, and the copyright notice for the soundtrack... cassette or other phonorecord reproducing the entire soundtrack or other sound portion of the motion...

  3. Risk Factors for Complications after Peripheral Vascular Surgery in 3,202 Patient Procedures

    DEFF Research Database (Denmark)

    Kehlet, Mette; Jensen, Leif Panduro; Schroeder, Torben V.

    2016-01-01

    with postoperative complications after open vascular surgery for infrainguinal occlusive disease in an 8-year cohort using the Danish National Vascular Registry (Karbase), which gathers information on all vascular procedures in Denmark. Methods This study is a retrospective cohort study. The Karbase was searched...... for the predefined procedures from January 1, 2005 through December 31, 2012 at our 2 vascular departments. Both elective and urgent surgeries were included. Complications were defined as wound, surgical, or general complication according to Karbase. Results Three thousand two hundred two procedures were identified......, high American Society of Anesthesiologists score, and general anesthetics. The 30-day mortality was 5% (1% for claudicants and 8% for acute ischemia) and the 30-day amputation rate was 7% (0.5% for claudicants and 21% for gangrene). Conclusions There is a high risk of complication in peripheral...

  4. 50 CFR 226.202 - Critical habitat for Stellar sea lions.

    Science.gov (United States)

    2010-10-01

    ... in Alaska. Three special aquatic foraging areas in Alaska, including the Shelikof Strait area, the Bogoslof area, and the Seguam Pass area. (1) Critical habitat includes the Shelikof Strait area in the Gulf... Bering Sea shelf and consists of the area between 170°00′W and 164°00′W, south of straight lines...

  5. CALIPSO Imaging Infrared Radiometer L2 Data Swath V2-02

    Data.gov (United States)

    National Aeronautics and Space Administration — Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observations (CALIPSO) was launched on April 28, 2006 to study the impact of clouds and aerosols on the Earth’s...

  6. MO-DE-202-01: Image-Guided Focused Ultrasound Surgery and Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Farahani, K. [National Cancer Institute (United States)

    2016-06-15

    At least three major trends in surgical intervention have emerged over the last decade: a move toward more minimally invasive (or non-invasive) approach to the surgical target; the development of high-precision treatment delivery techniques; and the increasing role of multi-modality intraoperative imaging in support of such procedures. This symposium includes invited presentations on recent advances in each of these areas and the emerging role for medical physics research in the development and translation of high-precision interventional techniques. The four speakers are: Keyvan Farahani, “Image-guided focused ultrasound surgery and therapy” Jeffrey H. Siewerdsen, “Advances in image registration and reconstruction for image-guided neurosurgery” Tina Kapur, “Image-guided surgery and interventions in the advanced multimodality image-guided operating (AMIGO) suite” Raj Shekhar, “Multimodality image-guided interventions: Multimodality for the rest of us” Learning Objectives: Understand the principles and applications of HIFU in surgical ablation. Learn about recent advances in 3D–2D and 3D deformable image registration in support of surgical safety and precision. Learn about recent advances in model-based 3D image reconstruction in application to intraoperative 3D imaging. Understand the multi-modality imaging technologies and clinical applications investigated in the AMIGO suite. Understand the emerging need and techniques to implement multi-modality image guidance in surgical applications such as neurosurgery, orthopaedic surgery, vascular surgery, and interventional radiology. Research supported by the NIH and Siemens Healthcare.; J. Siewerdsen; Grant Support - National Institutes of Health; Grant Support - Siemens Healthcare; Grant Support - Carestream Health; Advisory Board - Carestream Health; Licensing Agreement - Carestream Health; Licensing Agreement - Elekta Oncology.; T. Kapur, P41EB015898; R. Shekhar, Funding: R42CA137886 and R41CA192504 Disclosure and CoI: IGI Technologies, small-business partner on the grants.

  7. 7 CFR 59.202 - Mandatory daily reporting for barrows and gilts.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Mandatory daily reporting for barrows and gilts. 59... gilts. (a) Prior day report. The corporate officers or officially designated representatives of each packer that processes barrows and gilts shall report to the Secretary for each business day of the packer...

  8. 17 CFR 202.12 - Policy statement concerning cooperation by individuals in its investigations and related...

    Science.gov (United States)

    2010-04-01

    ..., among other things: (1) The value of the individual's cooperation to the Investigation including, but... violations and in the context of the individual's knowledge, education, training, experience, and position of... nor are they intended to be all-inclusive or to require a specific determination in any particular...

  9. 37 CFR 202.22 - Acquisition and deposit of unpublished audio and audiovisual transmission programs.

    Science.gov (United States)

    2010-07-01

    ... under the general authority of the Librarian of Congress, may make a fixation of an unpublished audio or... phonorecord; (iii) A ninety-day deadline by which time either compliance or a request for an extension of a... allow such extension or adjustments shall be made by the Register of Copyrights after consultation with...

  10. 77 FR 202 - Federal Acquisition Regulation; Updated Financial Accounting Standards Board Accounting References

    Science.gov (United States)

    2012-01-03

    ... 9000-AM00 Federal Acquisition Regulation; Updated Financial Accounting Standards Board Accounting... accounting standards owing to the Financial Accounting Standards Board's Accounting Standards Codification of Generally Accepted Accounting Principles. DATES: Effective Date: February 2, 2012. FOR FURTHER INFORMATION...

  11. 46 CFR 117.202 - Survival craft-vessels operating on oceans routes.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-vessels operating on oceans routes. 117... operating on oceans routes. (a) Except as allowed by paragraph (b) of this section, each vessel certificated to operate on an oceans route in cold water must be provided with inflatable liferafts of an...

  12. 46 CFR 308.202 - Issuance of interim binder; terms and conditions.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Issuance of interim binder; terms and conditions. 308... binder; terms and conditions. Upon acceptance of an application, an interim binder in form as set forth... forth in § 308.207) to the same extent as if such application and policy were made a part of the binder...

  13. Page 1 S. Afr. J. Antm. Sci. 7, 201-202 (1977) High feed costs ...

    African Journals Online (AJOL)

    can be alleviated by the utilization of various waste materials or by-products such as poultry manure (Oltjen. & Dinius, 1976) and feedlot and/or animal waste (Hull,. Raguse, Morris & Delmas, l9l4). The gut contents of cattle also fall in this latter category. No information could, however, be found in the available literature on.

  14. Ce que nous faisons | Page 202 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Facteurs à l'origine d'une croissance non solidaire. Le progrès économique dans les pays en développement et les pays émergents est marqué, mais il reste de grands défis à relever, en particulier dans les pays où une grande partie de la population n'a pas bénéficié de la croissance rapide.

  15. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (202-0612-332211)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  16. 5 CFR 412.202 - Systematic training and development of supervisors, managers, and executives.

    Science.gov (United States)

    2010-01-01

    ... employees; (2) Improve employee performance and productivity; (3) Conduct employee performance appraisals in accordance with agency appraisal systems; and (4) Identify and assist employees with unacceptable performance... and implement leadership development programs integrated with the employee development plans, programs...

  17. 49 CFR 172.202 - Description of hazardous material on shipping papers.

    Science.gov (United States)

    2010-10-01

    ...., 1 L (0.3 gallons) equals 1 kg (2.2 pounds); (iii) For dangerous goods in machinery or apparatus, the individual total quantities or an estimate of the individual total quantities of dangerous goods in solid, liquid or gaseous state, contained in the article must be shown; (iv) For dangerous goods transported in...

  18. 48 CFR 1419.202-70 - Acquisition screening and BUDS recommendations.

    Science.gov (United States)

    2010-10-01

    ...) program shall be resolved by the BPC. The BPC shall annotate the resolution, with signature, in the “Notes” section of the form. The BPC may consult with the OSDBU to obtain assistance in resolving the disagreement. ...

  19. 40 CFR 246.202-4 - Recommended procedures: Methods of separation and storage.

    Science.gov (United States)

    2010-07-01

    ... placed in balers and compacted into bales. These bales may be stored inside or outside of the facility. The bales should be protected from fire, inclement weather, theft, and vandalism. (b) Stationary...

  20. 9 CFR 205.202 - “Effective financing statement” or EFS.

    Science.gov (United States)

    2010-01-01

    ... separate document meeting the definition in (c)(4). Note that (c)(4) contains a comprehensive definition of... applicable State law under provisions of the Uniform Commercial Code or may be a paper document. An electronically filed EFS need not be a paper document and need not be signed. If an original or reproduced paper...

  1. 29 CFR 1952.202 - Completion of developmental steps and certification.

    Science.gov (United States)

    2010-07-01

    ... safety and health personnel were retrained during March-May 1973. (d) Training sessions for public... of § 1952.10, the Minnesota State poster was approved by the Assistant Secretary on March 7, 1975. (b.... (k) The State poster approved on March 25, 1975 (40 FR 13211) which was revised in response to...

  2. Ce que nous faisons | Page 202 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI finance des études de recherche dans les pays en voie de développement en vue de produire un changement durable à grande échelle. Pour que le savoir devienne un outil permettant de résoudre des problèmes urgents :

  3. 31 CFR 539.202 - Prohibition on import-related transactions.

    Science.gov (United States)

    2010-07-01

    ... authorized, no United States person may finance, act as broker for, transfer, transport, or otherwise participate in the importation into the United States on or after the effective date of any goods, technology...

  4. 20 CFR 25.202 - How is the Special Schedule applied for Japanese seamen?

    Science.gov (United States)

    2010-04-01

    ... grandchildren. (g) Burial allowance. $1,000 payable to the eligible survivor(s), regardless of actual expenses... children under 21 who lived with or were dependent upon the employee. (3) Adult children who were dependent...

  5. 76 FR 202 - Self-Regulatory Organizations; National Futures Association; Notice of Filing and Immediate...

    Science.gov (United States)

    2011-01-03

    ... proposed rule change with the Commodity Futures Trading Commission (``CFTC''). \\1\\ 15 U.S.C. 78s(b)(7). \\2...'') and commodity trading advisors (``CTAs'') in a manner more consistent with the nature of their... the approach taken by the Board in 2008 to deal with changes to the enhanced ANC provision for Forex...

  6. 20 CFR 726.202 - Who may underwrite an operator's liability.

    Science.gov (United States)

    2010-04-01

    ... of benefits as required by the Act with any stock company or mutual company or association, or with any other person, or fund, including any State fund while such company, association, person, or fund is authorized under the law of any State to insure workmen's compensation. ...

  7. 17 CFR 275.202(a)(11)-1 - Certain broker-dealers.

    Science.gov (United States)

    2010-04-01

    ... interest. We are paid both by you and, sometimes, by people who compensate us based on what you buy. Therefore, our profits, and our salespersons' compensation, may vary by product and over time.” The... provides advice that is not solely incidental to the conduct of its business as a broker or dealer within...

  8. 37 CFR 202.19 - Deposit of published copies or phonorecords for the Library of Congress.

    Science.gov (United States)

    2010-07-01

    .... (3) The terms architectural works, copies, collective work, device, fixed, literary work, machine, motion picture, phonorecord, publication, sound recording, useful article, and their variant forms, have... authors. (4) Literary, dramatic, and musical works published only as embodied in phonorecords. This...

  9. 37 CFR 202.20 - Deposit of copies and phonorecords for copyright registration.

    Science.gov (United States)

    2010-07-01

    ... defects or distortions. (3) The terms architectural works, copy, collective work, device, fixed, literary... useful article, and their variant forms, have the meanings given to them in 17 U.S.C. 101. (4) A secure... identifying material under paragraph (c)(2)(xi)(B)(5) of this section; (H) Literary, dramatic, and musical...

  10. 48 CFR 27.202-5 - Solicitation provisions and contract clause.

    Science.gov (United States)

    2010-10-01

    ... pricing data are obtained under 15.403; or (ii) Sealed bid solicitations only if the need for such... ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Patents and Copyrights...

  11. 40 CFR 161.202 - Purposes of the registration data requirements.

    Science.gov (United States)

    2010-07-01

    ... chemistry. (1) Residue Chemistry Data are used by the Agency to estimate the exposure of the general...) Residue chemistry data are also needed to support the adequacy of one or more methods for the enforcement... water resources. (6) Accumulation studies. Accumulation studies indicate pesticide residue levels in...

  12. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  13. δ37Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.

  14. δ³⁷Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine

  15. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  16. A Phase 1/2 Study Exploring the Safety, Tolerability, and Efficacy of Pembrolizumab (MK-3475) in Combination With Epacadostat (INCB024360) in Subjects With Selected Cancers (INCB 24360-202 / MK-3475-037 / KEYNOTE-037/ ECHO-202)

    Science.gov (United States)

    2017-06-20

    Malignant Solid Tumor; Lymphoma, Large B-Cell, Diffuse; Carcinoma, Non-Small-Cell Lung; Transitional Cell Carcinoma of Urinary Tract; Triple Negative Breast Cancer; Carcinoma, Squamous Cell of Head and Neck; Ovarian Neoplasms; Adenocarcinoma of the Endometrium; Renal Cell Carcinoma; Microsatellite-instability (MSI) High Colorectal Cancer; Gastric Cancer; Hepatocellular Carcinoma

  17. 40 CFR 33.202 - How does an entity qualify as an MBE or WBE under EPA's 8% statute?

    Science.gov (United States)

    2010-07-01

    ... person who has been subjected to racial or ethnic prejudice or cultural bias because of his or her identity as a member of a group without regard to his or her individual qualities and as further defined by the implementing regulations of section 8(a)(5) of the Small Business Act (15 U.S.C. 637(a)(5); 13 CFR...

  18. WE-AB-202-01: Evaluating the Toxicity Reduction with CT-Ventilation Functional Avoidance Radiation Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Vinogradskiy, Y [University of Colorado Denver, Aurora, CO (United States); Miyasaka, Y; Kadoya, N [Tohoku University Graduate School of Medicine, Sendal, Miyagi (Japan); Castillo, R [University Texas Medical Branch of Galveston, League City, TX (United States); Castillo, E; Guerrero, T [Beaumont Health System, Royal Oak, MI (United States); Yamamoto, T [UC Davis School of Medicine, Sacramento, CA (United States)

    2016-06-15

    Purpose: CT-ventilation is an exciting new imaging modality that uses 4DCTs to calculate lung ventilation. Studies have proposed to use 4DCT-ventilation imaging for functional avoidance radiotherapy which implies designing treatment plans to spare functional portions of the lung. Although retrospective studies have been performed to evaluate the dosimetric gains to functional lung; no work has been done to translate the dosimetric gains to an improvement in pulmonary toxicity. The purpose of our work was to evaluate the potential reduction in toxicity for 4DCT-ventilation based functional avoidance. Methods: 70 lung cancer patients with 4DCT imaging were used for the study. CT-ventilation maps were calculated using the patient’s 4DCT, deformable image registrations, and a density-change-based algorithm. Radiation pneumonitis was graded using imaging and clinical information. Log-likelihood methods were used to fit a normal-tissue-complication-probability (NTCP) model predicting grade 2+ radiation pneumonitis as a function of doses (mean and V20) to functional lung (>15% ventilation). For 20 patients a functional plan was generated that reduced dose to functional lung while meeting RTOG 0617-based constraints. The NTCP model was applied to the functional plan to determine the reduction in toxicity with functional planning Results: The mean dose to functional lung was 16.8 and 17.7 Gy with the functional and clinical plans respectively. The corresponding grade 2+ pneumonitis probability was 26.9% with the clinically-used plan and 24.6% with the functional plan (8.5% reduction). The V20-based grade 2+ pneumonitis probability was 23.7% with the clinically-used plan and reduced to 19.6% with the functional plan (20.9% reduction). Conclusion: Our results revealed a reduction of 9–20% in complication probability with functional planning. To our knowledge this is the first study to apply complication probability to convert dosimetric results to toxicity improvement. The results presented in the current work provide seminal data for prospective clinical trials in functional avoidance. YV discloses funding from State of Colorado. TY discloses National Lung Cancer Partnership; Young Investigator Research grant.

  19. 48 CFR 619.202-70 - The Department of State Mentor-Protégé Program.

    Science.gov (United States)

    2010-10-01

    ... include: (1) Management guidance relating to: (i) Financial management; (ii) Organizational management; (iii) Overall business management/planning; (iv) Business development; and, (v) Technical assistance...

  20. Oahu Hyperspectral Imagery 2000 (202-0612-332211) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  1. 76 FR 63169 - Airworthiness Directives; Bombardier Inc. Model DHC-8-102, -103, -106, -201, -202, -301, -311...

    Science.gov (United States)

    2011-10-12

    ...] directive is issued to require rework of the cockpit door striker plate and replacement of the latch block... AD rework the cockpit door striker plate and replace the latch block, in accordance with the... doing the modification required in paragraph (g) of this AD, rework the cockpit door striker plate and...

  2. 76 FR 33173 - Airworthiness Directives; Bombardier Inc. Model DHC-8-102, -103, -106, -201, -202, -301, -311...

    Science.gov (United States)

    2011-06-08

    ..., * * * this directive is issued to require rework of the cockpit door striker plate and replacement of the... cockpit door striker plate and replace the latch block, in accordance with the Accomplishment Instructions... modification required in paragraph (g) of this AD, rework the cockpit door striker plate and replace the latch...

  3. 20 CFR 802.202 - Appearances by attorneys and other authorized persons; denial or authority to appear.

    Science.gov (United States)

    2010-04-01

    ..., telephone number, general education, any special training or experience in claims representation, and such... inquiry as to the qualification or ability of such person to render assistance. In the event of a failure...

  4. Hanford Tanks 241-C-202 and 241-C-203 Residual Waste Contaminant Release Models and Supporting Data

    Energy Technology Data Exchange (ETDEWEB)

    Deutsch, William J.; Krupka, Kenneth M.; Lindberg, Michael J.; Cantrell, Kirk J.; Brown, Christopher F.; Mattigod, Shas V.; Schaef, Herbert T.; Arey, Bruce W.

    2007-09-13

    As directed by Congress, the U. S. Department of Energy (DOE) established the Office of River Protection in 1998 to manage DOE's largest, most complex environmental cleanup project – retrieval of radioactive waste from Hanford tanks for treatment and eventual disposal. Sixty percent by volume of the nation's high-level radioactive waste is stored at Hanford in aging deteriorating tanks. If not cleaned up, this waste is a threat to the Columbia River and the Pacific Northwest. CH2M Hill Hanford Group, Inc., is the Office of River Protection's prime contractor responsible for the storage, retrieval, and disposal of Hanford's tank waste. As part of this effort, CH2M HILL Hanford Group, Inc. contracted with Pacific Northwest National Laboratory (PNNL) to develop release models for key contaminants that are present in residual sludge remaining after closure of Hanford Tanks 241-C-203 (C-203) and 241-C-204 (C-204). The release models were developed from data generated by laboratory characterization and testing of samples from these two tanks. These release models are being developed to support the tank closure risk assessments performed by CH2M HILL Hanford Group, Inc., for DOE.

  5. CALiPER Report 20.2: Dimming, Flicker, and Power Quality Characteristics of LED PAR38 Lamps

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2014-03-31

    This report focuses on the flicker and power quality performance of the Series 20 lamps at full output and various dimmed levels. All of the Series 20 PAR38 lamps that manufacturers claimed to be dimmable (including all halogen lamps) were evaluated individually (one lamp at a time) both on a switch and under the control of a phase-cut dimmer designed for use with "all classes of bulbs." Measurements of luminous flux, flicker, and power quality were taken at 10 target dimmed settings and compared with operation on a switch. Because only a single unit of each product was evaluated on a single dimmer that may or may not have been recommended by its manufacturer, this report focuses on the performance of the products relative to each other, rather than the best-case performance of each lamp or variation in performance delivered from each lamp. Despite these limitations, the results suggest that LED performance is improving, and performance trends are beginning to emerge, perhaps due in part to the identification of preferred LED driver strategies for lamp products.

  6. WE-AB-202-02: Incorporating Regional Ventilation Function in Predicting Radiation Fibrosis After Concurrent Chemoradiotherapy for Lung Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Lan, F; Jeudy, J; Tseng, H; Zhou, J; D’Souza, W; Zhang, H [University of Maryland, Baltimore, MD (United States); Senan, S; Sornsen de Koste, J van [VU University Medical Center, Amsterdam (Netherlands)

    2016-06-15

    Purpose: To investigate the incorporation of pre-therapy regional ventilation function in predicting radiation fibrosis (RF) in stage III non-small-cell lung cancer (NSCLC) patients treated with concurrent thoracic chemoradiotherapy. Methods: 37 stage III NSCLC patients were retrospectively studied. Patients received one cycle of cisplatin-gemcitabine, followed by two to three cycles of cisplatin-etoposide concurrently with involved-field thoracic radiotherapy between 46 and 66 Gy (2 Gy per fraction). Pre-therapy regional ventilation images of the lung were derived from 4DCT via a density-change-based image registration algorithm with mass correction. RF was evaluated at 6-months post-treatment using radiographic scoring based on airway dilation and volume loss. Three types of ipsilateral lung metrics were studied: (1) conventional dose-volume metrics (V20, V30, V40, and mean-lung-dose (MLD)), (2) dose-function metrics (fV20, fV30, fV40, and functional mean-lung-dose (fMLD) generated by combining regional ventilation and dose), and (3) dose-subvolume metrics (sV20, sV30, sV40, and subvolume mean-lung-dose (sMLD) defined as the dose-volume metrics computed on the sub-volume of the lung with at least 60% of the quantified maximum ventilation status). Receiver operating characteristic (ROC) curve analysis and logistic regression analysis were used to evaluate the predictability of these metrics for RF. Results: In predicting airway dilation, the area under the ROC curve (AUC) values for (V20, MLD), (fV20, fMLD), and (sV20, and sMLD) were (0.76, 0.70), (0.80, 0.74) and (0.82, 0.80), respectively. The logistic regression p-values were (0.09, 0.18), (0.02, 0.05) and (0.004, 0.006), respectively. With regard to volume loss, the corresponding AUC values for these metrics were (0.66, 0.57), (0.67, 0.61) and (0.71, 0.69), and p-values were (0.95, 0.90), (0.43, 0.64) and (0.08, 0.12), respectively. Conclusion: The inclusion of regional ventilation function improved predictability of radiation fibrosis. Dose-subvolume metrics provided a promising method for incorporating functional information into the conventional dose-volume parameters for outcome assessment.

  7. SU-E-J-202: Performance of the Patient QA Systems in a Hybrid MRI-Linac

    Energy Technology Data Exchange (ETDEWEB)

    Houweling, A; Vries, W de; Wolthaus, J; Woodings, S; Asselen, B van; Kok, J; Lagendijk, J; Raaymakers, B [University Medical Center Utrecht, Utrecht (Netherlands)

    2015-06-15

    Purpose: The first clinical MR-linac will soon become operational, therefore patient plan QA procedures and equipment have to become MRcompatible. Reference dosimetry is affected by the magnetic field, however, relative dosimetry using patient QA systems haven’t been investigated extensively. The purpose of this study was to examine the performance characteristics of the MR-compatible ArcCHECK and Delta4 systems in a transverse 1.5 T magnetic field. Methods: Recently MR-compatible versions of both ArcCheck (Sun Nuclear) and Delta4 (Scandidos) have been developed. To examine the performance characteristics within the magnetic field, the reproducibility, dose linearity, dose rate dependence, field size and angular dependence were evaluated on the MR-linac (8 MV FFF beam, SAD of 142 cm) and a conventional linac (Elekta, 6MV). To allow comparison of the measurements with and without magnetic field, the measurement setup for the conventional linac is adapted to mimic the setup at the MR-linac if possible (e.g. SAD, dose rate). The results from the MR-linac were benchmarked to the results from the conventional linac as being the clinical reference. Results: At the moment of writing, measurements for the Delta4 are still running. Therefore, only the results of the ArcCheck are presented in this abstract. No significant difference was observed in the reproducibility of the ArcCheck (<0.06%) between both linacs. The maximum dose response difference when measuring the dose linearity was less than 0.4% and the varying dose rate resulted in maximal dose differences of 1.0% for both linacs. Response variation for varying field sizes was <2.6% at the conventional linac, and <1.0% at the MR-linac. Angular response was similar for both linacs. Conclusion: The reproducibility, dose linearity, dose rate dependence, field size and angular dependence of the MR compatible ArcCheck were not influenced by the presence of a transverse 1.5 T magnetic field. The results for the Delta4 are about to follow. Equipment is generously provided by Sun Nuclear Corporation (Melbourne, USA) and Scandidos (Uppsala, Sweden)

  8. 78 FR 39003 - 60-Day Notice of Proposed Information Collection: Section 202 Supportive Housing for the Elderly...

    Science.gov (United States)

    2013-06-28

    ... the Elderly Application Submission Requirements AGENCY: Multifamily Housing Program, Office of Housing... Supportive Housing for the Elderly Application Submission Requirements. OMB Approval Number: 2502-0267. Type... Department to assist HUD in determining applicant eligibility and ability to develop housing for the elderly...

  9. 9 CFR 93.202 - Inspection of certain aircraft and other means of conveyance and shipping containers thereon...

    Science.gov (United States)

    2010-01-01

    ... IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS... contaminated with material of animal (including poultry) origin, such as, but not limited to, meat, organs...

  10. Ann Crabbé and Pieter Leroy, 2008, The Handbook of Environmental Policy Evaluation, Earthscan, London, 202 p.

    Directory of Open Access Journals (Sweden)

    François Destandau

    2010-09-01

    Full Text Available Ann Crabbé de l’Université d’Anvers (Belgique et Pieter Leroy de l’Université de Nijmegen (Pays-Bas proposent ici un ouvrage pionnier sur l’évaluation appliquée aux politiques environnementales. Ce manuel s’inspire des enseignements théoriques et méthodologiques des sciences politiques et sociales. Les auteurs y présentent un panel de méthodes adaptées aux politiques environnementales, de façon pratique et accessible. « Peut-on identifier une relation de causalité entre l’intervention polit...

  11. 7 CFR 1728.202 - RUS Bulletin 1728H-702, RUS Specification for Quality Control and Inspection of Timber Products.

    Science.gov (United States)

    2010-01-01

    ... Preserving Plants. (xvii) M4-91, Standard for the Care of Preservative-Treated Wood Products. (xviii) P1/P13...) P9-91, Standards for Solvents for Organic Preservative Systems. (2) American Institute of Timber... section. (6) Laminated materials for use on RUS borrower systems shall follow manufacturing and quality...

  12. 42 CFR 413.202 - Organ procurement organization (OPO) cost for kidneys sent to foreign countries or transplanted...

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Organ procurement organization (OPO) cost for... (OPO) cost for kidneys sent to foreign countries or transplanted in patients other than Medicare beneficiaries. An OPO's total costs for all kidneys is reduced by the costs associated with procuring kidneys...

  13. 75 FR 4477 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, -243, -301, -302, -303, -321...

    Science.gov (United States)

    2010-01-28

    ... and, in case deformation or damage is detected, to apply the associated repair. The one-time...-time detailed inspections of both main landing gear bogie beams in the region of the bogie stop pad for...], the bogie stop pad was found deformed and cracked. Upon removal of the bogie stop pad for replacement...

  14. MO-DE-202-04: Multimodality Image-Guided Surgery and Intervention: For the Rest of Us

    Energy Technology Data Exchange (ETDEWEB)

    Shekhar, R. [Children’s National Health System (United States)

    2016-06-15

    At least three major trends in surgical intervention have emerged over the last decade: a move toward more minimally invasive (or non-invasive) approach to the surgical target; the development of high-precision treatment delivery techniques; and the increasing role of multi-modality intraoperative imaging in support of such procedures. This symposium includes invited presentations on recent advances in each of these areas and the emerging role for medical physics research in the development and translation of high-precision interventional techniques. The four speakers are: Keyvan Farahani, “Image-guided focused ultrasound surgery and therapy” Jeffrey H. Siewerdsen, “Advances in image registration and reconstruction for image-guided neurosurgery” Tina Kapur, “Image-guided surgery and interventions in the advanced multimodality image-guided operating (AMIGO) suite” Raj Shekhar, “Multimodality image-guided interventions: Multimodality for the rest of us” Learning Objectives: Understand the principles and applications of HIFU in surgical ablation. Learn about recent advances in 3D–2D and 3D deformable image registration in support of surgical safety and precision. Learn about recent advances in model-based 3D image reconstruction in application to intraoperative 3D imaging. Understand the multi-modality imaging technologies and clinical applications investigated in the AMIGO suite. Understand the emerging need and techniques to implement multi-modality image guidance in surgical applications such as neurosurgery, orthopaedic surgery, vascular surgery, and interventional radiology. Research supported by the NIH and Siemens Healthcare.; J. Siewerdsen; Grant Support - National Institutes of Health; Grant Support - Siemens Healthcare; Grant Support - Carestream Health; Advisory Board - Carestream Health; Licensing Agreement - Carestream Health; Licensing Agreement - Elekta Oncology.; T. Kapur, P41EB015898; R. Shekhar, Funding: R42CA137886 and R41CA192504 Disclosure and CoI: IGI Technologies, small-business partner on the grants.

  15. MO-DE-202-02: Advances in Image Registration and Reconstruction for Image-Guided Neurosurgery

    Energy Technology Data Exchange (ETDEWEB)

    Siewerdsen, J. [Johns Hopkins University (United States)

    2016-06-15

    At least three major trends in surgical intervention have emerged over the last decade: a move toward more minimally invasive (or non-invasive) approach to the surgical target; the development of high-precision treatment delivery techniques; and the increasing role of multi-modality intraoperative imaging in support of such procedures. This symposium includes invited presentations on recent advances in each of these areas and the emerging role for medical physics research in the development and translation of high-precision interventional techniques. The four speakers are: Keyvan Farahani, “Image-guided focused ultrasound surgery and therapy” Jeffrey H. Siewerdsen, “Advances in image registration and reconstruction for image-guided neurosurgery” Tina Kapur, “Image-guided surgery and interventions in the advanced multimodality image-guided operating (AMIGO) suite” Raj Shekhar, “Multimodality image-guided interventions: Multimodality for the rest of us” Learning Objectives: Understand the principles and applications of HIFU in surgical ablation. Learn about recent advances in 3D–2D and 3D deformable image registration in support of surgical safety and precision. Learn about recent advances in model-based 3D image reconstruction in application to intraoperative 3D imaging. Understand the multi-modality imaging technologies and clinical applications investigated in the AMIGO suite. Understand the emerging need and techniques to implement multi-modality image guidance in surgical applications such as neurosurgery, orthopaedic surgery, vascular surgery, and interventional radiology. Research supported by the NIH and Siemens Healthcare.; J. Siewerdsen; Grant Support - National Institutes of Health; Grant Support - Siemens Healthcare; Grant Support - Carestream Health; Advisory Board - Carestream Health; Licensing Agreement - Carestream Health; Licensing Agreement - Elekta Oncology.; T. Kapur, P41EB015898; R. Shekhar, Funding: R42CA137886 and R41CA192504 Disclosure and CoI: IGI Technologies, small-business partner on the grants.

  16. SU-C-202-05: Pilot Study of Online Treatment Evaluation and Adaptive Re-Planning for Laryngeal SBRT

    Energy Technology Data Exchange (ETDEWEB)

    Mao, W [The University of Texas Southwestern Medical Ctr, Dallas, TX (United States); Henry Ford Health System, Detroit, MI (United States); Liu, C; Zhong, H [Henry Ford Health System, Detroit, MI (United States); Rozario, T; Lu, W; Gu, X; Yan, Y; Jia, X; Sumer, B; Schwartz, D [The University of Texas Southwestern Medical Ctr, Dallas, TX (United States)

    2016-06-15

    Purpose: We have instigated a phase I trial of 5-fraction stereotactic body radiotherapy (SBRT) for advanced-stage laryngeal cancer. We conducted this pilot dosimetric study to confirm the potential utility of online adaptive re-planning to preserve treatment quality. Methods: Ten cases of larynx cancer were evaluated. Baseline and daily SBRT treatment plans were generated per trial protocol. Daily volumetric images were acquired prior to every fraction of treatment. Reference simulation CT images were deformably registered to daily volumetric images using Eclipse. Planning contours were then deformably propagated to daily images. Reference SBRT plans were directly copied to calculate delivered dose distributions on deformed reference CT images. In-house software platform has been developed to calculate cumulative dose over a course of treatment in four steps: 1) deforming delivered dose grid to reference CT images using deformation information exported from Eclipse; 2) generating tetrahedrons using deformed dose grid as vertices; 3) resampling dose to a high resolution within every tetrahedron; 4) calculating dose-volume histograms. Our inhouse software was benchmarked with a commercial software, Mirada. Results: In all ten cases including 49 fractions of treatments, delivered daily doses were completely evaluated and treatment could be re-planned within 10 minutes. Prescription dose coverage of PTV was less than intended in 53% of fractions of treatment (mean: 94%, range: 84%–98%) while minimum coverage of CTV and GTV was 94% and 97%, respectively. Maximum bystander point dose limits to arytenoids, parotids, and spinal cord remained respected in all cases, although variances in carotid artery doses were observed in a minority of cases. Conclusion: Although GTV and CTV coverage is preserved by in-room 3D image guidance of larynx SBRT, PTV coverage can vary significantly from intended plans. Online adaptive treatment evaluation and re-planning is potentially necessary and our procedure is clinically applicable to fully preserve treatment quality. This project is supported by CPRIT Individual Investigator Research Award RP150386.

  17. SU-C-202-02: A Comprehensive Evaluation of Adaptive Daily Planning for Cervical Cancer HDR Brachytherapy

    Energy Technology Data Exchange (ETDEWEB)

    Meerschaert, R; Paul, A; Zhuang, L [Department of Oncology, Radiation Oncology Division, Wayne State University School of Medicine, Detroit, MI (United States); Nalichowski, A [Department of Oncology, Radiation Oncology Division, Karmanos Cancer Institute, Detroit, MI (United States); Burmeister, J; Miller, A [Department of Oncology, Radiation Oncology Division, Wayne State University School of Medicine, Detroit, MI (United States); Department of Oncology, Radiation Oncology Division, Karmanos Cancer Institute, Detroit, MI (United States)

    2016-06-15

    Purpose: To evaluate adaptive daily planning for cervical cancer patients who underwent high-dose-rate intra-cavitary brachytherapy (HDR-ICBT). Methods: This study included 22 cervical cancer patients who underwent 5 fractions of HDR ICBT. Regions of interest (ROIs) including high-risk clinical tumor volume (HR-CTV) and organs-at-risk (OARs) were manually contoured on daily CT images. All patients were treated with adaptive daily plans, which involved ROI delineation and dose optimization at each treatment fraction. Single treatment plans were retrospectively generated by applying the first treatment fraction’s dwell times adjusted for decay and dwell positions of the applicator to subsequent treatment fractions. Various existing similarity metrics were calculated for the ROIs to quantify interfractional organ variations. A novel similarity score (JRARM) was established, which combined both volumetric overlap metrics (DSC, JSC, and RVD) and distance metrics (ASD, MSD, and RMSD). Linear regression was performed to determine a relationship between inter-fractional organ variations of various similarity metrics and D2cc variations from both plans. Wilcoxon Signed Rank Tests were used to assess adaptive daily plans and single plans by comparing EQD2 D2cc (α/β=3) for OARs. Results: For inter-fractional organ variations, the sigmoid demonstrated the greatest variations based on the JRARM and DSC similarity metrics. Comparisons between paired ROIs showed differences in JRARM scores and DSCs at each treatment fraction. RVD, MSD, and RMSD were found to be significantly correlated to D2cc variations for bladder and sigmoid. The comparison between plans found that adaptive daily planning provided lower EQD2 D2cc of OARs than single planning, specifically for the sigmoid (p=0.015). Conclusion: Substantial inter-fractional organ motion can occur during HDR-BT, which may significantly affect D2cc of OARs. Adaptive daily planning provides improved dose sparing for OARs compared to single planning.

  18. 75 FR 60655 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes; Airbus...

    Science.gov (United States)

    2010-10-01

    ... National Aviation Authorities (NAA) the application of a similar regulation. The aim of this regulation is to require * * * a definition review against explosion hazards. * * * * * Failure of the auxiliary... explosion and consequent loss of the airplane. The proposed AD would require actions that are intended to...

  19. 76 FR 432 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes; Airbus...

    Science.gov (United States)

    2011-01-05

    ... Authorities (NAA) the application of a similar regulation. The aim of this regulation is to require * * * a definition review against explosion hazards. * * * * * Failure of the auxiliary power unit (APU) bleed leak... of the fuel vapors in that tank, which could result in a fuel tank explosion and consequent loss of...

  20. 75 FR 68698 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, -223F, -243, and -243F...

    Science.gov (United States)

    2010-11-09

    ... aviation product. The MCAI describes the unsafe condition as: * * * * * Investigation conducted by Thales... conducted by Thales on the removed probes revealed oil residue between the stator and the rotor parts of the... inspection of the Thales Avionics AoA probe P/N [part number] C16291AA in order to identify the suspect parts...

  1. 32 CFR Appendix A to Part 47 - Instructions for Submitting Group Applications Under Public Law 95-202

    Science.gov (United States)

    2010-07-01

    ... group provided service to the U.S. Armed Forces. 2. Show the relationship that the group had with the U.S. Armed Forces, the manner in which members of the group were employed, and the services the... SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN ACTIVE DUTY SERVICE FOR CIVILIAN OR CONTRACTUAL GROUPS...

  2. Risk of pseudophakic retinal detachment in 202 226 patients using the fellow nonoperated eye as reference

    DEFF Research Database (Denmark)

    Bjerrum, Søren S; Mikkelsen, Kim Lyngby; La Cour, Morten

    2013-01-01

    To study the risk of pseudophakic retinal detachment (PRD) after first-eye phacoemulsification cataract surgery in Denmark relative to the risk of retinal detachment (RD) in the patients' fellow nonoperated eyes.......To study the risk of pseudophakic retinal detachment (PRD) after first-eye phacoemulsification cataract surgery in Denmark relative to the risk of retinal detachment (RD) in the patients' fellow nonoperated eyes....

  3. 76 FR 42602 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, -243, -301, -302, -303, -321...

    Science.gov (United States)

    2011-07-19

    ...: During A330 and A340 aeroplanes fatigue tests, cracks appeared on the right (RH) and left (LH) sides between the crossing area of the keel beam fitting and the front spar of the Centre Wing Box (CWB). This condition, if not corrected, could lead to keel beam rupture which would affect the area structural...

  4. TU-H-CAMPUS-TeP2-02: FLASH Irradiation Improves the Therapeutic Index Following GI Tract Irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Schueler, E; Trovati, S; King, G; Lartey, F; Rafat, M; Loo, B; Maxim, P [Stanford University School of Medicine, Palo Alto, California (United States)

    2016-06-15

    Purpose: To investigate and characterize the radiobiological effectiveness of very high dose rate radiotherapy (FLASH) compared to conventional irradiation in an in vivo model. Methods: The gastrointestinal (GI) tract of C57BL/6 mice were irradiated with doses ranging between 10 and 18 Gy using a custom stereotactic jig. A Varian Clinac 21EX was modified to allow dose rates ranging from 0.05 to 240 Gy/s at the position of the mirror. With the gantry at 180 degrees, the jig holding the individual animals was placed above the mirror to take advantage of the reduced source to target distance. Mice were irradiated with 20MeV electrons. Following irradiation, the mice were monitored twice daily for morbidity and daily for weight changes. Results: Mice irradiated with FLASH irradiation had lower weight loss compared to the mice receiving conventional irradiation. Following FLASH irradiation, a maximum weight loss of ∼20% was observed at day 6 with subsequent recovery, while following conventional irradiation, higher weight losses was observed with fewer instances of recovery. Concerning survival, all mice in the conventionally irradiated groups had a 100% mortality in the range of 15.5–18 Gy, while the mice irradiated with FLASH irradiation had a 100% survival in the same range. Conclusion: These results have demonstrated proof of principle that FLASH irradiations have a dramatic impact on the overall survival of mice following GI tract irradiations. If the increase in the therapeutic window can be validated and understood, this would revolutionize the field of radiation oncology and lead to increased cure rates with reduced side effects following treatment, resulting in increased quality of life for cancer survivors. Funding: DoD, Award#:W81XWH-14-1-0014, Weston Havens Foundation, Bio-X (Stanford University), the Office of the Dean of the Medical School, the Office of the Provost (Stanford University), and the Swedish Childhood Cancer Foundation; BL and PM are founders of TibaRay,Inc.; BL and PM have received research grants from Varian and RaySearch Laboratory.

  5. SU-D-202-03: Statistical Segmentation On Quantitative CT for Assessing Spatial Tumor Response During Radiation Therapy Delivery

    Energy Technology Data Exchange (ETDEWEB)

    Schott, D; Chen, X; Klawikowski, S; Noid, G; Dalah, E; Li, X [Medical College of Wisconsin, Milwaukee, WI (United States); Schmidt, T [Marquette University, Milwaukee, WI (United States)

    2016-06-15

    Purpose: Develop a method to segment regions of interest (ROIs) in tumor with statistically similar Hounsfield unit (HU) values and/or HU changes during chemoradiation therapy (CRT) delivery, to assess spatial tumor treatment response based on daily CTs during CRT delivery. Methods: Generate a three region map of ROIs with differential HUs, by sampling neighboring voxels around a selected voxel and comparing to the mean of the entire ROI using a t-test. The cumulative distribution function, P, is calculated from the t-test. The P value is assigned to be the value at the selected voxel, and this is repeated over all voxels in the initial ROI. Three regions are defined as: (1-P) < 0.00001 (mid region), and 0.00001 < (1-P) (mean greater than baseline and mean lower than baseline). The test is then expanded to compare daily CT sets acquired during routine CT-guided RT delivery using a CT-on-rails. The first fraction CT is used as the baseline for comparison. We tested 15 pancreatic head tumor cases undergoing CRT, to identify the ROIs and changes corresponding to normal, fibrotic, and tumor tissue. The obtained ROIs were compared with MRI-ADC maps acquired pre- and post-CRT. Results: The ROIs in 13 out of 15 patients’ first fraction CTs and pre-CRT MRIs matched the general region and slices covered, as well as in 6 out of the 9 patients with post-CRT MRIs. The high HU region designated by the t-test was seen to correlate with the tumor region in MR, and these ROIs are positioned within the same region over the course of treatment. In patients with poorly delineated tumors in MR, the t-test was inconclusive. Conclusion: The proposed statistical segmentation technique shows the potential to identify regions in tumor with differential HUs and HU changes during CRT delivery for patients with pancreas head cancer.

  6. 41 CFR 105-50.202-2 - Preparation of or assistance in the conduct of statistical or other studies.

    Science.gov (United States)

    2010-07-01

    ...) Space management, including assignment and utilization; (2) Supply management, including laboratory... assistance in the conduct of such activities and in the preparation of such materials, provided they are of a...

  7. 77 FR 8804 - Foreign-Trade Zone 202-Los Angeles, CA; Application for Reorganization and Expansion Under...

    Science.gov (United States)

    2012-02-15

    ... Terminal, 2000 E. Sepulveda Boulevard, Carson (119.3 acres), Shell Carson Terminal, 20945 S. Wilmington... would be all of Orange County and portions of Los Angeles and San Bernardino Counties, California, as...

  8. WE-AB-202-06: Correlating Lung CT HU with Transformation-Based and Xe-CT Derived Ventilation

    Energy Technology Data Exchange (ETDEWEB)

    Du, K; Patton, T; Bayouth, J [University of Wisconsin, Madison, WI (United States); Reinhardt, J; Christensen, G [The University of Iowa, Iowa City, IA (United States)

    2016-06-15

    Purpose: Regional lung ventilation is useful to reduce radiation-induced function damage during lung cancer radiation therapy. Recently a new direct HU (Hounsfield unit)-based method was proposed to estimate the ventilation potential without image registration. The purpose of this study is to examine if there is a functional dependence between HU values and transformation-based or Xe-CT derived ventilation. Methods: 4DCT images acquired from 13 patients prior to radiation therapy and 4 mechanically ventilated sheep subjects which also have associated Xe-CT images were used for this analysis. Transformation-based ventilation was computed using Jacobian determinant of the transformation field between peak-exhale and peak-inhale 4DCT images. Both transformation and Xe-CT derived ventilation was computed for each HU bin. Color scatter plot and cumulative histogram were used to compare and validate the direct HU-based method. Results: There was little change of the center and shape of the HU histograms between free breathing CT and 4DCT average, with or without smoothing, and between the repeated 4DCT scans. HU of −750 and −630 were found to have the greatest transformation-based ventilation for human and sheep subjects, respectively. Maximum Xe-CT derived ventilation was found to locate at HU of −600 in sheep subjects. The curve between Xe-CT ventilation and HU was noisy for tissue above HU −400, possibly due to less intensity change of Xe gas during wash-out and wash-in phases. Conclusion: Both transformation-based and Xe-CT ventilation demonstrated that lung tissues with HU values in the range of (-750, −600) HU have the maximum ventilation potential. The correlation between HU and ventilation suggests that HU might be used to help guide the ventilation calculation and make it more robust to noise and image registration errors. Research support from NIH grants CA166703 and CA166119 and a gift from Roger Koch.

  9. Oahu Hyperspectral Imagery 2000 (202-0612-272217) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  10. 76 FR 24343 - Airworthiness Directives; Bombardier, Inc. Model DHC-8-101, -102, -103, -106, -201, -202, -301...

    Science.gov (United States)

    2011-05-02

    ... cockpit windshield frames (or lower windshield frames) that resulted in either corrosion or water ingress... that secure the windshield to the lower windshield frame, such that the intended fastening function was seriously compromised. Corrosion of the lower windshield frames, including the anchor nuts that secure the...

  11. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  12. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  13. Production cross section of At radionuclides from 7Li+natPb and 9Be+natTl reactions

    Science.gov (United States)

    Maiti, Moumita; Lahiri, Susanta

    2011-12-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from 6,7Li- and 9Be-induced reactions on natural lead and thallium targets, respectively. The production of astatine radionuclides were investigated experimentally with two heavy-ion-induced reactions: 9Be + natTl and 7Li + natPb. Formation cross sections of the evaporation residues, 207,208,209,210At, produced in the (HI,xn) channel, were measured by the stacked-foil technique followed by off-line γ spectrometry at low incident energies (<50 MeV). Measured excitation functions were interpreted in terms of a compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach models. Measured cross-section values are lower than the respective theoretical predictions.

  14. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Koziorowski, J

    1998-10-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on {sup 211}At and {sup 124}I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[{sup 211}At]astato-2`-deoxyuridine (AUdR) and N-succinimidyl-4-[{sup 211}At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [{sup 124}I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[{sup 124}I]iodo-2`-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for

  15. Aristotle and the Mathematical Tradition on diastēma and logos: An Analysis of Physics 3.3, 202a18-21

    Directory of Open Access Journals (Sweden)

    Monica Ugaglia

    2016-02-01

    Full Text Available Physics 3.3, by distinguishing two kinds of kinesis involved in the same interval, constitutes evidence of a debate on the respective merits of proportion theory vs. harmonic theory.

  16. Static stretch versus Mulligan Concept – long-term effects in gymnast’s flexibility DOI:10.5007/1980-0037.2010v12n3p202

    Directory of Open Access Journals (Sweden)

    Manuela Karloh

    2010-01-01

    Full Text Available Flexibility is one of the most important physical aspects in Rhythmic Gymnastics (RG. The purpose of the study was to compare long-term changes in flexibility of hip extension in athletes of RG in function of two techniques: the static stretch and Mulligan’s Long Leg Traction. Participated eight female athletes with an average age of 13,25±0,89 years old, divided into two groups. Group1 performed Mulligan technique and Group2 performed static stretch. Flexibility training lasts for six weeks. It was executed 2 times a week, and was composed by 2 repetitions of 30 seconds for each lower limb. Photogrammetry was used to assess the range of motion (ROM of hip extension. ROM was assessed before and after six weeks of training. Descriptive and inferential statistics were used to analyze the data. The increase of ROM was statistically significant in both lower limbs in Group 1, and in right lower limb (RLL in Group 2. After six weeks of training the increase of ROM in Group 1 was 6,25°± 2,75º in left lower limb (LLL and 5,25°± 2,63º in RLL, and the increase in Group 2 was 6,75º± 4,64º in LLL and 5,5º± 3,41º in RLL. Comparing the two executed techniques, in relation to the increase of ROM, there were no statistically significant differences. We conclude that after six weeks of training the two proposed techniques have showed increases in range of motion.

  17. WE-AB-202-08: Feasibility of Single-Inhalation/Single-Energy Xenon CT for High-Resolution Imaging of Regional Lung Ventilation in Humans

    Energy Technology Data Exchange (ETDEWEB)

    Pinkham, D; Schueler, E; Diehn, M; Mittra, E; Loo, B; Maxim, P [Stanford University School of Medicine, Palo Alto, California (United States); Negahdar, M [IBM Research Center, San Jose, California (United States); Yamamoto, T [University of California Davis Medical Center, Sacramento, CA (United States)

    2016-06-15

    Purpose: To demonstrate the efficacy of a novel functional lung imaging method that utilizes single-inhalation, single-energy xenon CT (Xe-CT) lung ventilation scans, and to compare it against the current clinical standard, ventilation single-photon emission CT (V-SPECT). Methods: In an IRB-approved clinical study, 14 patients undergoing thoracic radiotherapy received two successive single inhalation, single energy (80keV) CT images of the entire lung using 100% oxygen and a 70%/30% xenon-oxygen mixture. A subset of ten patients also received concurrent SPECT ventilation scans. Anatomic reproducibility between the two scans was achieved using a custom video biofeedback apparatus. The CT images were registered to each other by deformable registration, and a calculated difference image served as surrogate xenon ventilation map. Both lungs were partitioned into twelve sectors, and a sector-wise correlation was performed between the xenon and V-SPECT scans. A linear regression model was developed with forced expiratory volume (FEV) as a predictor and the coefficient of variation (CoV) as the outcome. Results: The ventilation comparison for five of the patients had either moderate to strong Pearson correlation coefficients (0.47 to 0.69, p<0.05). Of these, four also had moderate to strong Spearman correlation coefficients (0.46 to 0.80, p<0.03). The patients with the strongest correlation had clear regional ventilation deficits. The patient comparisons with the weakest correlations had more homogeneous ventilation distributions, and those patients also had diminished lung function as assessed by spirometry. Analysis of the relationship between CoV and FEV yielded a non-significant trend toward negative correlation (Pearson coefficient −0.60, p<0.15). Conclusion: Significant correlations were found between the Xe-CT and V-SPECT ventilation imagery. The results from this small cohort of patients indicate that single inhalation, single energy Xe-CT has the potential to quantify regional lung ventilation volumetrically with high resolution using widely accessible radiologic equipment. Bill Loo and Peter Maxim are founders of TibaRay, Inc. Bill Loo is also a board member. Bill Loo and Peter Maxim have received research grants from Varian Medical Systems, Inc. and RaySearch Laboratory.

  18. TU-H-CAMPUS-JeP2-02: Interobserver Variability of CT, PET-CT and MRI Based Primary Tumor Delineation for Lung Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Karki, K; Hugo, G; Saraiya, S; Jan, N; Schuster, J; Schutzer, M; Fahrner, L; Groves, R; Ford, J; Weiss, E [Virginia Commonwealth University, Richmond, VA (United States)

    2016-06-15

    Purpose: Target delineation in lung cancer radiotherapy has, in general, large variability. MRI has so far not been investigated in detail for lung cancer delineation variability. The purpose of this study is to investigate delineation variability for lung tumors using MRI and compare it to CT alone and PET-CT based delineations. Methods: Seven physicians delineated the primary tumor volumes of nine patients for the following scenarios: (1) CT only; (2) post-contrast T1-weighted MRI registered with diffusion-weighted MRI; and (3) PET-CT fusion images. To compute interobserver variability, the median surface was generated from all observers’ contours and used as the reference surface. A single physician labeled the interface types (tumor to lung, atelectasis (collapsed lung), hilum, mediastinum, or chest-wall) on the median surface. Volume variation (normalized to PET-CT volume), minimum distance (MD), and bidirectional local distance (BLD) between individual observers’ contours and the reference contour were measured. Results: CT- and MRI-based normalized volumes were 1.61±0.76 (mean±SD) and 1.38±0.44, respectively, both significantly larger than PET-CT (p<0.05, paired t-test). The overall uncertainty (root mean square of SD values over all points) of both BLD and MD measures of the observers for the interfaces were not significantly different (p>0.05, two-samples t-test) for all imaging modalities except between tumor-mediastinum and tumor-atelectasis in PET-CT. The largest mean overall uncertainty was observed for tumor-atelectasis interface, the smallest for tumor-mediastinum and tumor-lung interfaces for all modalities. The whole tumor uncertainties for both BLD and MD were not significantly different between any two modalities (p>0.05, paired t-test). Overall uncertainties for the interfaces using BLD were similar to using MD. Conclusion: Large volume variations were observed between the three imaging modalities. Contouring variability appeared to depend on the interface type. This study will be useful for understanding the delineation uncertainty for radiotherapy planning of lung cancer using different imaging modalities. Disclosures: Research agreement with Phillips Healthcare (GH and EW), National Institutes of Health Licensing agreement with Varian Medical Systems (GH and EW), research grants from the National Institute of Health (GH and EW), UpToDate royalties (EW), and none (others). Authors have no potential conflicts of interest to disclose.

  19. No psychological effect of color context in a low level vision task [v1; ref status: indexed, http://f1000r.es/202

    Directory of Open Access Journals (Sweden)

    Adam Pedley

    2013-11-01

    Full Text Available Background: A remarkable series of recent papers have shown that colour can influence performance in cognitive tasks. In particular, they suggest that viewing a participant number printed in red ink or other red ancillary stimulus elements improves performance in tasks requiring local processing and impedes performance in tasks requiring global processing whilst the reverse is true for the colour blue. The tasks in these experiments require high level cognitive processing such as analogy solving or remote association tests and the chromatic effect on local vs. global processing is presumed to involve widespread activation of the autonomic nervous system. If this is the case, we might expect to see similar effects on all local vs. global task comparisons. To test this hypothesis, we asked whether chromatic cues also influence performance in tasks involving low level visual feature integration. Methods: Subjects performed either local (contrast detection or global (form detection tasks on achromatic dynamic Glass pattern stimuli. Coloured instructions, target frames and fixation points were used to attempt to bias performance to different task types. Based on previous literature, we hypothesised that red cues would improve performance in the (local contrast detection task but would impede performance in the (global form detection task.  Results: A two-way, repeated measures, analysis of covariance (2×2 ANCOVA with gender as a covariate, revealed no influence of colour on either task, F(1,29 = 0.289, p = 0.595, partial η2 = 0.002. Additional analysis revealed no significant differences in only the first attempts of the tasks or in the improvement in performance between trials. Discussion: We conclude that motivational processes elicited by colour perception do not influence neuronal signal processing in the early visual system, in stark contrast to their putative effects on processing in higher areas.

  20. Major Lipid Body Protein: A Conserved Structural Component of Lipid Body Accumulated during Abiotic Stress in S. quadricauda CASA-CC202

    Directory of Open Access Journals (Sweden)

    Arumugam Muthu

    2016-11-01

    Full Text Available Abiotic stress in oleaginous microalgae enhances lipid accumulation and is stored in a specialised organelle called lipid droplets (LDs. Both the LDs and body are enriched with major lipid droplet protein (MLDP. It serves as a major structural component and also plays a key role in recruiting other proteins and enzymes involved in lipid body maturation. In the present study, the presence of MLDP was detected in two abiotic stress condition namely nitrogen starvation and salt stress condition. Previous research reveals that nitrogen starvation enhances lipid accumulation. Therefore, the effect of salt on growth, biomass yield, and fatty acid profile is studied in detail. The specific growth rate of S. quadricauda under the salt stress of 10mM concentration is about 0.174μ and in control, the SGR is 0.241μ. An increase in the doubling time of the cells shows that the rate of cell division decreases during salt stress (2.87–5.17. The dry biomass content also decreased drastically at 50mM salt-treated cells (129mg/L compared to control (236mg/L on the day 20. The analysis of fatty acid composition also revealed that there is a 20% decrease in the saturated fatty acid level and 19.9% increment in monounsaturated fatty acid level, which makes salt-mediated lipid accumulation as a suitable biodiesel precursor.