WorldWideScience

Sample records for astatine 199

  1. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  2. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-09-15

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Discovery of the astatine, radon, francium, and radium isotopes

    Science.gov (United States)

    Fry, C.; Thoennessen, M.

    2013-09-01

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration

    2011-11-30

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  6. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Science.gov (United States)

    Uusitalo, J.; Jakobsson, U.

    2011-11-01

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  7. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy.

    Science.gov (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  9. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others

    2015-10-15

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  10. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Science.gov (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.

    2015-10-01

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  11. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  12. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  13. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  14. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  15. Comment: 199 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available nal Institute for Basic Biology) licensed under CC Attribution2.1 Japan メダカ近交系 Hd-rR系統 南日本集団由来の純系。 メダカで最初にゲノム解読が行われた系統。 撮影:成瀬清(基礎生物学...研究所) Photo: Kiyoshi Naruse (National Institute for Basic Biology) bando 2009/09/30 11:23:24 2010/01/14 20:09:43 ... ...Japanese medaka Oryzias latipes Oryzias_latipes_L.png 199.png Kiyoshi Naruse (Natio

  16. α decay of the very neutron-deficient isotopes 197-199Fr

    Science.gov (United States)

    Kalaninová, Z.; Andreyev, A. N.; Antalic, S.; Heßberger, F. P.; Ackermann, D.; Andel, B.; Drummond, M. C.; Hofmann, S.; Huyse, M.; Kindler, B.; Lane, J. F. W.; Liberati, V.; Lommel, B.; Page, R. D.; Rapisarda, E.; Sandhu, K.; Šáro, Š.; Thornthwaite, A.; Van Duppen, P.

    2013-04-01

    Decay properties of the very neutron-deficient isotopes 197-199Fr were studied at the velocity filter Separator for Heavy Ion reaction Products (SHIP) at GSI in Darmstadt. The isotopes were produced in the 2n-4n evaporation channels of the fusion-evaporation reaction 60Ni+141Pr → 201Fr*. Improved α-decay properties of 199Fr were determined and the possible existence of two α-decaying states in this nucleus is discussed. For the isotope 198Fr a broad α-decay energy distribution was detected in the range of (7470-7930) keV and two α-decaying states were observed with half-lives of 1.1(7) and 15(3) ms. The new isotope 197Fr was identified based on the observation of one α-decay chain yielding Eα=7728(15) keV and T1/2=0.6-0.3+3.0 ms. The systematics of reduced α-decay widths are presented for neutron-deficient francium, radon, and astatine isotopes.

  17. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  18. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  19. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  20. CA 19-9 (Cancer Antigen 19-9)

    Science.gov (United States)

    ... antigen negative (about 30% in people of African ancestry) and do not produce CA 19-9. The ... are slightly more likely to have it than women), family history, diabetes , chronic pancreatitis , and workplace exposure ...

  1. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study

    Science.gov (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi

    2018-01-01

    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).

  2. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  3. 30 CFR 19.9 - Performance.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Performance. 19.9 Section 19.9 Mineral... MINING PRODUCTS ELECTRIC CAP LAMPS § 19.9 Performance. In addition to the general design and the safety... respect to performance, as follows: (a) Time of burning and candlepower. Permissible electric cap lamps...

  4. 46 CFR 199.201 - Survival craft.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft. 199.201 Section 199.201 Shipping COAST... SYSTEMS FOR CERTAIN INSPECTED VESSELS Additional Requirements for Passenger Vessels § 199.201 Survival craft. (a) Each survival craft must be approved and equipped as follows: (1) Each lifeboat must be...

  5. 46 CFR 199.261 - Survival craft.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft. 199.261 Section 199.261 Shipping COAST... SYSTEMS FOR CERTAIN INSPECTED VESSELS Additional Requirements for Cargo Vessels § 199.261 Survival craft. (a) Each survival craft must be approved and equipped as follows: (1) Each lifeboat must be a totally...

  6. 49 CFR 199.215 - Alcohol concentration.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Alcohol concentration. 199.215 Section 199.215... Prevention Program § 199.215 Alcohol concentration. Each operator shall prohibit a covered employee from... alcohol concentration of 0.04 or greater. No operator having actual knowledge that a covered employee has...

  7. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  8. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  9. 46 CFR 199.290 - Stowage of survival craft.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Stowage of survival craft. 199.290 Section 199.290... of survival craft. (a) To meet the requirements of § 199.130(b)(1), each lifeboat— (1) On a cargo... required under § 199.261(e), no stowage position or muster and embarkation station for a survival craft on...

  10. 49 CFR 199.219 - Pre-duty use.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Pre-duty use. 199.219 Section 199.219 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... Prevention Program § 199.219 Pre-duty use. Each operator shall prohibit a covered employee from using alcohol...

  11. 49 CFR 199.217 - On-duty use.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false On-duty use. 199.217 Section 199.217 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... Prevention Program § 199.217 On-duty use. Each operator shall prohibit a covered employee from using alcohol...

  12. 46 CFR 108.199 - Arrangement of sleeping spaces.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Arrangement of sleeping spaces. 108.199 Section 108.199... AND EQUIPMENT Construction and Arrangement Accommodation Spaces § 108.199 Arrangement of sleeping spaces. To the extent practicable, each occupation group must be berthed together in sleeping spaces...

  13. 22 CFR 19.9 - Pension benefits for former spouses.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Pension benefits for former spouses. 19.9 Section 19.9 Foreign Relations DEPARTMENT OF STATE PERSONNEL BENEFITS FOR SPOUSES AND FORMER SPOUSES OF PARTICIPANTS IN THE FOREIGN SERVICE RETIREMENT AND DISABILITY SYSTEM § 19.9 Pension benefits for former spouses. ...

  14. 46 CFR 199.130 - Stowage of survival craft.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Stowage of survival craft. 199.130 Section 199.130... LIFESAVING SYSTEMS FOR CERTAIN INSPECTED VESSELS Requirements for All Vessels § 199.130 Stowage of survival craft. (a) General. Each survival craft must be stowed— (1) As close to the accommodation and service...

  15. 46 CFR 199.230 - Stowage of survival craft.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Stowage of survival craft. 199.230 Section 199.230... Stowage of survival craft. (a) To meet the requirements of § 199.130(b)(1), each lifeboat on a passenger... height of a survival craft must take into account the vessel's escape provisions, the vessel's size, and...

  16. 49 CFR 199.113 - Employee assistance program.

    Science.gov (United States)

    2010-10-01

    ... community service hot-line telephone number for employee assistance; and display and distribution of the... 49 Transportation 3 2010-10-01 2010-10-01 false Employee assistance program. 199.113 Section 199... TESTING Drug Testing § 199.113 Employee assistance program. (a) Each operator shall provide an employee...

  17. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  18. 26 CFR 1.199-7 - Expanded affiliated groups.

    Science.gov (United States)

    2010-04-01

    ..., rental, license, sale, exchange, or other disposition of the furniture by the single corporation (and no... disposing member) derives gross receipts (as defined in § 1.199-3(c)) from the lease, rental, license, sale... gross receipts (DPGR) (as defined in § 1.199-3(a)). With respect to a lease, rental, or license, the...

  19. 49 CFR 199.225 - Alcohol tests required.

    Science.gov (United States)

    2010-10-01

    ... resolving problems associated with alcohol misuse, each operator shall ensure that the employee is subject... 49 Transportation 3 2010-10-01 2010-10-01 false Alcohol tests required. 199.225 Section 199.225... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY DRUG AND ALCOHOL TESTING Alcohol Misuse...

  20. 7 CFR 205.106-205.199 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false [Reserved] 205.106-205.199 Section 205.106-205.199 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) ORGANIC FOODS PRODUCTION ACT PROVISIONS NATIONAL ORGANIC PROGRAM...

  1. 26 CFR 1.199-6 - Agricultural and horticultural cooperatives.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Agricultural and horticultural cooperatives. 1....199-6 Agricultural and horticultural cooperatives. (a) In general. A patron who receives a qualified... cooperative (cooperative) (as defined in paragraph (f) of this section) is allowed a deduction under § 1.199-1...

  2. 38 CFR 19.9 - Remand for further development.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Remand for further development. 19.9 Section 19.9 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS....9 Remand for further development. (a) General. If further evidence, clarification of the evidence...

  3. Relationship of CA 19-9 with choledocholithiasis and cholangitis.

    Science.gov (United States)

    Doğan, Ümit Bilge; Gümürdülü, Yüksel; Gölge, Necmettin; Kara, Banu

    2011-01-01

    It is well known that increased concentrations of CA 19-9 can be found in benign disease of the liver, pancreas and biliary tract, especially in cases with gallstone disease with cholangitis. The aim of this study was to investigate the relation of CA 19-9 with the number and size of the stones, cholangitis and biliary obstruction in patients with choledocholithiasis. Seventy patients with radiologically proven choledocholithiasis were studied. Endoscopic retrograde cholangiopancreatography, sphincterotomy and stone extraction were applied to all patients. In each case, the parameters recorded included the levels of CA 19-9 and other laboratory tests before and after endoscopic retrograde cholangiopancreatography and the results of imaging techniques and immunoserologic tests. The correlations of these parameters were determined by SPSS 17 package program for statistical analysis. Elevation of CA 19-9 was found in 32 patients (46%), while 8 patients (11%) had extraordinarily high levels (>1000 U/ml). CA 19-9 levels were correlated with serum alkaline phosphatase (r=0.5, palkaline phosphatase, gamma glutamyl transpeptidase and bilirubin levels. After stone extraction, CA 19-9 levels started to decrease and reached normal values 1-28 days later. In conclusion, CA 19-9 levels are associated with biliary obstruction and cholangitis but not with the number and size of stones in patients with choledocholithiasis.

  4. 46 CFR 199.03 - Relationship to international standards.

    Science.gov (United States)

    2010-10-01

    ... requirements: (1) Each new lifeboat and launching appliance on a tank vessel may be of aluminum construction... lifejackets, if carried, must be of the same or similar design as required by § 199.70(b). (5) Containers for...

  5. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.

    2017-04-01

    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  6. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination.

    Science.gov (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick

    2007-01-01

    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  7. Carbohydrate antigen 19-9 is extremely elevated in polycystic liver disease.

    NARCIS (Netherlands)

    Waanders, E.; Keimpema, L. van; Brouwer, J.T.; Oijen, M.G.H. van; Aerts, R.; Sweep, C.G.J.; Nevens, F.; Drenth, J.P.H.

    2009-01-01

    BACKGROUND/AIMS: Carbohydrate antigen 19-9 (CA19-9) is used as a biomarker to differentiate benign from malignant gastrointestinal disorders. We examined the value of CA19-9 measurement in polycystic livers after observing high CA19-9 cyst fluid levels in a benign polycystic liver case. METHODS: We

  8. 14 CFR 121.199 - Nontransport category airplanes: Takeoff limitations.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Nontransport category airplanes: Takeoff... OPERATING REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Airplane Performance Operating Limitations § 121.199 Nontransport category airplanes: Takeoff limitations. (a) No person operating a...

  9. Phenotype abnormality: 199 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 199 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u705i decreased number... of trichome in organ named cauline leaf ... cauline leaf ... present in fewer numbers in organism ... trichome ...

  10. 27 CFR 26.199d - Customs inspection and release.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Customs inspection and... Shipment of Bulk Distilled Spirits From Puerto Rico, Without Payment of Tax, for Transfer From Customs Custody to Internal Revenue Bond § 26.199d Customs inspection and release. On receipt of a properly...

  11. Borehole completion data package for well 199-N-81

    Energy Technology Data Exchange (ETDEWEB)

    Hartman, M.J.

    1994-05-05

    Well 199-N-81 was drilled in 1993 as a RCRA groundwater monitoring for the 1324-N network. The well is completed at the top of the uppermost aquifer, in the Ringold Formation. This data package includes information on drilling, construction, development, and aquifer testing. Copies of forms, notes, and diagrams completed in the field comprise the bulk of this document. Few interpretations are included. Lithologic contacts were picked by the site geologist. An attempt was made to interpret aquifer test data.

  12. Phenotype-gene: 199 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 199 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1197i decreased size for quantity.../metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u12566580i decreased size for quantity of inflorescence http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u721i AT4G20910

  13. Identification of bile survivin and carbohydrate antigen 199 in distinguishing cholangiocarcinoma from benign obstructive jaundice.

    Science.gov (United States)

    Liu, Yanfeng; Sun, Jingxian; Zhang, Qiangbo; Jin, Bin; Zhu, Min; Zhang, Zongli

    2017-01-01

    To investigate whether bile survivin and carbohydrate antigen 199 (CA199) can be helpful in distinguishing cholangiocarcinoma (malignant obstructive jaundice) from benign obstructive jaundice. Receiver operating characteristic curve was used to evaluate the feasibility of bile survivin and CA199 in differentiating cholangiocarcinoma from benign obstructive jaundice. The area under the curve for survivin and CA199 in bile and serum were 0.780 (p jaundice.

  14. Interfering Effect of Black Tea Consumption on Diagnosis of Pancreatic Cancer by CA 19-9.

    Science.gov (United States)

    Al-Janabi, Ali Abdul Hussein S; Tawfeeq, Ekhlas F

    2017-06-01

    The study aims to determine the possible effects of black tea consumption on the level of CA 19-9 antigen in the human body. The level of CA 19-9 was measured in 270 healthy individuals who consumed heavy amounts of black tea. About 43.3 % of involved individuals were revealed to have elevated levels of CA 19-9. Males with high values of CA 19-9 represented the greatest number of involved individuals. The cutoff value of high levels of CA 19-9 in all individuals was ranged 69-105 U/ml. Consuming heavy amounts of black tea could be considered an important interfering factor that affects the levels of CA 19-9. The cutoff or predictive value of CA 19-9 in heavy-consuming people of black tea was determined.

  15. The miR-199-dynamin regulatory axis controls receptor-mediated endocytosis.

    Science.gov (United States)

    Aranda, Juan F; Canfrán-Duque, Alberto; Goedeke, Leigh; Suárez, Yajaira; Fernández-Hernando, Carlos

    2015-09-01

    Small non-coding RNAs (microRNAs) are important regulators of gene expression that modulate many physiological processes; however, their role in regulating intracellular transport remains largely unknown. Intriguingly, we found that the dynamin (DNM) genes, a GTPase family of proteins responsible for endocytosis in eukaryotic cells, encode the conserved miR-199a and miR-199b family of miRNAs within their intronic sequences. Here, we demonstrate that miR-199a and miR-199b regulate endocytic transport by controlling the expression of important mediators of endocytosis such as clathrin heavy chain (CLTC), Rab5A, low-density lipoprotein receptor (LDLR) and caveolin-1 (Cav-1). Importantly, miR-199a-5p and miR-199b-5p overexpression markedly inhibits CLTC, Rab5A, LDLR and Cav-1 expression, thus preventing receptor-mediated endocytosis in human cell lines (Huh7 and HeLa). Of note, miR-199a-5p inhibition increases target gene expression and receptor-mediated endocytosis. Taken together, our work identifies a new mechanism by which microRNAs regulate intracellular trafficking. In particular, we demonstrate that the DNM, miR-199a-5p and miR-199b-5p genes act as a bifunctional locus that regulates endocytosis, thus adding an unexpected layer of complexity in the regulation of intracellular trafficking. © 2015. Published by The Company of Biologists Ltd.

  16. Search for an Electric Dipole Moment (EDM) of 199Hg

    Science.gov (United States)

    Heckel, Blayne

    2017-04-01

    The observation of a non-zero EDM of an atom or elementary particle, at current levels of experimental sensitivity, would imply CP violation beyond the CKM matrix of the standard model of particle physics. Additional sources of CP violation have been proposed to help explain the excess of matter over anti-matter in our universe and the magnitude of ΘQCD, the strength of CP violation in the strong interaction, remains unknown. We have recently completed a set of measurements on the EDM of 199Hg, sensitive to both new sources of CP violation and ΘQCD. The experiment compares the phase accumulated by precessing Hg spins in vapor cells with electric fields parallel and anti-parallel to a common magnetic field. Our new result represents a factor of 5 improvement over previous results. A description of the EDM experiment, data, systematic error considerations will be presented. This work was supported by NSF Grant No. 1306743 and by the DOE Office of Nuclear Physics under Award No. DE-FG02-97ER41020.

  17. 46 CFR 199.214 - Immersion suits and thermal protective aids.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Immersion suits and thermal protective aids. 199.214... Passenger Vessels § 199.214 Immersion suits and thermal protective aids. (a) Each passenger vessel must... an immersion suit. (c) The immersion suits and thermal protective aids required under paragraphs (a...

  18. Association between serum CA 19-9 and metabolic syndrome: A cross-sectional study.

    Science.gov (United States)

    Du, Rui; Cheng, Di; Lin, Lin; Sun, Jichao; Peng, Kui; Xu, Yu; Xu, Min; Chen, Yuhong; Bi, Yufang; Wang, Weiqing; Lu, Jieli; Ning, Guang

    2017-11-01

    Increasing evidence suggests that serum CA 19-9 is associated with abnormal glucose metabolism. However, data on the association between CA 19-9 and metabolic syndrome is limited. The aim of the present study was to investigate the association between serum CA 19-9 and metabolic syndrome. A cross-sectional study was conducted on 3641 participants aged ≥40 years from the Songnan Community, Baoshan District in Shanghai, China. Logistic regression analysis was used to evaluate the association between serum CA 19-9 and metabolic syndrome. Multivariate logistic regression analysis showed that compared with participants in the first tertile of serum CA 19-9, those in the second and third tertiles had increased odds ratios (OR) for prevalent metabolic syndrome (multivariate adjusted OR 1.46 [95% confidence interval {CI} 1.11-1.92] and 1.51 [95% CI 1.14-1.98]; P trend  = 0.005). In addition, participants with elevated serum CA 19-9 (≥37 U/mL) had an increased risk of prevalent metabolic syndrome compared with those with serum CA 19-9 metabolic syndrome. In order to confirm this association and identify potential mechanisms, prospective cohort and mechanic studies should be performed. © 2017 Ruijin Hospital, Shanghai Jiaotong University School of Medicine and John Wiley & Sons Australia, Ltd.

  19. The Correlated Factors of Serum CA19-9 Levels in Diabetic Patients.

    Science.gov (United States)

    Jiang, Qiuming; Lei, Lei; Zhang, Xiyang; Pressley, Jennifer; Mao, Yuanjie

    2017-01-01

    Serum CA19-9 level is a sensitive marker for pancreatic tissue damage; however, its correlation factors are still unclear in diabetic patients. This study was aimed to investigate the correlation factors of serum CA 19-9 levels in these patients. Based on their serum CA19-9 levels, 412 diabetic patients (57 type 1 and 355 type 2) were divided into the negative group (432 cases, CA19-9 37 U /ml) and the positive group (31 cases, CA19-9 ≥ 37 U /ml). The two groups were compared with age, sex, duration of diabetic history, hemoglobin A1c, blood lipid, fasting C-peptide level, and area under the curve C-peptide. The difference was significant between 2 groups in age, hemoglobin A1c, total cholesterol, highdensity lipoprotein cholesterol, fasting C-peptide level, and area under the curve C-peptide (P < 0.05). A multivariate linear regression model found that the type of diabetes, hemoglobin A1c, area under the curve C-peptide, and high-density lipoprotein cholesterol are the independent contributors to CA19-9 levels. The results indicated that CA19-9 levels in patients with diabetes mellitus were related to not only age and sex but also diabetic type, hemoglobin A1c, lipid metabolism, and pancreatic beta cell function. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

  20. Vitrification of in vitro-produced bovine embryos matured inmodified TCM-199 medium

    OpenAIRE

    SANDAL, ASİYE İZEM; ÖZDAŞ, Özen Banu

    2015-01-01

    In vitro-produced bovine embryos matured in modified Tissue Culture Medium 199 (TCM-199) were vitrified at the 7th and 8th days of culture, and development at 48 h after warming was recorded. Ovaries were obtained from a local abattoir, and the oocytes were recovered by slicing method and divided into two main groups. The first group included cysteamine in the TCM-199 (Group A) and the second did not (Group B). They were incubated for 24 h at 38.8 °C in an atmosphere of 5% CO2 in humidified a...

  1. EO-199, a specific antagonist of antiarrhythmic drugs: Assessment by binding experiments and in vivo studies

    Energy Technology Data Exchange (ETDEWEB)

    Oppenheimer, E.; Harel, G.; Lipinsky, D.; Sarne, Y. (Tel-Aviv Univ. (Israel))

    1991-01-01

    EO-199, a demethylated analog of the novel class I antiarrhythmic drug EO-122 was found to antagonize the antiarrhythmic activity of EO-122 and that of procainamide (Class I{sub A}). EO-199 did not block significantly the activity of a class I{sub B} antiarrhythmic agent, lidocaine. EO-199 also displaced the specific binding of ({sup 3}H)EO-122 to rate heart membranes similarly to procainamide whereas lidocaine did not. The correlation between binding experiments and pharmacological effects points to a possible subclassification of these drugs; the two chemical analogs EO-199 and EO-122, as well as procainamide (I{sub A}) but not lidocaine (I{sub B}), compete at the same site or the same state of the sodium channel. The availability of a specific antagonist might be useful for studying the mechanism of action of antiarrhythmic drugs as well as an antidote in cases of antiarrhythmics overdose intoxication.

  2. Metastatic prostate cancer with elevated serum levels of CEA and CA19-9

    Directory of Open Access Journals (Sweden)

    Guang-Dar Juang

    2014-03-01

    Full Text Available Prostate-specific antigen (PSA is well known as a specific tumor marker for prostate cancer, but carcinoembryonic antigen (CEA- and carbohydrate antigen 19-9 (CA19-9-elevating adenocarcinomas originating in the prostate gland are rare. We report a case of metastatic adenocarcinoma of the prostate gland with a high serum level of CEA and CA19-9 in a 78-year-old man in whom prostate cancer (T3N1M1 had been diagnosed 2 years ago and who was treated with androgen deprivation therapy. He visited the emergency department because of a loss of appetite and abdominal pain. The serum CEA and CA19-9 levels were increased to 218.9 ng/mL (normal, <5 ng/mL and 212 ng/mL (normal, <27 ng/mL, respectively. The serum PSA level was slightly elevated (4.41 ng/mL. Computed tomography demonstrated multiple liver metastases, para-aortic lymph node enlargement, and lung metastases. A liver biopsy was performed and the specimen showed high-grade adenocarcinoma with focal positive staining for PSA. Despite chemotherapy with docetaxel, the patient died 3 months after treatment. Based on this case and a review of the literature, an aggressive variant of prostatic carcinoma with a high serum level of CEA and CA19-9 and a low PSA level was shown to progress rapidly with a poor prognosis.

  3. Comparison of Plasma Tu-M2-PK and CA19-9 in Pancreatic Cancer

    DEFF Research Database (Denmark)

    Joergensen, Maiken Thyregod; Heegaard, Niels H H; Schaffalitzky de Muckadell, Ove B

    2009-01-01

    because of suspicion of pancreatic cancer. Of these, 51 patients had their conditions diagnosed as PDAC, whereas this diagnosis was ruled out in 52 after 12 months of follow-up. The performance of Tu-M2-PK was compared with that of CA19-9 using cutoff values 15 and 37 U/mL, respectively. RESULTS......OBJECTIVES:: The performance of the 2 tumor markers carbohydrate antigen 19-9 (CA19-9) and tumor M2 pyruvate kinase (Tu-M2-PK) separately and in combination detecting pancreatic ductal adenocarcinoma (PDAC) was evaluated in a prospective study. METHODS:: The study comprised 103 patients referred...... alone. The presence of chronic pancreatitis or jaundice causes increased levels of CA19-9 but does not influence Tu-M2-PK. CONCLUSIONS:: Tu-M2-PK was inferior to CA19-9 as marker of PDAC. Tu-M2-PK may have a role in diagnosing PDAC because it is not affected by cholestasis or Lewis phenotype. Neither...

  4. Production of radio-gold {sup 199}Au for diagnostic and therapeutic applications

    Energy Technology Data Exchange (ETDEWEB)

    Khandaker, Mayeen Uddin, E-mail: mu-khandaker@um.edu.my; Kassim, Hasan Abu, E-mail: hasanak@um.edu.my [Department of Physics, University of Malaya, 50603 Kuala Lumpur (Malaysia); Haba, Hiromitsu, E-mail: haba@riken.jp [Nishina Center for Accelerator-Based Science, RIKEN, Wako, Saitama 351-0198 (Japan)

    2016-01-22

    Production cross-sections of the {sup nat}Pt(d,x){sup 199}Au reactions have been measured from a 24-MeV deuteron energy down to the threshold by using a stacked-foil activation technique combined with HPGe γ-ray spectrometry. Only a partial agreement is obtained with the existing literature data. Theoretical data extracted from the TENDL-2013 library shows large discrepancy with the measured ones. Physical thick target yield for the {sup 199}Au radionuclide was deduced using the measured cross-sections, and found a general agreement with the directly measured yield available in the literature. This study reveals that a low deuteron energy (<15 MeV) cyclotron and an enriched {sup 198}Pt (100%) target could be used to obtain {sup 199}Au in no carrier added form.

  5. Production of radio-gold 199Au for diagnostic and therapeutic applications

    Science.gov (United States)

    Khandaker, Mayeen Uddin; Haba, Hiromitsu; Kassim, Hasan Abu

    2016-01-01

    Production cross-sections of the natPt(d,x)199Au reactions have been measured from a 24-MeV deuteron energy down to the threshold by using a stacked-foil activation technique combined with HPGe γ-ray spectrometry. Only a partial agreement is obtained with the existing literature data. Theoretical data extracted from the TENDL-2013 library shows large discrepancy with the measured ones. Physical thick target yield for the 199Au radionuclide was deduced using the measured cross-sections, and found a general agreement with the directly measured yield available in the literature. This study reveals that a low deuteron energy (<15 MeV) cyclotron and an enriched 198Pt (100%) target could be used to obtain 199Au in no carrier added form.

  6. Streptococcus pneumoniae clonal complex 199: genetic diversity and tissue-specific virulence.

    Directory of Open Access Journals (Sweden)

    Jonathan C Thomas

    2011-04-01

    Full Text Available Streptococcus pneumoniae is an important cause of otitis media and invasive disease. Since introduction of the heptavalent pneumococcal conjugate vaccine, there has been an increase in replacement disease due to serotype 19A clonal complex (CC199 isolates. The goals of this study were to 1 describe genetic diversity among nineteen CC199 isolates from carriage, middle ear, blood, and cerebrospinal fluid, 2 compare CC199 19A (n = 3 and 15B/C (n = 2 isolates in the chinchilla model for pneumococcal disease, and 3 identify accessory genes associated with tissue-specific disease among a larger collection of S. pneumoniae isolates. CC199 isolates were analyzed by comparative genome hybridization. One hundred and twenty-seven genes were variably present. The CC199 phylogeny split into two main clades, one comprised predominantly of carriage isolates and another of disease isolates. Ability to colonize and cause disease did not differ by serotype in the chinchilla model. However, isolates from the disease clade were associated with faster time to bacteremia compared to carriage clade isolates. One 19A isolate exhibited hypervirulence. Twelve tissue-specific genes/regions were identified by correspondence analysis. After screening a diverse collection of 326 isolates, spr0282 was associated with carriage. Four genes/regions, SP0163, SP0463, SPN05002 and RD8a were associated with middle ear isolates. SPN05002 also associated with blood and CSF, while RD8a associated with blood isolates. The hypervirulent isolate's genome was sequenced using the Solexa paired-end sequencing platform and compared to that of a reference serotype 19A isolate, revealing the presence of a novel 20 kb region with sequence similarity to bacteriophage genes. Genetic factors other than serotype may modulate virulence potential in CC199. These studies have implications for the long-term effectiveness of conjugate vaccines. Ideally, future vaccines would target common

  7. Flavopiridol enhances ABT-199 sensitivity in unfavourable-risk multiple myeloma cells in vitro and in vivo.

    Science.gov (United States)

    Zhou, Liang; Zhang, Yu; Sampath, Deepak; Leverson, Joel; Dai, Yun; Kmieciak, Maciej; Nguyen, Matthew; Orlowski, Robert Z; Grant, Steven

    2017-12-14

    The BCL-2-specific BH3-mimetic ABT-199 (venetoclax) has been reported to be principally active against favourable-risk multiple myeloma (MM) cells, prompting efforts to extend its activity to include more resistant, higher-risk MM subsets. Effects of the CDK9 inhibitor flavopiridol (FP; alvocidib) on responses to ABT-199 were examined in MM cells. Cell death and protein expression were evaluated by western blot and immunofluorescence. Xenograft models were used to study combination effects in vivo. FP synergistically increased ABT-199 lethality in both ABT-199-sensitive and insensitive MM cells. FP blocked CDK9 activation/positive transcription elongation factor B phosphorylation, downregulated MCL-1, increased BCL-2/MCL-1 ratios, and upregulated BIM. MCL-1 ectopic expression or knockdown in MM cells significantly diminished or increased ABT-199 sensitivity, respectively. CDK9 knockdown triggered MCL-1 downregulation and increased ABT-199 activity, whereas BIM knockdown significantly reduced FP/ABT-199 lethality. FP also enhanced ABT-199 lethality in unfavourable prognosis primary MM cells. HS-5 cell co-culture failed to protect MM cells from the FP/ABT-199 regimen, suggesting circumvention of microenvironmental signals. Finally, FP/ABT-199 significantly increased survival in systemic xenograft and immune-competent MM models while exhibiting minimal toxicity. These findings argue that CDK9 inhibitors, for example, FP may increase the antimyeloma activity of ABT-199, including in unfavourable-risk MM minimally responsive to ABT-199 alone.British Journal of Cancer advance online publication, 14 December 2017; doi:10.1038/bjc.2017.432 www.bjcancer.com.

  8. Enhanced discrimination of malignant from benign pancreatic disease by measuring the CA 19-9 antigen on specific protein carriers.

    Directory of Open Access Journals (Sweden)

    Tingting Yue

    Full Text Available The CA 19-9 assay detects a carbohydrate antigen on multiple protein carriers, some of which may be preferential carriers of the antigen in cancer. We tested the hypothesis that the measurement of the CA 19-9 antigen on individual proteins could improve performance over the standard CA 19-9 assay. We used antibody arrays to measure the levels of the CA 19-9 antigen on multiple proteins in serum or plasma samples from patients with pancreatic adenocarcinoma or pancreatitis. Sample sets from three different institutions were examined, comprising 531 individual samples. The measurement of the CA 19-9 antigen on any individual protein did not improve upon the performance of the standard CA 19-9 assay (82% sensitivity at 75% specificity for early-stage cancer, owing to diversity among patients in their CA 19-9 protein carriers. However, a subset of cancer patients with no elevation in the standard CA 19-9 assay showed elevations of the CA 19-9 antigen specifically on the proteins MUC5AC or MUC16 in all sample sets. By combining measurements of the standard CA 19-9 assay with detection of CA 19-9 on MUC5AC and MUC16, the sensitivity of cancer detection was improved relative to CA 19-9 alone in each sample set, achieving 67-80% sensitivity at 98% specificity. This finding demonstrates the value of measuring glycans on specific proteins for improving biomarker performance. Diagnostic tests with improved sensitivity for detecting pancreatic cancer could have important applications for improving the treatment and management of patients suffering from this disease.

  9. CA 19-9 as a serum marker in urothelial carcinoma

    Directory of Open Access Journals (Sweden)

    Mahander Pall

    2012-01-01

    Conclusions: Serum CA19-9 is a marker of aggressiveness of urothelial carcinoma and is almost invariably raised in patients with metastatic disease. Thus, it may be used as a prognostic marker but not as a screening tool due to its low sensitivity.

  10. 46 CFR 199.160 - Rescue boat embarkation, launching and recovery arrangements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Rescue boat embarkation, launching and recovery... Vessels § 199.160 Rescue boat embarkation, launching and recovery arrangements. (a) Each rescue boat must... be used to meet this requirement. (b) Each rescue boat embarkation and launching arrangement must...

  11. 46 CFR 199.220 - Survival craft and rescue boat embarkation arrangements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft and rescue boat embarkation arrangements... Passenger Vessels § 199.220 Survival craft and rescue boat embarkation arrangements. (a) Survival craft... rescue boat must be able to be boarded and launched directly from the stowed position with the number of...

  12. Flexible and Versatile as a Chameleon—Sophisticated Functions of microRNA-199a

    Directory of Open Access Journals (Sweden)

    Shen Gu

    2012-07-01

    Full Text Available Although widely studied in the past decade, our knowledge of the functional role of microRNAs (miRNAs remains limited. Among the many miRNAs identified in humans, we focus on miR-199a due to its varied and important functions in diverse models and systems. Its expression is finely regulated by promoter methylation and direct binding of transcription factors such as TWIST1. During tumorigenesis, depending on the nature of the cancer, miR-199a, especially its -3p mature form, may act as either a potential tumor suppressor or an oncogene. Its 5p mature form has been shown to protect cardiomyocytes from hypoxic damage via its action on HIF1α. It also has a functional role in stem cell differentiation, embryo development, hepatitis, liver fibrosis, etc. Though it has varied biological activities, its regulation has not been reviewed. The varied and protean functions of miR-199a suggest that efforts to generalize the action of a miRNA are problematic. This review provides a comprehensive survey of the literature on miR-199a as an example of the complexity of miRNA biology and suggests future directions for miRNA research.

  13. 49 CFR 40.199 - What problems always cause a drug test to be cancelled?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false What problems always cause a drug test to be... TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Problems in Drug Tests § 40.199 What problems always cause a drug test to be cancelled? (a) As the MRO, when the laboratory discovers a “fatal flaw” during...

  14. The experimental structure of199Au and the interacting boson-fermion model

    Science.gov (United States)

    Mayerhofer, Ulrich; von Egidy, T.; Jolie, J.; Börner, H. G.; Colvin, G.; Judge, S.; Krusche, B.; Robinson, S. J.; Schreckenbach, K.; Brant, S.; Paar, V.

    1991-03-01

    Gamma rays of199Au obtained after double neutron capture in197Au were measured at the ILL high flux reactor. A level scheme up to 1770 keV excitation energy is established. The result is compared with IBFM and Boson-Fermion-Symmetry calculations.

  15. Utility of CT Scan and CA 19-9 in Predicting Non –Resectability in ...

    African Journals Online (AJOL)

    Methods: Eligible consenting patients were recruited. All had a CT scan of the abdomen and serum CA 19-9 levels determined preoperatively and staging was done using the LRCC criteria. At surgery, intraoperative findings were then compared in terms of non-resectability with the preoperative CT scan prediction and the ...

  16. 30 CFR 250.199 - Paperwork Reduction Act statements-information collection.

    Science.gov (United States)

    2010-07-01

    ... and Gas and Drilling Operations (1010-0141), including Forms MMS-123, Application for Permit to Drill... the equipment and procedures to be used in drilling operations on the OCS. To ensure that drilling... OFFSHORE OIL AND GAS AND SULPHUR OPERATIONS IN THE OUTER CONTINENTAL SHELF General References § 250.199...

  17. 14 CFR 61.199 - Reinstatement requirements of an expired flight instructor certificate.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Reinstatement requirements of an expired... GROUND INSTRUCTORS Flight Instructors Other than Flight Instructors With a Sport Pilot Rating § 61.199 Reinstatement requirements of an expired flight instructor certificate. (a) Flight instructor certificates. The...

  18. A measurement of the neutron to 199Hg magnetic moment ratio

    Directory of Open Access Journals (Sweden)

    S. Afach

    2014-12-01

    Full Text Available The neutron gyromagnetic ratio has been measured relative to that of the 199Hg atom with an uncertainty of 0.8 ppm. We employed an apparatus where ultracold neutrons and mercury atoms are stored in the same volume and report the result γn/γHg=3.8424574(30.

  19. Reduced Limit on the Permanent Electric Dipole Moment of $^{199}$Hg

    CERN Document Server

    Graner, B; Lindahl, E G; Heckel, B R

    2016-01-01

    This paper describes the results of the most recent measurement of the permanent electric dipole moment (EDM) of neutral $^{199}$Hg atoms. Fused silica vapor cells containing enriched $^{199}$Hg are arranged in a stack in a common magnetic field. Optical pumping is used to spin-polarize the atoms orthogonal to the applied magnetic field, and the Faraday rotation of near-resonant light is observed to determine an electric-field-induced perturbation to the Larmor precession frequency. Our results for this frequency shift are consistent with zero; we find the corresponding $^{199}$Hg EDM $d_{Hg} = (-2.20 \\pm 2.75_{stat} \\pm 1.48_{syst}) \\times 10^{-30} e\\cdot \\text{cm}$. We use this result to place a new upper limit on the $^{199}$Hg EDM $|d_{Hg}| < 7.4\\times 10^{-30} e\\cdot \\text{cm}$ (95\\% C.L.), improving our previous limit by a factor of 4. We also discuss the implications of this result for various $CP$-violating observables as they relate to theories of physics beyond the standard model.

  20. Comparison of two different methods for CA19-9 antigen determination.

    Science.gov (United States)

    Deinzer, Martina; Faissner, Ralf; Metzger, Tobias; Kaminski, Wolfgang E; Löhr, Mathias; Neumaier, Michael; Brinkmann, Thomas

    2010-01-01

    This study was designed to investigate the clinical performance of the Access GI Monitor (Beckman Coulter) on the UniCel DxI 800, a method for CA19-9 antigen determination, and to compare with CA19-9 assay on the AxSYM system (Abbott). 1,063 serum samples from unselected patients with different underlying diagnoses were tested with both methods. Passing-Bablok regression analysis and Bland Altman analysis was performed. In addition, using ROC analysis, the distribution of Access GI Monitor and AxSYM CA19-9 antigen levels was tested in patients with pancreatic cancer (n = 50), acute inflammatory disease (n = 20), and with chronic inflammation of the pancreatic gland (n = 18). Furthermore, four patients with pancreatic cancer were monitored individually in their courses of the disease (before, during, and after therapeutic procedures) to compare their CA19-9 values with regard to inter-method concordance. Passing-Bablok analysis showed a systematic difference with R = 0.93, slope 0.75, and intercept -1.0. Bland Altman analysis showed a wide scatter of relative differences between both methods, especially in the low end measuring range. In the selected group of patients with pancreatic diseases the analysis of concordance revealed 95.5 % agreement between both methods with a comparable area under the ROC curves (0.73 vs. 0.76). A clear concordance was found for all four selected patients. Although we found significant systematic measuring variations in the global analysis, the two different automated methods for the quantitative determination of CA19-9 antigen were comparable with respect to their clinical accuracy and applicability to support decision making in the management of pancreatic cancer.

  1. 19 CFR 10.199 - Duty-free entry for certain beverages produced in Canada from Caribbean rum.

    Science.gov (United States)

    2010-04-01

    ... Canada from Caribbean rum. 10.199 Section 10.199 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION... customs territory of the United States from Canada; and the rum used in its production must have been... Islands. (1) “Imported directly” into the customs territory of the United States from Canada means: (i...

  2. Comparison of circulating MMP-9, TIMP-1 and CA19-9 in the detection of pancreatic cancer

    DEFF Research Database (Denmark)

    Joergensen, Maiken Thyregod; Brünner, Nils; De Muckadell, Ove B Schaffalitzky

    2010-01-01

    adenocarcinoma. PATIENTS AND METHODS: The patients had symptoms of pancreatic cancer. The discriminative strength of MMP-9 and TIMP-1 were compared to that of CA19-9 using receiver operating characteristics curves, area under the curves (AUC), specificity and sensitivity. RESULTS: The sensitivities of MMP-9......Background/Aim: The performance of the circulating tumor markers carbohydrate antigen 19-9 (CA19-9), matrix metalloproteinase 9 (MMP-9) and tissue inhibitor of metalloproteinase 1 (TIMP-1) were evaluated separately and in combination for their potential value in detecting pancreatic ductal......, TIMP-1 and CA19-9 in detecting pancreatic ductal adenocarcinoma were 58.82%, 47.1% and 86%, respectively, with specificities of 34.6%, 69.2% and 73%. The AUCs of MMP-9, TIMP-1 and CA19-9 were 0.50, 0.64 and 0.84, respectively. Combining the three markers did not significantly improve detection...

  3. Inflammation But Not Biliary Obstruction Is Associated With Carbohydrate Antigen 19-9 Levels in Patients With Primary Sclerosing Cholangitis.

    Science.gov (United States)

    Wannhoff, Andreas; Rupp, Christian; Friedrich, Kilian; Brune, Maik; Knierim, Johannes; Flechtenmacher, Christa; Sauer, Peter; Stremmel, Wolfgang; Hov, Johannes R; Schirmacher, Peter; Weiss, Karl Heinz; Gotthardt, Daniel N

    2015-12-01

    Assays that measure the serum level of carbohydrate antigen 19-9 (CA19-9) are used to screen patients with primary sclerosing cholangitis (PSC) for malignancies. However, in patients with PSC, cholestasis, and bacterial cholangitis, the CA19-9 level can be affected by variants in the fucosyltransferases 2 and 3 genes (FUT2 and FUT3), which regulate the production of CA19-9. We investigated how these genotypes affect cancer screening in these patients. We performed a retrospective analysis of data from 209 patients with PSC (19 patients with biliary malignancy, 23 patients with cholestasis and bacterial cholangitis) treated at the University Hospital Heidelberg from 1987 through 2014. We collected data on the maximum serum level of CA19-9; laboratory measures of cholestasis or inflammation; the presence of dominant stenosis, cholestasis, and bacterial cholangitis; and FUT2 and FUT3 genotypes. Patients were assigned to intermediate (n = 161) or high (n = 48) CA19-9 biosynthesis groups, based on FUT2 and FUT3 genotypes. Patients incapable of CA19-9 biosynthesis, based on genetic features, were excluded. The median level of CA19-9 was 31.1 U/mL in cancer-free patients. The CA19-9 level correlated with the level of C-reactive protein (P cholangitis (7.8 U/mL), followed by patients with only obstruction (28.0 U/mL), and then patients with cholestasis and bacterial cholangitis (77.0 U/mL and 205.4 U/mL in patients without or with concomitant obstruction, respectively). The greatest increase in CA19-9 as a result of cholestasis and bacterial cholangitis was observed in patients in the high CA19-9 biosynthesis group. In patients with PSC, cholestasis has little effect on the level of CA19-9, but cholestasis and bacterial cholangitis increase the level. Their effects on CA19-9 level depend on the FUT2 and FUT3 genotype. These findings support the analysis of FUT2 and FUT3 genotype during follow-up evaluation of patients with PSC. Copyright © 2015 AGA Institute. Published by

  4. Page 1 Flow and heat transfer for an electrically conducting fluid 199 ...

    Indian Academy of Sciences (India)

    Flow and heat transfer for an electrically conducting fluid 199 ... 2 Os. His 10, Br is 10, Ks 0, ReP = -100. O-9. O O.3 O4. O6 O 8 O g. Figure 8. Bulk temperature an Nusselt number versus axial distance (constant wall tempe- rature. 2-S Sa O. 2.O n = 0.5, Br = 10, Rap s -10-0. O O.2 O. 4 O.6 O-8 d. Figure 9. Bulk temperature ...

  5. Adjusting CA19-9 values to predict malignancy in obstructive jaundice: Influence of bilirubin and C-reactive protein

    Science.gov (United States)

    La Greca, Gaetano; Sofia, Maria; Lombardo, Rosario; Latteri, Saverio; Ricotta, Agostino; Puleo, Stefano; Russello, Domenico

    2012-01-01

    AIM: To find a possible relationship between inflammation and CA19-9 tumor marker by analyzing data from patients with benign jaundice (BJ) and malignant jaundice (MJ). METHODS: All patients admitted for obstructive jaundice, in the period 2005-2009, were prospectively enrolled in the study, obtaining a total of 102 patients. On admission, all patients underwent complete standard blood test examinations including C-reactive protein (CRP), bilirubin, CA19-9. Patients were considered eligible for the study when they presented obstructive jaundice confirmed by instrumental examinations and increased serum bilirubin levels (total bilirubin > 2.0 mg/dL). The standard cut-off level for CA19-9 was 32 U/mL, whereas for CRP this was 1.5 mg/L. The CA19-9 level was adjusted by dividing it by the value of serum bilirubin or by the CRP value. The patients were divided into 2 groups, MJ and BJ, and after the adjustment a comparison between the 2 groups of patients was performed. Sensitivity, specificity and positive predictive values were calculated before and after the adjustment. RESULTS: Of the 102 patients, 51 were affected by BJ and 51 by MJ. Pathologic CA19-9 levels were found in 71.7% of the patients. In the group of 51 BJ patients there were 29 (56.9%) males and 22 (43.1%) females with a median age of 66 years (range 24-96 years), whereas in the MJ group there were 24 (47%) males and 27 (53%) females, with a mean age of 70 years (range 30-92 years). Pathologic CA19-9 serum level was found in 82.3% of MJ. CRP levels were pathologic in 66.6% of the patients with BJ and in 49% with MJ. Bilirubin and CA19-9 average levels were significantly higher in MJ compared with BJ (P = 0.000 and P = 0.02), while the CRP level was significantly higher in BJ (P = 0.000). Considering a CA19-9 cut-off level of 32 U/mL, 82.3% in the MJ group and 54.9% in the BJ group were positive for CA19-9 (P = 0.002). A CA19-9 cut-off of 100 U/mL increases the difference between the two groups: 35.3% in

  6. Glycoprotein CA19.9-specific monoclonal antibodies recognize sialic acid-independent glycotope.

    Science.gov (United States)

    Chugh, Manoj; Piskarev, Vladimir; Galanina, Oxana; Khasbiullina, Nailya; Kadam, Pallavi; Shilova, Nadezhda; Pazynina, Galina; Dobrochaeva, Kira; Bhanushali, Paresh; Kozlov, Nikolay; Tupitsin, Nikolay; Bovin, Nicolai

    2017-10-01

    A repertoire of monoclonal antibodies was generated by immunization of mice with cancer-associated glycoprotein CA19.9, and two of them were selected as optimal capture and detecting counterparts for sandwich test system for detection of CA19.9. Fine epitope specificity of the antibodies was determined using printed glycan array, enzyme-linked immunosorbent assay, and inhibitory enzyme-linked immunosorbent assay. Unexpectedly, both immunoglobulins did not bind key epitope of CA19.9 glycoprotein, tetrasaccharide SiaLeA, as well as its defucosylated form sialyl LeC (known as CA-50 epitope). The antibodies were found to have different glycan-binding profiles; however, they recognized similar glycotopes with common motif Galβ1-3GlcNAcβ (LeC), thus resembling specificity of human natural cancer-associated anti-LeC antibodies. We propose that cancer-specific glycopeptide epitope includes Galβ1-3GlcNAcβ fragment of a glycoprotein O-chain in combination with proximal hydrophobic amino acid(s) of the polypeptide chain.

  7. Orientation of /sup 199m/Hg by optical pumping detected by gamma - radiation anisotropy

    CERN Document Server

    Bonn, J; Kluge, H J; Lode, D; Otten, E W

    1975-01-01

    /sup 199m/Hg was produced and mass separated at the ISOLDE facility (CERN). Nuclear orientation achieved by optical pumping via the resonance line 6s/sup 2/ /sup 1/S/sub 0/ to 6S6p/sup 3/P/sub 1/, lambda =2537 AA was monitored by means of the anisotropy of the gamma -radiation emitted in the cascade /sup 199m/Hg(I=13/2/sup +/) to /sup 191/Hg(I=5/2/sup -/) to /sup 199/Hg(I=1/2/sup -/). Maximum anisotropies of 35% (2,8%) were found in the M4(E2) transition. A Zeeman scanning of the /sup 3/P/sub 1/ state yielded the positions of F=13/2 and the F=15/2 hfs components relative to the reference isotope /sup 204/Hg at 15.13(15) GHz and -2.86(15) GHz respectively. Isotopic shift and the quadrupole interaction constant were deduced from these values using the known A factor. From the B factor the spectroscopic quadruplment was calculated as Q/sub s/=1.54(44) barn. (30 refs).

  8. Elevated plasma gastrin, CEA, and CA 19-9 levels decrease after colorectal cancer resection.

    Science.gov (United States)

    Bombski, G; Gasiorowska, A; Orszulak-Michalak, D; Neneman, B; Kotynia, J; Strzelczyk, J; Janiak, A; Malecka-Panas, E

    2003-03-01

    Gastrin stimulates mucosal growth of much of the gastrointestinal tract and has also been implicated in promoting growth of colonic tumors, but its role in colorectal carcinogenesis remains controversial. This study determined fasting serum gastrin levels before and after surgery for colorectal cancer (CRC) and the relationship to the clinical stage of the disease to investigate it possible prognostic role. Fasting radioimmunoassay gastrin, CA 19-9, and CEA levels were measured before and after surgery for CRC. Helicobacter pylori status was also assessed since it causes significant hypergastrinemia. Mean fasting plasma gastrin level was significantly higher in CRC patients than in controls before surgery but not 59 days after surgery. Mean CEA and CA 19-9 levels were significantly higher in patients with CRC before surgery than after tumor resection. There was a significant positive correlation between the plasma gastrin, CEA, and CA 19-9 levels and the CRC stage (Dukes' classification). The significance of gastrin as a marker for diagnosis or prognostic purposes in colorectal cancer needs to be further examined.

  9. Marcador tumoral CA 19.9 aumentado sin evidencia de malignidad Elevated Ca 19.9 tumor marker without evidence of malignancy

    Directory of Open Access Journals (Sweden)

    Eduardo González Bosquet

    2007-06-01

    Full Text Available Los marcadores tumorales son de gran utilidad clínica en el seguimiento de los pacientes oncológicos. Su papel en el diagnóstico de tumoraciones malignas es controvertido. Presentamos un caso de una mujer con un quiste ovárico benigno en la cual los marcadores aumentan de forma inexplicable después de la extirpación del mismo.Tumor markers are a useful tool for surveillance of oncologic patients, whereas their role in the diagnosis of a malignancy is controversial. We present the case of a woman with a benign ovarian cyst with an unexpected elevation of Ca 19.9 after laparoscopic bilateral anexectomy.

  10. Persistent High Level of Urinary Tumor Marker Carbohydrate Antigen 19-9 in Prenatally Diagnosed Dysplastic Kidney

    Directory of Open Access Journals (Sweden)

    Reza Khorramirouz

    2014-01-01

    Full Text Available Tumor marker carbohydrate antigen 19-9 (CA 19-9 level has gained clinical significance in gastrointestinal malignancies and in various solid and cystic diseases. Dysplastic kidney is a congenital abnormality resulting from atresia of the ureteral bud during the embryogenesis which can be unilateral or bilateral. We report unilateral dysplastic kidney with extremely large cyst diagnosed by routine ultrasonography in the 32nd week of gestational age with high levels of CA 19-9 in cystic and amniotic fluid, as well as persistent high urinary levels of this tumor marker during the 1-year follow-up. Persistent high urinary CA 19-9 level even after cyst aspiration may be attributable to remained function of dysplastic kidney due to remained epithelial lining.

  11. Exploration of the value of MRCP combined with tumor marker CA19-9 in the diagnosis of pancreatic cancer.

    Science.gov (United States)

    Ma, Shaojun; Duan, Jutao; Li, Weizhi; Zhang, He; Hou, Zhenyu

    2016-01-01

    This paper aims to provide an effective, accurate, and specific diagnostic method for the diagnosis of pancreatic cancer. It discusses the diagnostic value of magnetic res retrograde cholangiopancreatography (MRCP) combined with the detection of tumor marker carbohydrate antigen 19-9 (CA19-9) for pancreatic cancer. A group of confirmed cases of pancreatic cancer in some hospitals were randomly selected and subjected to an MRCP examination as well as serological CA19-9 detection. In addition, a group of patients whose pancreatic cancer was confirmed by surgery and pathology, and who underwent MRCP without the detection of the tumor marker CA19-9, were also selected for research. The experiment found that the rate of accuracy for the group that underwent MRCP combined with CA19-9 detection showed a higher positive value in the diagnosis of pancreatic cancer than in the group that underwent MRCP alone. Therefore, this paper proposes that MRCP combined with CA19-9 detection can be taken as the reliable and effective means for diagnosis of pancreatic cancer.

  12. Diagnostic and Prognostic Impact of Circulating YKL-40, IL-6, and CA 19.9 in Patients with Pancreatic Cancer.

    Directory of Open Access Journals (Sweden)

    Nicolai A Schultz

    Full Text Available We tested the hypothesis that high plasma YKL-40 and IL-6 associate with pancreatic cancer and short overall survival.In all, 559 patients with pancreatic cancer from prospective biomarker studies from Denmark (n = 448 and Germany (n = 111 were studied. Plasma YKL-40 and IL-6 were determined by ELISAs and serum CA 19.9 by chemiluminescent immunometric assay.Odds ratios (ORs for prediction of pancreatic cancer were significant for all biomarkers, with CA 19.9 having the highest AUC (CA 19.9: OR = 2.28, 95% CI 1.97 to 2.68, p<0.0001, AUC = 0.94; YKL-40: OR = 4.50, 3.99 to 5.08, p<0.0001, AUC = 0.87; IL-6: OR = 3.68, 3.08 to 4.44, p<0.0001, AUC = 0.87. Multivariate Cox analysis (YKL-40, IL-6, CA 19.9, age, stage, gender in patients operated on showed that high preoperative IL-6 and CA 19.9 (dichotomized according to normal values were independently associated with short overall survival (CA 19.9: HR = 2.51, 1.22-5.15, p = 0.013; IL-6: HR = 2.03, 1.11 to 3.70, p = 0.021. Multivariate Cox analysis of non-operable patients (Stage IIB-IV showed that high pre-treatment levels of each biomarker were independently associated with short overall survival (YKL-40: HR = 1.30, 1.03 to 1.64, p = 0.029; IL-6: HR = 1.71, 1.33 to 2.20, p<0.0001; CA 19.9: HR = 1.54, 1.06 to 2.24, p = 0.022. Patients with preoperative elevation of both IL-6 and CA 19.9 had shorter overall survival (p<0.005 compared to patients with normal levels of both biomarkers (45% vs. 92% alive after 12 months.Plasma YKL-40 and IL-6 had less diagnostic impact than CA 19.9. Combination of pretreatment YKL-40, IL-6, and CA 19.9 may have clinical value to identify pancreatic cancer patients with the poorest prognosis.

  13. α-decay studies of the francium isotopes 198Fr and 199Fr

    Science.gov (United States)

    Uusitalo, J.; Sarén, J.; Juutinen, S.; Leino, M.; Eeckhaudt, S.; Grahn, T.; Greenlees, P. T.; Jakobsson, U.; Jones, P.; Julin, R.; Ketelhut, S.; Leppänen, A.-P.; Nyman, M.; Pakarinen, J.; Rahkila, P.; Scholey, C.; Semchenkov, A.; Sorri, J.; Steer, A.; Venhart, M.

    2013-06-01

    Very neutron deficient francium isotopes have been produced in fusion evaporation reactions using 60Ni ions on 141Pr targets. The gas-filled recoil separator RITU was employed to collect the fusion products and to separate them from the scattered beam. The activities were implanted into a position sensitive silicon detector after passing through a gas-counter system. The isotopes were identified using spatial and time correlations between the implants and the decays. Two α-particle activities, with Eα=7613(15) keV and T1/2 = (15-5+12) ms and Eα=7684(15) keV and T1/2 = (16-5+13) ms were identified in the new isotope 198Fr. In addition, the half-life and α-particle energy of 199Fr were measured with improved precision. The measured decay properties deduced for 199Fr and 198Fr suggest that there is an onset of ground-state deformation at N=112 in the Fr isotopes.

  14. ABT-199, a potent and selective BCL-2 inhibitor, achieves antitumor activity while sparing platelets.

    Science.gov (United States)

    Souers, Andrew J; Leverson, Joel D; Boghaert, Erwin R; Ackler, Scott L; Catron, Nathaniel D; Chen, Jun; Dayton, Brian D; Ding, Hong; Enschede, Sari H; Fairbrother, Wayne J; Huang, David C S; Hymowitz, Sarah G; Jin, Sha; Khaw, Seong Lin; Kovar, Peter J; Lam, Lloyd T; Lee, Jackie; Maecker, Heather L; Marsh, Kennan C; Mason, Kylie D; Mitten, Michael J; Nimmer, Paul M; Oleksijew, Anatol; Park, Chang H; Park, Cheol-Min; Phillips, Darren C; Roberts, Andrew W; Sampath, Deepak; Seymour, John F; Smith, Morey L; Sullivan, Gerard M; Tahir, Stephen K; Tse, Chris; Wendt, Michael D; Xiao, Yu; Xue, John C; Zhang, Haichao; Humerickhouse, Rod A; Rosenberg, Saul H; Elmore, Steven W

    2013-02-01

    Proteins in the B cell CLL/lymphoma 2 (BCL-2) family are key regulators of the apoptotic process. This family comprises proapoptotic and prosurvival proteins, and shifting the balance toward the latter is an established mechanism whereby cancer cells evade apoptosis. The therapeutic potential of directly inhibiting prosurvival proteins was unveiled with the development of navitoclax, a selective inhibitor of both BCL-2 and BCL-2-like 1 (BCL-X(L)), which has shown clinical efficacy in some BCL-2-dependent hematological cancers. However, concomitant on-target thrombocytopenia caused by BCL-X(L) inhibition limits the efficacy achievable with this agent. Here we report the re-engineering of navitoclax to create a highly potent, orally bioavailable and BCL-2-selective inhibitor, ABT-199. This compound inhibits the growth of BCL-2-dependent tumors in vivo and spares human platelets. A single dose of ABT-199 in three patients with refractory chronic lymphocytic leukemia resulted in tumor lysis within 24 h. These data indicate that selective pharmacological inhibition of BCL-2 shows promise for the treatment of BCL-2-dependent hematological cancers.

  15. Comparison of leaf proteomes of cassava (Manihot esculenta Crantz) cultivar NZ199 diploid and autotetraploid genotypes.

    Science.gov (United States)

    An, Feifei; Fan, Jie; Li, Jun; Li, Qing X; Li, Kaimian; Zhu, Wenli; Wen, Feng; Carvalho, Luiz J C B; Chen, Songbi

    2014-01-01

    Cassava polyploid breeding has drastically improved our knowledge on increasing root yield and its significant tolerance to stresses. In polyploid cassava plants, increases in DNA content highly affect cell volumes and anatomical structures. However, the mechanism of this effect is poorly understood. The purpose of the present study was to compare and validate the changes between cassava cultivar NZ199 diploid and autotetraploid at proteomic levels. The results showed that leaf proteome of cassava cultivar NZ199 diploid was clearly differentiated from its autotetraploid genotype using 2-DE combined MS technique. Sixty-five differential protein spots were seen in 2-DE image of autotetraploid genotype in comparison with that of diploid. Fifty-two proteins were identified by MALDI-TOF-MS/MS, of which 47 were up-regulated and 5 were down-regulated in autotetraploid genotype compared with diploid genotype. The classified functions of 32 up-regulated proteins were associated with photosynthesis, defense system, hydrocyanic acid (HCN) metabolism, protein biosynthesis, chaperones, amino acid metabolism and signal transduction. The remarkable variation in photosynthetic activity, HCN content and resistance to salt stress between diploid and autotetraploid genotypes is closely linked with expression levels of proteomic profiles. The analysis of protein interaction networks indicated there are direct interactions between the 15 up-regulation proteins involved in the pathways described above. This work provides an insight into understanding the protein regulation mechanism of cassava polyploid genotype, and gives a clue to improve cassava polyploidy breeding in increasing photosynthesis and resistance efficiencies.

  16. Colorectal carcinoma: nucleosomes, carcinoembryonic antigen and ca 19-9 as apoptotic markers; a comparative study

    Directory of Open Access Journals (Sweden)

    Mahgoub Samir S

    2011-07-01

    Full Text Available Abstract Background Colorectal carcinoma is a common and often fatal disease in which methods of early detection and monitoring are essential. The present study was conducted for measuring serum levels of nucleosomes, carcinoembryonic antigen (CEA and CA 19-9 in patients newly diagnosed with colorectal carcinoma and confirmed by clinicopathological study. Method Thirty subjects were included in the current study: six normal subjects as a control group with mean age (45.6 ± 7.9 and twenty four colorectal carcinoma patients with mean age (46.9 ± 15.6, which were classified pathologically according to the degree of malignant cell differentiation into well differentiated (group I, moderately differentiated (group II and poorly differentiated (group III. Fasting venous blood samples were collected preoperative. Results The results revealed a significant increase in serum level of nucleosomes in patients with poorly differentiated tumors versus patients with well differentiated tumors (p = 0.041. The levels of CEA and CA19-9 showed no significant increase (p = 0.569 and 0.450, respectively. Conclusion In conclusion, serum level of nucleosomes provides a highly sensitive and specific apoptotic marker for colorectal carcinoma.

  17. Diagnostic value of CA 19-9 in pregnancies complicated by spinal neural tube defects: a preliminary study.

    Science.gov (United States)

    Timur, Hakan; Tokmak, Aytekin; Yucel, Aykan; Ali Inal, Hasan; Buyukkagnici, Umran; Sirvan, Levent; Danisman, Nuri

    2016-01-01

    Various physiological and pathological conditions can induce significant variations in plasma concentrations of tumor markers, such as CA 19-9, which is present in the serum and amniotic fluid of pregnant women. Herein, we aimed to determine the clinical importance of maternal serum CA 19-9 levels in the diagnosis of neural tube defects (NTDs). A total of 100 women were included in this controlled cross-sectional study. Thirty-three patients whose pregnancies were complicated by isolated meningocele or meningomyelocele constituted the study group, whereas 33 normal, healthy pregnant women constituted the control group, and 34 age- and body mass index (BMI)-matched non-pregnant women were chosen for the validation group. The mean maternal serum CA 19-9 levels were 17.2 ± 17.0 IU/mL, 7.1 ± 5.9 IU/mL, and 4.7 ± 3.6 IU/mL in the study, control, and validation groups, respectively (p < 0.001). ROC analyses showed that elevated CA 19-9 values may predict NTDs (p < 0.001). The cut-off value for CA 19-9 was found to be 9.6 IU/mL at 70% (51%-84%, 95% CI) sensitivity and 84% (74%-92%, 95% CI) specificity. CA 19-9 may be a promising noninvasive marker for NTDs. Further studies are needed to reveal the clinical applicability and diagnostic potential of maternal serum CA 19-9 levels in the identification of NTDs.

  18. miR-199a-5p confers tumor-suppressive role in triple-negative breast cancer.

    Science.gov (United States)

    Chen, Jiawei; Shin, Vivian Y; Siu, Man T; Ho, John C W; Cheuk, Isabella; Kwong, Ava

    2016-11-14

    Triple-negative breast cancer (TNBC) remains a poor prognostic factor for breast cancer since no effective targeted therapy is readily available. Our previous studies confirmed miR-199a-5p is a TNBC-specific circulating biomarker, however, its functional roles in breast cancer is largely unknown. Thus, we investigated the functional implication of miR-199a-5p in TNBC and its potential underlying mechanisms. MTT assay was performed to investigate the cell proliferation after transient transfection of miR-199a-5p in MDA-MB-231 cell line, followed by cell cycle analysis. Transwell invasion assay and wound healing assay were used to study the invasion and migration ability respectively. To further investigate the stemness-related characteristics of miR-199a-5p in breast cancer cells, single-cell clonogenic assay and aldehyde dehydrogenase (ALDH) assay were performed. 32 normal and 100 breast cancer patients' plasma were recruited to identify the potential circulating markers by qPCR. Cell proliferation assay revealed significant inhibition after miR-199a-5p ectopic expression (p breast cancer plasma especially in TNBC (p = 0.0248). PIK3CD was identified as a potential downstream target of miR-199a-5p. Taken together, we unraveled, for the first time, the tumor-suppressive role of miR-199a-5p in TNBC, which attributed to EMT and cancer stemness properties, providing a novel therapeutic options towards this aggressive disease.

  19. Application of Joint Detection of AFP, CA19-9, CA125 and CEA in Identification and Diagnosis of Cholangiocarcinoma.

    Science.gov (United States)

    Li, Yong; Li, Da-Jiang; Chen, Jian; Liu, Wei; Li, Jian-Wei; Jiang, Peng; Zhao, Xin; Guo, Fei; Li, Xiao-Wu; Wang, Shu-Guang

    2015-01-01

    To explore the application of joint detection of serum AFP, CA19-9, CA125 and CEA in identification and diagnosis of cholangiocarcinoma (CC). The levels of serum AFP, CA19-9, CA125 and CEA of both 30 patients with CC and 30 patients with hepatocellular carcinoma (HCC) were assessed. Receiver operating characteristic (ROC) curves were used to evaluate the diagnostic effects of single and joint detection of those 4 kinds of tumor markers for CC. The levels of serum CA19-9, CA125 and CEA in CC patients were higher than that in HCC patients,whereas that of serum AFP was significantly lower s. The area under ROC curve of single detection of serum AFP, CA19-9, CA125 and CEA were 0.05, 0.86, 0.84 and 0.83, with the optimal cutoff values of 15.4 ng/ml, 125.1 U/ml, 95.7 U/ml and 25.9 ng/ml, correspondingly, and the percentage correct single diagnosis was AFP, CA19-9, CA125 and CEA was the highest, with an area under the ROC curve of 0.94 (95%CI 0.88~0.99). Single detection of serum CA19-9, CA125 and EA is not meaningful. The sensitivity, specificity, the rate of correct diagnosis and the area under ROC curve of joint detection of AFP, CA19-9, CA125 and CEA are highest, indicating that the joint detection of these 4 tumor markers is of great importance in the diagnosis of CC.

  20. Can preoperative CEA and CA19-9 serum concentrations suggest metastatic disease in colorectal cancer patients?

    Science.gov (United States)

    Stojkovic Lalosevic, Milica; Stankovic, Sanja; Stojkovic, Mirjana; Markovic, Velimir; Dimitrijevic, Ivan; Lalosevic, Jovan; Petrovic, Jelena; Brankovic, Marija; Pavlovic Markovic, Aleksandra; Krivokapic, Zoran

    2017-01-01

    This study was designed to investigate the efficiency of preoperative serum carcinoembryonic antigen (CEA) and carbohydrate cancer antigen (CA19-9) levels for diagnosing synchronous liver metastases and lymph node in colorectal carcinoma (CRC) patients. A total of 300 patients with histologically diagnosed CRC were included in this study between May 2014 and March 2015. The data were obtained prospectively from patient's medical records: medical history, demographics, tumor location, differentiation (grade), depth of the tumor (T), lymph node metastases (N), distant metastases (M), lymphatics, venous and perineural invasion, and disease stage. Tumor markers were measured with an electrochemiluminescent assay and the reference value was 5ng/ml for CEA and for Ca19-9, 37u/ml. There was A high statistically significant difference in the levels of serum CEA and CA19-9 between different disease stages of CRC (P<0.001). Regarding different T stages of CRC, We noticed a significant statistical difference in CEA (stage I 3.76±8.73; II 5.68±17.27, III 7.56±14.81, and IV 70.90±253.23) and CA 19-9 levels (stage I 9.65±11.03, II 9.83±11.09; III 19.58±36.91, and IV 228.9±985.38, respectively). The mean CEA and CA19-9 serum levels were significantly higher in patients with regional lymph nodes involvement (CEA 37.21±177.85 vs 4.79±9.90, CA19-9 119.51±687.71 VS 12.24±17.69, respectively, P<0.05) and in liver metastases (CEA 86.56±277.65 vs. 5.98±12.98, and CA19-9 273.27±1073.46 vs. 4.98±3142, respectively, with P<0.001) in comparison to patients without lymph node involvement and liver metastases. We noticed a cut-off value for lymph nodes involvement, for CEA and CA 19-9, 3.5 ng/mL and 7.5 U/mL, respectively. While, a cut-off value for the presence of synchronous liver metastases of these two markers was 3.5ng/mL AND 5.5 U/mL. Our study showed that tumor makers, CEA and CA19-9, can be used as diagnostic factors regarding the severity of CRC specifically to

  1. Pancreatic cancer and predictors of survival: comparing the CA 19-9/bilirubin ratio with the McGill Brisbane Symptom Score.

    Science.gov (United States)

    Dumitra, Sinziana; Jamal, Mohammad H; Aboukhalil, Jad; Doi, Suhail A; Chaudhury, Prosanto; Hassanain, Mazen; Metrakos, Peter P; Barkun, Jeffrey S

    2013-12-01

    Few tools predict survival from pancreatic cancer (PAC). The McGill Brisbane Symptom Score (MBSS) based on symptoms at presentation (weight loss, pain, jaundice and smoking) was recently validated. The present study compares the ability of four strategies to predict 9-month survival: MBSS, carbohydrate antigen 19-9 (CA 19-9) alone, CA19-9-to-bilirubin ratio and a combination of MBSS and the CA19-9-to-bilirubin ratio. A retrospective review of 133 patients diagnosed with PAC between 2005 and 2011 was performed. Survival was determined from the Quebec civil registry. Blood CA 19-9 and bilirubin values were collected (n = 52) at the time of diagnosis. Receiver-operating characteristic (ROC) curves were used to determine a cutoff for optimal test characteristics of CA 19-9 and CA19-9-to-total bilirubin ratio in predicting survival at 9 months. Predictive characteristics were then calculated for the four strategies. Of the four strategies, the one with the greatest negative predictive value was the MBSS: negative predictive value (NPV) was 90.2% (76.9-97.3%) and the positive likelihood ratio (LR) was the greatest. The ability of CA 19-9 levels alone, at baseline, to predict survival was low. For the CA19-9-to-bilirubin ratio, the test characteristics improved but remained non-significant. The best performing strategy according to likelihood ratios was the combined MBSS and CA19-9 to the bilirubin ratio. CA19-9 levels and the CA19-9-to-bilirubin ratio are poor predictors of survival for PAC, whereas the MBSS is a far better predictor, confirming its clinical value. By adding the CA19-9-to-bilirubin ratio to the MBSS the predictive characteristics improved. © 2013 International Hepato-Pancreato-Biliary Association.

  2. Intramuscular myxoma associated with an increased carbohydrate antigen 19.9 level in a woman: a case report

    Directory of Open Access Journals (Sweden)

    Toutouzas Kostas

    2011-05-01

    Full Text Available Abstract Introduction Intramuscular myxoma is a rare benign soft tissue tumor. The lack of specific symptoms and widely used laboratory tests makes the diagnosis quite difficult. We present a case of an Intramuscular myxoma associated with an increased carbohydrate antigen 19.9 level. To the best of our knowledge, there have not been any reported cases of an association of Intramuscular myxoma with tumor markers in the literature. Case presentation A 45-year-old Caucasian woman presented to our department for resection of a mass in her left groin area, discovered incidentally on a triplex ultrasonography of her lower extremities. The diagnosis of Intramuscular myxoma was confirmed on histopathology after the complete surgical excision of the tumor. On laboratory examination, the serum level of carbohydrate antigen 19.9 was found to be elevated, but it returned to normal six months after resection of the mass. Conclusion Carbohydrate antigen 19.9 is a tumor marker that increases in a variety of malignant and benign conditions. After the exclusion of all other possible reasons for carbohydrate antigen 19.9 elevation, we assumed a possible connection of carbohydrate antigen 19.9 elevation and Intramuscular myxoma, an issue that requires needs further investigation.

  3. Silvernano Particle Loaded on Activated Carbon as Novel Adsorbent for the Removal of Acid Yellow 199 Dye

    Directory of Open Access Journals (Sweden)

    Z. Alishavandi

    2013-11-01

    Full Text Available In this study, a new adsorbent, silver nanoparticle loaded on activated carbon (Ag˗NP˗AC was usedfor removal of acid yellow199 (AY 199 dye. This novel material was characterized and identified by differenttechniques such as Brunauer, Emmett and Teller (BET, field emission scanning electron microscopy(FESEM, X-ray diffraction (XRD analysis. Unique properties of this adsorbent such as high surface area(>1100 m2g-1 and low pore size (<47 A˚ and average particle size lower than 60 A˚ make it possible forefficient removal of Ay199. In batch experimental set-up, adsorbent dosage, initial dye concentration, contacttime and pH were investigated. Optimum values were set as pH of 3.0, 0.03g/50mL of adsorbent for initial dyeconcentration of 15 mgL-1 at 40 min and 25 ±1 ºC. The adsorption of Ay199 follows the pseudo-second-orderrate equation in addition to interparticle diffusion model (with removal more than 90% at all conditions.Equilibrium data fitted well with the Langmuir model, while maximum adsorption capacity was 30 mg g-1 for0.03 g/50mL of Ag˗NP˗AC. Calculation of various thermodynamic parameters such as, Gibb’s free energy,entropy and enthalpy of the on-going adsorption process also indicated feasibility and endothermic nature ofAY 199 adsorption onto Ag˗NP˗AC.

  4. Silvernano Particle Loaded on Activated Carbon as Novel Adsorbent for the Removal of Acid Yellow 199 Dye

    Directory of Open Access Journals (Sweden)

    Z. Alishavandi

    2013-05-01

    Full Text Available In this study, a new adsorbent, silver nanoparticle loaded on activated carbon (Ag˗NP˗AC was used for removal of acid yellow199 (AY 199 dye. This novel material was characterized and identified by different techniques such as Brunauer, Emmett and Teller (BET, field emission scanning electron microscopy (FESEM, X-ray diffraction (XRD analysis. Unique properties of this adsorbent such as high surface area (>1100 m2g-1 and low pore size (<47 A˚ and average particle size lower than 60 A˚ make it possible for efficient removal of Ay199. In batch experimental set-up, adsorbent dosage, initial dye concentration, contact time and pH were investigated. Optimum values were set as pH of 3.0, 0.03g/50mL of adsorbent for initial dye concentration of 15 mgL-1 at 40 min and 25 ±1 ºC. The adsorption of Ay199 follows the pseudo-second-order rate equation in addition to interparticle diffusion model (with removal more than 90% at all conditions. Equilibrium data fitted well with the Langmuir model, while maximum adsorption capacity was 30 mg g-1 for 0.03 g/50mL of Ag˗NP˗AC. Calculation of various thermodynamic parameters such as, Gibb’s free energy, entropy and enthalpy of the on-going adsorption process also indicated feasibility and endothermic nature of AY 199 adsorption onto Ag˗NP˗AC.

  5. Diverse monoclonal antibodies against the CA 19-9 antigen show variation in binding specificity with consequences for clinical interpretation.

    Science.gov (United States)

    Partyka, Katie; Maupin, Kevin A; Brand, Randall E; Haab, Brian B

    2012-07-01

    The CA 19-9 antigen is currently the best individual marker for the detection of pancreatic cancer. In order to optimize the CA 19-9 assay and to develop approaches to further improve cancer detection, it is important to understand the specificity differences between CA 19-9 antibodies and the consequential affect on biomarker performance. Antibody arrays enabled multiplexed comparisons between five different CA 19-9 antibodies used in the analysis of plasma samples from pancreatic cancer patients and controls. Major differences were observed between antibodies in their detection of particular patient samples. Glycan array analysis revealed that certain antibodies were highly specific for the canonical CA 19-9 epitope, sialyl-Lewis A, while others bound sialyl-Lewis A in addition to a related structure called sialyl-Lewis C and modification with Nue5Gc. In a much larger patient cohort, we confirmed the binding of sialyl-Lewis C glycan by one of the antibodies and showed that the broader specificity led to the detection of an increased number of cancer patients without increasing detection of pancreatitis patient samples. This work demonstrates that variation between antibody specificity for cancer-associated glycans can have significant implications for biomarker performance and highlights the value of characterizing and detecting the range of glycan structures that are elevated in cancer. © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. A simple hepatic cyst with elevated serum and cyst fluid CA19-9 levels: a case report

    Directory of Open Access Journals (Sweden)

    Yanai Hidekatsu

    2008-10-01

    Full Text Available Abstract Introduction Simple hepatic cysts rarely cause symptoms, however, occasionally they become symptomatic due to mass effect, rupture, hemorrhage, and infection. We report a patient with a large hepatic cyst with elevated serum and cyst fluid CA19-9 levels. We studied serum and cyst fluid CA19-9 levels in this patient, before and after the intracystic instillation of minocycline hydrochloride. Case presentation A 76-year-old Japanese woman was diagnosed as having an infected hepatic cyst, by physical examination and enhanced abdominal computed tomography. Serum (170 U/ml; reference: Conclusion Our study is the first report to reveal the influence of intracystic instillation of minocycline hydrochloride on serum and cyst fluid CA19-9 levels in a patient with a simple hepatic cyst.

  7. Extraordinary elevated CA19-9 in patient with common bile duct stones and cholangitis Case report

    Directory of Open Access Journals (Sweden)

    Ali Mokhtarifar

    2012-05-01

    Full Text Available Serum Carbohydrate Antigen, CA19-9, is a carbohydrate antigen whose usage -as a tumor marker- in pancreatic and bile ducts malignancies is commonly increasing. Sensitivity and specificity of this antigen in the diagnosis of malignancies is 70-90% and 68-91%, respectively. CA19-9 can also rise in other disorders and in few of benign conditions including cholangitis, due to other causes, e.g. choledocholithiasis. However, in such cases the increase is not significant and it is usually below 1000 u/ml. Values more than 10000 u/ml are limited to few case reports in articles. The case under study was a 66 year old man hospitalized because of epigastric and right upper quadrant pain, fever, jaundice, acholic stool, weight loss of about 6 kg, and hyperchromic urine. Physical examination revealed that the case was icteric and febrile with a mild RUQ tenderness on percussion. Laboratory tests showed marked elevation of bilirubin and CA19-9 (Total bilirubin: 36 mg/dl, Direct: 19.5 mg/dl CA19-9 :44777u/ml, Normal: 0-40 u/ml, but the enzymes of the liver and alkaline phosphatase only increased to two times the normal level. Sonography showed dilated common bile duct with four stones within it. Four weeks after stones extraction and renewal of bile current CA19-9 fell to 60 u/ml and returned to normal range (0-40 2 months later and during this period the patient was totally asymptomatic. As a result, in patients with biliary obstruction, a diagnosis of malignancy cannot be made solely on the basis of increased concentration of CA19-9, even in case of high clinical suspicion and the interpretation of this increase must be done with more caution and after lab follow-up following removal of the obstruction.

  8. Clinical Significance of Serum HE4, CA125, CA724, and CA19-9 in Patients With Endometrial Cancer.

    Science.gov (United States)

    Bian, Jing; Sun, Xiaoxu; Li, Bo; Ming, Liang

    2017-08-01

    Serum markers with increased sensitivity and specificity for endometrial cancer are required. To date, no good marker has met this standard. The aims of our study were to evaluate the utility of tumor markers HE4, CA125, CA724, and CA19-9 as potential markers in patients diagnosed with endometrial cancer. Blood samples from 105 patients with endometrial cancer and 87 healthy women were analyzed by Roche electrochemiluminescent immunoassay, and serum values were measured for the following biomarkers: HE4, CA125, CA724, and CA19-9. Serum HE4, CA125, CA724, and CA19-9 concentrations were significantly higher in patients with endometrial cancer, compared with controls ( P endometrial cancer, HE4 had higher sensitivity (58%), positive predictive value (60%), and negative predictive value (67%) than any other single tumor marker, and in the combination of HE4, CA125, CA724, and CA19-9, the sensitivity and positive predictive values reached 59.1% and 88%, respectively. Meanwhile, the receiver operating characteristic area under the curve of the combination of the 4 markers was significantly increased than any other group, either in stage I or in stage II to IV cases. HE4 and CA125 both correlate with advanced age; in addition, HE4 was related to pathology subtypes and positive adnexal involvement, CA125 was related to International Federation of Gynecology and Obstetrics stage, CA19-9 was related to International Federation of Gynecology and Obstetrics stage, and CA724 was correlated with positive lymph node. Combination of HE4, CA125, CA724, and CA19-9 has the highest value in diagnosing endometrial cancer, and they can be a useful tissue immune marker for patients with endometrial cancer.

  9. Retroperitoneal bronchogenic cyst resembling an adrenal tumor with high levels of serum carbohydrate antigen 19-9

    Science.gov (United States)

    Wang, Min; He, Xu; Qiu, Xia; Tian, Chuan; Li, Jian; Lv, Mingnan

    2017-01-01

    Abstract Rationale: Retroperitoneal bronchogenic cysts without specific clinical manifestations are extremely rare and difficult to diagnose preoperatively and are easily misdiagnosed as left adrenal or pancreatic tumors. Patient concerns: A 48-year-old woman with the chief complaint of obscure epigastric pain for 1 month and with no other gastrointestinal symptoms and no significant medical history. The patient had signed informed consent for publication of this case report. Diagnosis: The serum level of carbohydrate antigen 19-9 (CA 19-9) in the patient was >1200 U/mL, which far exceeded the normal level of tumor. However, endoscopic ultrasound (EUS) showed that the adrenal gland had an intact capsule and that the mass originated in the retroperitoneal space and did not involve the paranephros. Interventions: Surgical resection was performed on the patient. Outcomes: Histopathological examination demonstrated that the mass was a retroperitoneal bronchogenic cyst. At the 2-month postoperative follow-up, the level of CA 19-9 had returned to normal. Lessons: EUS appears to be superior to CT because it clearly delineated the mass from the surrounding structures of the retroperitoneal region. EUS-fine needle aspiration can be used for diagnosis or determining whether the mass is malignant or benign. To the best of our knowledge, retroperitoneal bronchogenic cysts with significantly elevated serum CA 19-9 have not been reported. Measurement of serum CA 19-9 may be helpful in the diagnosis of retroperitoneal bronchogenic cysts. However, this was a rare case, and the mechanism behind CA 19-9 elevation is not clear and needs further investigation. PMID:28767594

  10. Retroperitoneal bronchogenic cyst resembling an adrenal tumor with high levels of serum carbohydrate antigen 19-9: A case report.

    Science.gov (United States)

    Wang, Min; He, Xu; Qiu, Xia; Tian, Chuan; Li, Jian; Lv, Mingnan

    2017-08-01

    Retroperitoneal bronchogenic cysts without specific clinical manifestations are extremely rare and difficult to diagnose preoperatively and are easily misdiagnosed as left adrenal or pancreatic tumors. A 48-year-old woman with the chief complaint of obscure epigastric pain for 1 month and with no other gastrointestinal symptoms and no significant medical history. The patient had signed informed consent for publication of this case report. The serum level of carbohydrate antigen 19-9 (CA 19-9) in the patient was >1200 U/mL, which far exceeded the normal level of tumor. However, endoscopic ultrasound (EUS) showed that the adrenal gland had an intact capsule and that the mass originated in the retroperitoneal space and did not involve the paranephros. Surgical resection was performed on the patient. Histopathological examination demonstrated that the mass was a retroperitoneal bronchogenic cyst. At the 2-month postoperative follow-up, the level of CA 19-9 had returned to normal. EUS appears to be superior to CT because it clearly delineated the mass from the surrounding structures of the retroperitoneal region. EUS-fine needle aspiration can be used for diagnosis or determining whether the mass is malignant or benign. To the best of our knowledge, retroperitoneal bronchogenic cysts with significantly elevated serum CA 19-9 have not been reported. Measurement of serum CA 19-9 may be helpful in the diagnosis of retroperitoneal bronchogenic cysts. However, this was a rare case, and the mechanism behind CA 19-9 elevation is not clear and needs further investigation.

  11. In vivo SPECT imaging of tumors by {sup 198,199}Au-labeled graphene oxide nanostructures

    Energy Technology Data Exchange (ETDEWEB)

    Fazaeli, Yousef [Nuclear Medicine Research Group, Agricultural, Medical and Industrial Research School, Nuclear Science and Technology Research Institute (NSTRI), P.O. Box 31485-498, Karaj (Iran, Islamic Republic of); Akhavan, Omid, E-mail: oakhavan@sharif.edu [Department of Physics, Sharif University of Technology (SUT), P.O. Box 11155-9161, Tehran (Iran, Islamic Republic of); Institute for Nanoscience and Nanotechnology, Sharif University of Technology (SUT), P.O. Box 14588-89694, Tehran (Iran, Islamic Republic of); Rahighi, Reza [Department of Physics, Sharif University of Technology (SUT), P.O. Box 11155-9161, Tehran (Iran, Islamic Republic of); Aboudzadeh, Mohammad Reza; Karimi, Elham; Afarideh, Hossein [Nuclear Medicine Research Group, Agricultural, Medical and Industrial Research School, Nuclear Science and Technology Research Institute (NSTRI), P.O. Box 31485-498, Karaj (Iran, Islamic Republic of)

    2014-12-01

    Graphene oxide (GO) sheets functionalized by aminopropylsilyl groups (8.0 wt.%) were labeled by {sup 198,199}Au nanoparticle radioisotopes (obtained through reduction of HAuCl{sub 4} in sodium citrate solution followed by thermal neutron irradiation) for fast in vivo targeting and SPECT imaging (high purity germanium-spectrometry) of tumors. Using instant thin layer chromatography method, the physicochemical properties of the amino-functionalized GO sheets labeled by {sup 198,199}Au NPs ({sup 198,199}Au@AF-GO) were found to be highly stable enough in organic phases, e.g. a human serum, to be reliably used in bioapplications. In vivo biodistribution of the {sup 198,199}Au@AF-GO composite was investigated in rats bearing fibrosarcoma tumor after various post-injection periods of time. The {sup 198,199}Au@AF-GO nanostructure exhibited a rapid as well as high tumor uptake (with uptake ratio of tumor to muscle of 167 after 4 h intravenous injection) that resulted in an efficient tumor targeting/imaging. Meantime, the low lipophilicity of the {sup 198,199}Au@AF-GO caused to its fast excretion (∼ 24 h) throughout the body by the kidneys (as also confirmed by the urinary tract). Because of the short half-life of {sup 198,199}Au radioisotopes, the {sup 198,199}Au@AF-GO with an excellent tumor targeting/imaging and fast washing out from the body can be suggested as one of the most effective and promising nanomaterials in nanotechnology-based cancer diagnosis and therapy. - Graphical abstract: Amino-functionalized graphene oxide sheets were labeled with radioactive gold nanoparticles as effective SPECT imaging and therapeutic agents. - Highlights: • GO sheets were functionalized by amino groups and labeled by Au NP radioisotopes. • Au@AF-GO nanocomposites were used for in vivo targeting and SPECT imaging of tumors. • In vivo biodistribution study showed high tumor uptake of the nanocomposites. • Low lipophilicity of the nanocomposite caused its fast excretion

  12. Serum Carbohydrate Antigen 19-9 in Differential Diagnosis of Benign and Malignant Pancreatic Cystic Neoplasms: A Meta-Analysis.

    Science.gov (United States)

    Cao, Shaobo; Hu, Ya; Gao, Xiang; Liao, Quan; Zhao, Yupei

    2016-01-01

    Using serum carbohydrate antigen 19-9 (CA 19-9) in discriminating between benign and malignant pancreatic disease remains controversial. We aim to evaluate the diagnostic value of serum CA 19-9 in predicting malignant pancreatic cystic lesions. Eligible studies were identified through searching MEDLINE and EMBASE prior to March 2016. Studies were assessed for quality using the Quality Assessment for Studies of Diagnostic Accuracy, 2nd version (QUADAS-2). Pooled sensitivity and specificity with 95% confidence interval (CI) were calculated using random-effects models. Summary receiver operator characteristic (SROC) curves and the area under curve (AUC) were performed. A total of thirteen studies including 1437 patients were enrolled in this meta-analysis. The pooled sensitivity and specificity were 0.47(95% CI: 0.35-0.59), and 0.88(95% CI: 0.86-0.91), respectively, and the AUC was 0.87(95% CI, 0.84-0.90). Meta-regression analysis showed that sample size, region and reference standards were not the main sources of heterogeneity. Serum CA 19-9 has satisfying pooled specificity while poor pooled sensitivity for discriminating benign from malignant PCNs. It deserves to be widely used as complementary to other clinical diagnostic methods.

  13. The CA19-9 and Sialyl-TRA Antigens Define Separate Subpopulations of Pancreatic Cancer Cells.

    Science.gov (United States)

    Barnett, Daniel; Liu, Ying; Partyka, Katie; Huang, Ying; Tang, Huiyuan; Hostetter, Galen; Brand, Randall E; Singhi, Aatur D; Drake, Richard R; Haab, Brian B

    2017-06-22

    Molecular markers to detect subtypes of cancer cells could facilitate more effective treatment. We recently identified a carbohydrate antigen, named sTRA, that is as accurate a serological biomarker of pancreatic cancer as the cancer antigen CA19-9. We hypothesized that the cancer cells producing sTRA are a different subpopulation than those producing CA19-9. The sTRA glycan was significantly elevated in tumor tissue relative to adjacent pancreatic tissue in 3 separate tissue microarrays covering 38 patients. The morphologies of the cancer cells varied in association with glycan expression. Cells with dual staining of both markers tended to be in well-to-moderately differentiated glands with nuclear polarization, but exclusive sTRA staining was present in small clusters of cells with poor differentiation and large vacuoles, or in small and ill-defined glands. Patients with higher dual-staining of CA19-9 and sTRA had statistically longer time-to-progression after surgery. Patients with short time-to-progression (<2 years) had either low levels of the dual-stained cells or high levels of single-stained cells, and such patterns differentiated short from long time-to-progression with 90% (27/30) sensitivity and 80% (12/15) specificity. The sTRA and CA19-9 glycans define separate subpopulations of cancer cells and could together have value for classifying subtypes of pancreatic adenocarcinoma.

  14. Cyclic AMP-dependent secretion of Ca 19-9 by LS174T human colon carcinoma cells.

    Science.gov (United States)

    Macchia, Vincenzo; Gargiulo, Maria; Terracciano, Daniela; Di Carlo, Angelina; Mariano, Angela

    2002-01-01

    Prolonged increase of cyclic adenosine-monophosphate (cAMP) level in culture medium of a human colon cancer cell (LS174T) inhibits cellular growth and stimulates Ca 19-9 expression. The raise in cAMP level was produced by dibutyryl cyclic AMP (DBcAMP) or by forskolin an agent acting at the level of cAMP generation. Both these agents in a range of concentration between 10(-3)-10(-5) M have an inhibitory effect on the growth which is dose and time dependent. The inhibition was reversible as demonstrated by complete restoration of cell growth soon after the withdrawal of the substances from the culture medium. When cAMP levels in culture medium was raised, an increase in Ca 19-9 expression was observed and it appears that cyclic nucleotides have at least two effects: the first to cause rapid release of already synthesized Ca 19-9 and second to stimulate new antigen synthesis. The findings of the present study demonstrated that LS174T cells are unable to proliferate upon sustained accumulation of intracellular cyclic AMP suggesting the use of strategies able to increase cAMP levels for therapy of colon cancer. Furthermore, the finding that cAMP may also be a regulator of Ca 19-9 synthesis and release indicates the utility of cell line LS174T as a model for studies on the mechanism of synthesis and secretion of specific tumoral markers in colon cancer.

  15. Schwannoma of the stomach with elevated preoperative serum carbohydrate antigen 19-9: report of a case.

    Science.gov (United States)

    Fukuchi, Minoru; Naitoh, Hiroshi; Shoji, Hisanori; Yamagishi, Junko; Suzuki, Masaki; Yanoma, Toru; Kiriyama, Shinsuke; Kuwano, Hiroyuki

    2012-08-01

    We herein report a case of a gastric schwannoma with elevated preoperative serum carbohydrate antigen 19-9 (CA19-9) (155.2 U/ml, normal range 0-36.9 U/ml). A 59-year-old Japanese man was admitted to our hospital for treatment of a submucosal tumor of the stomach detected by barium meal, upper gastrointestinal endoscopy, and computed tomography. Endoscopic examination revealed a 3-cm diameter submucosal tumor in the antrum of the stomach, but biopsy of the lesion was unable to confirm the diagnosis. Positron emission tomography to evaluate the malignant potential showed a high uptake of (18)F-fluorodeoxyglucose in the tumor. Laparoscopy-assisted distal gastrectomy was therefore performed. The histopathological findings of the surgical specimen revealed a benign gastric schwannoma, positive for S-100 protein. The postoperative serum CA19-9 levels gradually decreased and normalized. To the best of our knowledge, this is the first report of a gastric schwannoma with elevated serum CA19-9.

  16. Change in carbohydrate antigen 19-9 level as a prognostic marker of overall survival in locally advanced pancreatic cancer treated with concurrent chemoradiotherapy.

    Science.gov (United States)

    Kim, Yi-Jun; Koh, Hyeon Kang; Chie, Eui Kyu; Oh, Do-Youn; Bang, Yung-Jue; Nam, Eun Mi; Kim, Kyubo

    2017-12-01

    To investigate the significance of carbohydrate antigen 19-9 (CA19-9) levels for survival in locally advanced pancreatic cancer (LAPC) treated with concurrent chemoradiotherapy (CCRT). We retrospectively reviewed data from 97 LAPC patients treated with CCRT between 2000 and 2013. CA19-9 levels (initial and post-CCRT) and their changes [{(post-CCRT CA19-9 level - initial CA19-9 level)/(initial CA19-9 level)} × 100] were analyzed for overall survival. A cut-off point of 37 U/mL was used to analyze initial and post-CCRT CA19-9 levels. In order to define an optimal cut-off point for change in CA19-9 level, the maxstat package of R was applied. Median overall survival was 14.7 months (95% CI 13.4-16.0), and the 2-year survival rate was 16.5%. The estimated optimal cut-off point of CA19-9 level change was 94.4%. On univariate analyses, CA19-9 level change between initial and post-CCRT was significantly correlated with overall survival (median survival time 9.7 vs 16.3 months, p 94.4% might serve as a surrogate marker for poor survival in patients with LAPC undergoing CCRT, and the prognostic power surpassed other CA19-9 variables including initial and post-CCRT values.

  17. Qiliqiangxin Attenuates Phenylephrine-Induced Cardiac Hypertrophy through Downregulation of MiR-199a-5p

    Directory of Open Access Journals (Sweden)

    Haifeng Zhang

    2016-05-01

    Full Text Available Background/Aims: Qiliqiangxin (QL, a traditional Chinese medicine, has long been used to treat chronic heart failure. Previous studies demonstrated that QL could prevent cardiac remodeling and hypertrophy in response to hypertensive or ischemic stress. However, little is known about whether QL could modulate cardiac hypertrophy in vitro, and (if so whether it is through modulation of specific hypertrophy-related microRNA. Methods: The primary neonatal rat ventricular cardiomyocytes were isolated, cultured, and treated with phenylephrine (PE, 50 µmol/L, 48 h to induce hypertrophy in vitro, in the presence or absence of pretreatment with QL (0.5 µg/ml, 48 h. The cell surface area was determined by immunofluorescent staining for α-actinin. The mRNA levels of hypertrophic markers including atrial natriuretic peptide (ANP, brain natriuretic peptide (BNP, and β-myosin heavy chain (MYH7 were assayed by qRT-PCRs. The protein synthesis of cardiomyocytes was determined by the protein/DNA ratio. The miR-199a-5p expression level was quantified in PE-treated cardiomyocytes and heart samples from acute myocardial infarction (AMI mouse model. MiR-199a-5p overexpression was used to determine its role in the anti-hypertrophic effect of QL on cardiomyocytes. Results: PE induced obvious enlargement of cell surface in cardiomyocytes, paralleling with increased ANP, BNP, and MYH7 mRNA levels and elevated protein/DNA ratio. All these changes were reversed by the treatment with QL. Meanwhile, miR-199a-5p was increased in AMI mouse heart tissues. Of note, the increase of miR-199a-5p in PE-treated cardiomyocytes was reversed by the treatment with QL. Moreover, overexpression of miR-199a-5p abolished the anti-hypertrophic effect of QL on cardiomyocytes. Conclusion: QL prevents PE-induced cardiac hypertrophy. MiR-199a-5p is increased in cardiac hypertrophy, while reduced by treatment with QL. miR-199a-5p suppression is essential for the anti-hypertrophic effect of QL

  18. Differences in plasma gastrin, CEA, and CA 19-9 concentration in patients with proximal and distal colorectal cancer.

    Science.gov (United States)

    Bombski, Grzegorz; Gasiorowska, Anita; Orszulak-Michalak, Daria; Neneman, Beata; Kotynia, Justyna; Strzelczyk, Janusz; Janiak, Adam; Malecka-Panas, Ewa

    2002-01-01

    We investigated whether there are differences in plasma gastrin, as compared with carcinoembryonic antigen (CEA) and cancer antigen (CA) 19-9 between patients with proximal and distal colorectal cancer. Gastrin concentration has also been analyzed, dependent on the tumor stage, in order to evaluate the possible prognostic role of this measurement. In 50 patients with colon cancer-fasting gastrin, CA 19-9 and CEA levels were evaluated. Mean plasma-gastrin level in patients with distal tumor yielded 105.31 +/- 12.5 microU/L and was significantly higher than in patients with the proximal tumor site (42.2 +/- 3.1 microU/L) as well as in controls (p < 0.001). No significant difference was observed between mean plasma gastrin in patients with proximal tumors and the control group. The mean CEA plasma level was significantly higher (p < 0.01) in patients with distal tumors (9.1 +/- 1.1 ng/mL) than in those with proximal tumors (1.48 +/- 0.1 ng/mL). Similarly, the mean CA 19-9 plasma level was significantly higher (p < 0.01) in patients with distal tumor (19.9 +/- 2.1 U/mL) than in those with proximal tumor: 1.8 +/- 0.2 U/mL. The mean gastrin plasma, CA 19-9, and CEA level was significantly higher in group of Duke's stage C and D as compared to A and B. We speculate that observed differences in gastrin concentration in patients with distal and proximal tumors may contribute to the distinct pathogenesis and biological properties of those cancers. The significance of gastrin as a marker for diagnostic or prognostic purposes in colorectal cancer requires further study.

  19. o199sc.m77t and o199sc.h77t: MGD77T data and header file for single-beam bathymetry for field activity O-1-99-SC in Southern California from 06/05/1999 to 06/17/1999

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of the U.S. Geological Survey cruise O-1-99-SC. The cruise was conducted in...

  20. $^{111m}$Cd- and $^{199m}$Hg-derivatives of blue oxidases

    CERN Multimedia

    2002-01-01

    The rack-induced bonding concept (H.B.Gray & B.G.~Malmstroem, Comments Inorg. Chem, 2, 203, 1983) postulates that the bound metal ion in metalloproteins is forced to adopt a coordination geometry determined by the rigid peptide conformation of the protein. Alternatively, the metal ion could create its own favoured coordination geometry in a soft peptide conformation. In order to decide who is slave or master the changes of coordination and rigidity of metal sites in blue copper proteins due to metal and ligand exchange were studied by $^{111m}$Cd and $^{199m}$Hg $\\gamma$-$\\gamma$-perturbed angular correlation (PAC). To get a better understanding of the so called " Type 1 Copper Site " of the blue oxidases laccase (LAC) and ascorbate oxidase (AO) we concentrated our investigations on the small blue copper proteins azurin and plastocyanin. \\\\ \\\\In azurin~(Az), the metal ligand methionine 121~(M121) was replaced by several amino acids, e.g. asparagine~(N), glutamic acid~(E), via site directed mutagenesis. Di...

  1. Decline in CA19-9 during chemotherapy predicts survival in four independent cohorts of patients with inoperable bile duct cancer

    DEFF Research Database (Denmark)

    Grunnet, Mie; Christensen, Ib J.; Lassen, Ulrik

    2015-01-01

    Background: Carbohydrate associated antigen (CA19-9) has been approved by the FDA as a biomarker for monitoring treatment effect in pancreatic cancer. However, the value of serum CA19-9 as a biomarker of response to chemotherapy in bile duct cancer is unclear. The aim of this study was to determi...

  2. The impact of perioperative CA19-9 change on the survival and recurrence patterns after adjuvant chemoradiotherapy in resectable extrahepatic cholangiocarcinoma.

    Science.gov (United States)

    Kim, Byoung Hyuck; Kim, Eunji; Kim, Kyubo; Jang, Jin-Young; Kim, Sun Whe; Oh, Do-Youn; Chie, Eui Kyu

    2017-09-20

    Perioperative CA19-9 value in pancreato-biliary cancers has been recognized as a prognostic factor. Herein, we investigated survival differences and recurrence patterns after adjuvant chemoradiotherapy by perioperative CA19-9 change in surgically resected extrahepatic cholangiocarcinoma. Patients were divided into those with preoperative normal CA19-9 (Group 1, n = 52), those with high preoperative and normalized postoperative CA19-9 (Group 2, n = 80), and those with both high pre- and postoperative CA19-9 (Group 3, n = 21). Depending on the group defined above, the 5-year overall survival (OS) (59.6%, 38.7%, and 9.5%, P < 0.001) and disease-free survival (55.8%, 31.2%, and 9.5%, P < 0.001) between the three groups differed. On multivariable analysis in patients other than group 1, poor prognosticators for OS were high postoperative CA19-9 (HR 2.26, P = 0.008) and N1 disease (HR 2.33, P = 0.001). Group 3, compared with group 2, showed higher distant metastasis rate, shorter disease-free interval, and higher CA19-9 at the time of recurrence. Survival and recurrence patterns after adjuvant chemoradiotherapy are significantly affected by perioperative CA19-9 change. This may have important implications in patient selection for adjuvant chemoradiotherapy and clinical trial design. © 2017 Wiley Periodicals, Inc.

  3. Decline in CA19-9 during chemotherapy predicts survival in four independent cohorts of patients with inoperable bile duct cancer.

    Science.gov (United States)

    Grunnet, Mie; Christensen, Ib J; Lassen, Ulrik; Jensen, Lars H; Lydolph, Magnus; Knox, Jennifer J; McNamara, Mairead G; Jitlal, Mark; Wasan, Harpreet; Bridgewater, John; Valle, Juan W; Mau-Sorensen, Morten

    2015-07-01

    Carbohydrate associated antigen (CA19-9) has been approved by the FDA as a biomarker for monitoring treatment effect in pancreatic cancer. However, the value of serum CA19-9 as a biomarker of response to chemotherapy in bile duct cancer is unclear. The aim of this study was to determine if a decline in CA19-9 (CA19-9 response) during chemotherapy is predictive of survival in patients with inoperable bile duct cancer. Consecutive patients with inoperable bile duct cancer treated at a University Hospital were retrospectively included in an investigational cohort (n = 212). Three validation cohorts were established including patients 1) participating in phase I/II trials at a Danish Hospital (n = 71), 2) identified retrospectively in a Canadian cohort (n = 196) and 3) randomized in the ABC-02 trial (n = 410). Patients with a baseline CA19-9 and at least one CA19-9 value measured 10-12 weeks after the start of chemotherapy were included. Multivariate Cox regression analyses were performed. Patients meeting the criteria to be included were 54 in the investigational cohort and 34, 68 and 148 in the three validation sets, respectively. Multivariate analysis included radiological response, performance status, bilirubin, gender, site of cancer, extend of disease, CA19-9 at baseline and age. A hazard ratio (HR) of 0.60 (95%CI: 0.44-0.80, p = 0.0005) for death in CA19-9 responders was reached in the investigational cohort. The predictive value of CA 19-9 response was confirmed in all three validation cohorts. CA19-9 response is a robust predictor of survival in patients with inoperable bile duct cancer in four independent data sets. Copyright © 2015 Elsevier Ltd. All rights reserved.

  4. Biomarkers for pancreatic cancer: promising new markers and options beyond CA 19-9.

    Science.gov (United States)

    Ballehaninna, Umashankar K; Chamberlain, Ronald S

    2013-12-01

    Pancreatic adenocarcinoma accounts for nearly 90-95% of exocrine malignant tumors of the pancreas. Traditionally, overexpressed proteins/epitopes such as CA 19-9, CA-50, CEA, and many others were being used as pancreatic cancer tumor markers. The main utility of these biomarkers was in the diagnosis of pancreatic cancer as well as to assess response to chemotherapy and to determine prognosis and to predict tumor recurrence. However, these markers had significant limitations such as lack of sensitivity, false-negative results in certain blood groups, as well as false-positive elevation in the presence of obstructive jaundice. To circumvent these limitations, an extraordinary amount of research is being performed to identify an accurate tumor marker or a panel of markers that could aid in the management of the pancreatic cancer. Although this research has identified a large number and different variety of biomarkers, few hold future promise as a preferred marker for pancreatic cancer. This review provides an insight into exciting new areas of pancreatic biomarker research such as salivary, pancreatic juice, and stool markers that can be used as a noninvasive test to identify pancreatic cancer. This manuscript also provides a discussion on newer biomarkers, the role of microRNAs, and pancreatic cancer proteomics, which have the potential to identify a preferred tumor marker for pancreatic adenocarcinoma. This review further elaborates on important genetic changes associated with the development and progression of pancreatic cancer that holds the key for the identification of a sensitive biomarker and which could also serve as a therapeutic target.

  5. Methadone conversion in infants and children: Retrospective cohort study of 199 pediatric inpatients.

    Science.gov (United States)

    Fife, Alexandra; Postier, Andrea; Flood, Andrew; Friedrichsdorf, Stefan J

    2016-01-01

    Methadone administration has increased in pediatric clinical settings. This review is an attempt to ascertain an equianalgesic dose ratio for methadone in the pediatric population using standard adult dose conversion guidelines. US tertiary children's hospital. Hospitalized pediatric patients, 0-18 years of age. A retrospective chart review was conducted for patients who were converted from their initial opioid therapy regimen (morphine, hydromorphone, and/or fentanyl) to methadone. The primary endpoint was whether or not a dose correction was needed for methadone in the 6 days following conversion using standard dose conversion charts for adults. Documented clinical signs of withdrawal, unrelieved pain, or oversedation were examined. The majority (53.7 percent) of the 199 children were converted to methadone on intensive care units prior extubation or postextubation. The mean conversion ratio was 23.7 mg of oral morphine to 1 mg of oral methadone (median, 18.8 mg:1 mg, SD=25.7). Most patients experienced an adequate conversion (n=115, 57.8 percent), while 83 (41.7 percent) appeared undermedicated, and one child was oversedated. There were no associations found with conversion ratios for initial morphine dose, days to conversion, or effect of withdrawal of concomitant agents with potential for withdrawal. Opioid conversion to methadone is commonly practiced at our institution; however, dosing was significantly lower compared to adult conversion ratios, and more than 40 percent of children were undermedicated. The majority of children in this study received opioids for sedation while intubated and ventilated; therefore, safe and efficacious pediatric methadone conversion rates remain unclear. Prospective studies are needed.

  6. Downregulation of miR-199b promotes the acute spinal cord injury through IKKβ-NF-κB signaling pathway activating microglial cells

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Heng-Jun [Department of Neurosurgery, the First Affiliated Hospital, Zhejiang University, 79 Qingchun Road, Hangzhou 310003, Zhejiang (China); Wang, Li-Qing [Department of Anesthesia, the First Affiliated Hospital, Zhejiang University, Hangzhou 310003 (China); Xu, Qing-Sheng; Fan, Zuo-Xu; Zhu, Yu; Jiang, Hao; Zheng, Xiu-Jue; Ma, Yue-Hui [Department of Neurosurgery, the First Affiliated Hospital, Zhejiang University, 79 Qingchun Road, Hangzhou 310003, Zhejiang (China); Zhan, Ren-Ya, E-mail: zhanry148@163.com [Department of Neurosurgery, the First Affiliated Hospital, Zhejiang University, 79 Qingchun Road, Hangzhou 310003, Zhejiang (China)

    2016-11-15

    Inflammatory response played an important role in the progression of spinal cord injury (SCI). Several miRNAs were associated with the pathology of SCI. However, the molecular mechanism of miRNA involving in inflammatory response in acute SCI (ASCI) was poorly understood. Sprague-Dawley (SD) rats were divided into 2 groups: control group (n=6) and acute SCI (ASCI) group (n=6). The expression of miR-199b and IκB kinase β-nuclear factor-kappa B (IKKβ-NF-κB) signaling pathway were evaluated by quantitative reverse transcription-PCR (qRT-PCR) in rats with ASCI and in primary microglia activated by lipopolysaccharide (LPS). We found that downregulation of miR-199b and activation of IKKβ/NF-κB were observed in rats after ASCI and in activated microglia. miR-199b negatively regulated IKKβ by targeting its 3′- untranslated regions (UTR) through using luciferase reporter assay. Overexpression of miR-199b reversed the up-regulation of IKKβ, p-p65, tumor necrosis factor-α (TNF-α) and interleukin-1β (IL-1β) in LPS-treated BV2 cells assessed by western blotting analysis. In addition, BMS-345541 reversed the up-regulation effects of miR-199b inhibitor on the expression of TNF-α and IL-1β. In the SCI rats, overexpression of miR-199b attenuated ASCI and decreased the expression of IKKβ-NF-κB signaling pathway and TNF-α and IL-1β. These results indicated that miR-199b attenuated ASCI at least partly through IKKβ-NF-κB signaling pathway and affecting the function of microglia. Our findings suggest that miR-199b may be employed as therapeutic for spinal cord injury. - Highlights: • Downregulation of miR-199b and activation of IKKβ/NF-κB were observed in rat after SCI. • miR-199b negatively regulated IKKβ by targeting its 3′-UTR. • miR-199b overexpression reversed the increasing IKKβ, p-p65, TNF-α and IL-1β in LPS-treated BV2. • BMS-345541 reversed the up-regulation of TNF-α and IL-1β induced by miR-199b inhibitor. • Overexpression of miR-199b

  7. Mide Kanserlerinde Preoperatif Serum CEA, CA19-9 ve AFP Düzeylerinin Klinikopatolojik Faktörlerle Korelasyonu

    OpenAIRE

    Dirican, Abuzer; Ünal, Bülent; Işık, Burak; Sümer, Fatih; Kayaalp, Cüneyt; Aslan, İlhan

    2008-01-01

    Amaç: Gastrik adenokarsinomlu hastalarda preoperatif serum karsinoemriyonik antijen (CEA), CA19-9 ve alfa-fetoprotein (AFP) düzeyi ile klinikopatolojik faktörlerin korelasyonunu araştırmak. Metot: Gastrik adenokarsinom sebebiyle Ankara Yıldırım Beyazıt Eğitim Hastanesi 2. Cerrahi Kliniğinde ameliyat edilen 74 hastanın kayıtları retrospektif olarak incelendi. Hastaların preoperatif serum CEA, CA19-9, AFP düzeyleri ile bazı klinikopatolojik faktörler (tümör evresi, karaciğer metastazı, perit...

  8. Hg-coordination studies of oligopeptides containing cysteine, histidine and tyrosine by $^{199m}$Hg-TDPAC

    CERN Document Server

    Ctortecka, B; Mallion, S; Butz, T; Hoffmann, R

    1999-01-01

    In order to study the interaction of histidine- and tyrosine- containing peptide chains with Hg(II), the nuclear quadrupole interaction (NQI) of /sup 199m/Hg in the Hg complexes of the oligopeptides alanyl-alanyl-histidyl-alanyl-alanine-amid (AAHAA-NH /sub 2/) and alanyl-alanyl-tyrosyl-alanyl-alanine-amid (AAYAA-NH/sub 2/) was determined by time differential perturbed angular correlation and is compared with previous data on alanyl-alanyl-cysteyl-alanyl- alanyl (AACAA-OH). The /sup 199m/Hg-NQIs depend on the oligopeptide to Hg(II) stoichiometry and indicate that two-fold and four-fold coordinations occur for the bound Hg(II). (12 refs).

  9. Intramuscular myxoma associated with an increased carbohydrate antigen 19.9 level in a woman: a case report

    OpenAIRE

    Toutouzas Kostas; Larentzakis Andreas; Drimousis Panagiotis G; Doulami Georgia I; Kleidi Eleftheria S; Theodorou Dimitrios; Katsaragakis Stylianos

    2011-01-01

    Abstract Introduction Intramuscular myxoma is a rare benign soft tissue tumor. The lack of specific symptoms and widely used laboratory tests makes the diagnosis quite difficult. We present a case of an Intramuscular myxoma associated with an increased carbohydrate antigen 19.9 level. To the best of our knowledge, there have not been any reported cases of an association of Intramuscular myxoma with tumor markers in the literature. Case presentation A 45-year-old Caucasian woman presented to o...

  10. [Giant cell interstitial pneumonia in a metal grinder with an abnormally high level of serum CA19-9].

    Science.gov (United States)

    Seike, M; Usuki, J; Uematsu, K; Enomoto, T; Shinoda, K; Yoshimori, K; Fukuda, Y; Kudoh, S; Niitani, H

    1995-08-01

    Interstitial pneumonia and recurrent pneumothorax developed in a 48-year-old man who had worked as a metal grinder. He died of respiratory failure despite having received antibiotics and steroids, and despite having undergone pleural sclerosis therapy. Giant cell interstitial pneumonia was diagnosed; innumerable bizarre giant cells engulfing black granules were found within the alveoli. The results of high-energy dispersion X-ray microanalysis indicated that the patient had hard metal pneumoconiosis associated with tungsten in the black granules. When he was admitted to the hospital, his serum CA19-9 and SLEX concentrations were abnormally high (2600 and 200 ng/ml, respectively). Immunohistochemical analysis of lung tissue was done with anti-CA19-9 and SLEX antibodies. CA19-9 staining revealed strong bronchialization and squamous metaplasia in contrast to type II hyperplasia. SLEX staining showed strong type II hyperplasia. Further investigations will be needed to determine the mechanism of elevated tumor-associated carbohydrate antigens in serum.

  11. Clinical Significance and Prognostic Value of CA72-4 Compared with CEA and CA19-9 in Patients with Gastric Cancer

    Directory of Open Access Journals (Sweden)

    M. Ychou

    2000-01-01

    Full Text Available Carcinoembryonic antigen (CEA and CA 19-9 are both widely used in the follow up of patients with gastrointestinal cancer. More recently another tumor marker, named CA 72-4 has been identified and characterized using two different monoclonal antibodies B72.3 and CC49. Several reports evaluated CA 72-4 as a serum tumor marker for gastric cancer and compared its clinical utility with that of CEA or CA 19-9; few reports concerned its prognostic value. In the present study, CA 72-4 is evaluated and compared with CEA and CA 19-9 in various populations of patients with gastric cancer and benign disease; for 52 patients with gastric adenocarcinoma and 57 patients without neoplastic disease CEA, CA 19-9 and CA 72-4 were evaluated before treatment. Sensitivity of the tumor markers CA 72-4, CA 19-9 and CEA at the recommended cut-off level in all 52 patients were 58%, 50% the sensitivity increased to 75%. of these markers, for non metastatic patients, multivariate analyses indicated that none of the markers were significant, when adjusted for gender and age (which were indicators of poor prognosis; patients with abnormal values of CA72-4 tended to have shorter survival than patients with normal values (p < 0.07. In the metastatic population, only high values of CA19-9 (p < 0.02 and gender (women (p < 0.03 were indicators of poor prognosis in univariate analysis; multivariate analysis revealed that both CA72-4 (p = 0.034 and CA19-9 p = 0.009, adjusted for gender were independent prognostic factors. However, CA72-4 lost significance (p = 0.41 when adjusted for CA19-9 and gender, indicating that CA19-9 provides more prognostic information than CA72-4.

  12. Identification of a Novel Human Papillomavirus, Type HPV199, Isolated from a Nasopharynx and Anal Canal, and Complete Genomic Characterization of Papillomavirus Species Gamma-12.

    Directory of Open Access Journals (Sweden)

    Anja Oštrbenk

    Full Text Available The novel human papillomavirus type 199 (HPV199 was initially identified in a nasopharyngeal swab sample obtained from a 25 year-old immunocompetent male. The complete genome of HPV199 is 7,184 bp in length with a GC content of 36.5%. Comparative genomic characterization of HPV199 and its closest relatives showed the classical genomic organization of Gammapapillomaviruses (Gamma-PVs. HPV199 has seven major open reading frames (ORFs, encoding five early (E1, E2, E4, E6, and E7 and two late (L1 and L2 proteins, while lacking the E5 ORF. The long control region (LCR of 513 bp is located between the L1 and E6 ORFs. Phylogenetic analysis additionally confirmed that HPV-199 clusters into the Gamma-PV genus, species Gamma-12, additionally containing HPV127, HV132, HPV148, HPV165, and three putative HPV types: KC5, CG2 and CG3. HPV199 is most closely related to HPV127 (nucleotide identity 77%. The complete viral genome sequence of additional HPV199 isolate was determined from anal canal swab sample. Two HPV199 complete viral sequences exhibit 99.4% nucleotide identity. To the best of our knowledge, this is the first member of Gamma-PV with complete nucleotide sequences determined from two independent clinical samples. To evaluate the tissue tropism of the novel HPV type, 916 clinical samples were tested using HPV199 type-specific real-time PCR: HPV199 was detected in 2/76 tissue samples of histologically confirmed common warts, 2/108 samples of eyebrow hair follicles, 2/137 anal canal swabs obtained from individuals with clinically evident anal pathology, 4/184 nasopharyngeal swabs and 3/411 cervical swabs obtained from women with normal cervical cytology. Although HPV199 was found in 1.4% of cutaneous and mucosal samples only, it exhibits dual tissue tropism. According to the results of our study and literature data, dual tropism of all Gamma-12 members is highly possible.

  13. Locations of All Shotpoints for R/V GYRE Cruise G1-99-GM (99002) - GOM99SHTALLG.SHP

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — All shotpoint locations from multichannel seismics survey, USGS cruise G1-99-GM During June 1998 and April 1999, the U.S. Geological Survey (USGS) conducted two...

  14. Delayed radiation-induced inflammation accompanying a marked carbohydrate antigen 19-9 elevation in a patient with resected pancreatic cancer

    Energy Technology Data Exchange (ETDEWEB)

    Mattes, Malcolm D.; Cardinal, Jon S.; Jacobson, Geraldine M. [West Virginia University School of Medicine, Morgantown (United States)

    2016-06-15

    Although carbohydrate antigen (CA) 19-9 is a useful tumor marker for pancreatic cancer, it can also become elevated from a variety of benign and malignant conditions. Herein we describe an unusual presentation of elevated CA 19-9 in an asymptomatic patient who had previously undergone adjuvant chemotherapy and radiation therapy for resected early stage pancreatic cancer. The rise in CA 19-9 might be due to delayed radiation-induced inflammation related to previous intra-abdominal radiation therapy with or without radiation recall induced by gemcitabine. After treatment with corticosteroids the CA 19-9 level decreased to normal, and the patient has not developed any evidence of recurrent cancer to date.

  15. Transient human anti-mouse antibody generated with immune enhancement in a carbohydrate antigen 19-9 immunoassay after surgical resection of recurrent cancer.

    Science.gov (United States)

    Nakano, Keiichi; Yasuda, Keiko; Shibuya, Hitoshi; Moriyama, Takanori; Kahata, Kaoru; Shimizu, Chikara

    2016-07-01

    We report a case of transient human anti-mouse antibody from a 64-year-old man in a carbohydrate antigen 19-9 immunoassay using an AIA 1800 analyser that generated immune enhancement after surgical resection of recurrent cancer. The carbohydrate antigen 19-9 concentration was measured using an AIA 1800 analyser and a UniCel Dxl 800. Size-exclusion high-performance liquid chromatography was carried out on a Superose 12 column to estimate the carbohydrate antigen 19-9 elution profile using an AIA 1800 analyser. To determine whether IgM in the patient contributed to the carbohydrate antigen 19-9 immunoassay, immunoprecipitation was performed. Furthermore, mouse immunoglobulins were added to the patient's serum to verify that the patient's IgM reacted with it. The carbohydrate antigen 19-9 concentration was >400 and 9.5 kU/L using an AIA 1800 analyser and using a UniCel Dxl 800, respectively. In the single carbohydrate antigen 19-9 peak, the molecular weight corresponded to IgM by size-exclusion high-performance liquid chromatography on a Superose 12 column. In the immunoprecipitation reaction and addition of mouse immunoglobulins, there was interference for anti-human IgM and mouse immunoglobulins whose recoveries were 3.2 and 14.2%, respectively. These results indicated that IgM in the patient's serum interfered with the carbohydrate antigen 19-9 immunoassay using an AIA 1800 analyser. A novel transient human anti-mouse antibody generated with immune activation in a carbohydrate antigen 19-9 immunoassay using an AIA 1800 analyser was identified in a patient with rectal cancer after surgical resection. These findings demonstrate the importance of monitoring tumour markers in patients after treatment with mouse monoclonal antibody. © The Author(s) 2016.

  16. Cisplatin-induced downregulation of miR-199a-5p increases drug resistance by activating autophagy in HCC cell

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Ning; Zhang, Jianjun; Shen, Conghuan; Luo, Yi; Xia, Lei; Xue, Feng [Department of Transplantation and Hepatic Surgery, Renji Hospital, Shanghai Jiaotong University School of Medicine, 1630 Dongfang Road, Shanghai 200127, People' s Republic of China (China); Xia, Qiang, E-mail: xiaqiang1@yahoo.com.cn [Department of Transplantation and Hepatic Surgery, Renji Hospital, Shanghai Jiaotong University School of Medicine, 1630 Dongfang Road, Shanghai 200127, People' s Republic of China (China)

    2012-07-13

    Highlights: Black-Right-Pointing-Pointer miR-199a-5p levels were significantly decreased after cisplatin treatment. Black-Right-Pointing-Pointer Cisplatin treatment induced autophagy activation. Black-Right-Pointing-Pointer Cisplatin-induced downregulation of miR-199a-5p increases drug resistance by activating autophagy in HCC cell. -- Abstract: Hepatocellular carcinoma (HCC) is one of the most common cancers worldwide. Systemic chemotherapy plays an important role in the treatment of patients with advanced liver cancer. However, chemoresistance to cisplatin is a major limitation of cisplatin-based chemotherapy in the clinic, and the underlying mechanism of such resistance is not fully understood. In the study, we found that miR-199a-5p levels were significantly reduced in HCC patients treated with cisplatin-based chemotherapy. Cisplatin treatment also resulted in decreased miR-199a-5p levels in human HCC cell lines. Forced expression of miR-199a-5p promoted cisplatin-induced inhibition of cell proliferation. Cisplatin treatment activated autophagy in Huh7 and HepG2 cells, which increased cell proliferation. We further demonstrated that downregulated miR-199a-5p enhanced autophagy activation by targeting autophagy-associated gene 7 (ATG7). More important, autophagy inhibition abrogated miR-199a-5p downregulation-induced cell proliferation. These data demonstrated that miR-199a-5p/autophagy signaling represents a novel pathway regulating chemoresistance, thus offering a new target for chemotherapy of HCC.

  17. Reforming of the Judicial System of Kosovo based on the Law no. 03/L-199 on Courts and its challenges

    OpenAIRE

    Dr.Sc. Azem Hajdari; MSc. Shpresa Ibrahimi; MSc. Albulena Hajdari

    2014-01-01

    Law no. 03/L-199 on Courts1 represents a law of significant importance which regulates the organisation, functioning and jurisdiction of courts of the Republic of Kosovo. This law has made numerous reforms in the judicial system of the country. It has set the bases of a modern and sustainable judicial system. In fact the Law on Courts in addition to having changed the judiciary of Kosovo in the aspect of organisation, it has opened the paths in the aspect of ensuring an efficient functioning ...

  18. miR-199a-5p Is upregulated during fibrogenic response to tissue injury and mediates TGFbeta-induced lung fibroblast activation by targeting caveolin-1.

    Science.gov (United States)

    Lino Cardenas, Christian Lacks; Henaoui, Imène Sarah; Courcot, Elisabeth; Roderburg, Christoph; Cauffiez, Christelle; Aubert, Sébastien; Copin, Marie-Christine; Wallaert, Benoit; Glowacki, François; Dewaeles, Edmone; Milosevic, Jadranka; Maurizio, Julien; Tedrow, John; Marcet, Brice; Lo-Guidice, Jean-Marc; Kaminski, Naftali; Barbry, Pascal; Luedde, Tom; Perrais, Michael; Mari, Bernard; Pottier, Nicolas

    2013-01-01

    As miRNAs are associated with normal cellular processes, deregulation of miRNAs is thought to play a causative role in many complex diseases. Nevertheless, the precise contribution of miRNAs in fibrotic lung diseases, especially the idiopathic form (IPF), remains poorly understood. Given the poor response rate of IPF patients to current therapy, new insights into the pathogenic mechanisms controlling lung fibroblasts activation, the key cell type driving the fibrogenic process, are essential to develop new therapeutic strategies for this devastating disease. To identify miRNAs with potential roles in lung fibrogenesis, we performed a genome-wide assessment of miRNA expression in lungs from two different mouse strains known for their distinct susceptibility to develop lung fibrosis after bleomycin exposure. This led to the identification of miR-199a-5p as the best miRNA candidate associated with bleomycin response. Importantly, miR-199a-5p pulmonary expression was also significantly increased in IPF patients (94 IPF versus 83 controls). In particular, levels of miR-199a-5p were selectively increased in myofibroblasts from injured mouse lungs and fibroblastic foci, a histologic feature associated with IPF. Therefore, miR-199a-5p profibrotic effects were further investigated in cultured lung fibroblasts: miR-199a-5p expression was induced upon TGFβ exposure, and ectopic expression of miR-199a-5p was sufficient to promote the pathogenic activation of pulmonary fibroblasts including proliferation, migration, invasion, and differentiation into myofibroblasts. In addition, we demonstrated that miR-199a-5p is a key effector of TGFβ signaling in lung fibroblasts by regulating CAV1, a critical mediator of pulmonary fibrosis. Remarkably, aberrant expression of miR-199a-5p was also found in unilateral ureteral obstruction mouse model of kidney fibrosis, as well as in both bile duct ligation and CCl4-induced mouse models of liver fibrosis, suggesting that dysregulation of mi

  19. Five Year Results of US Intergroup/RTOG 9704 With Postoperative CA 19-9 {<=}90 U/mL and Comparison to the CONKO-001 Trial

    Energy Technology Data Exchange (ETDEWEB)

    Berger, Adam C., E-mail: adam.berger@jefferson.edu [Thomas Jefferson University Hospital, Philadelphia, Pennsylvania (United States); Winter, Kathryn [RTOG Statistical Center, Philadelphia, Pennsylvania (United States); Hoffman, John P. [Fox Chase Cancer Center, Philadelphia, Pennsylvania (United States); Regine, William F. [University of Maryland Medical Systems, Baltimore, Maryland (United States); Abrams, Ross A. [Rush University Medical Center, Chicago, Illinois (United States); Safran, Howard [Division of Hematology/Oncology, The Miriam Hospital, Providence, Rhode Island (United States); Freedman, Gary M. [Fox Chase Cancer Center, Philadelphia, Pennsylvania (United States); Benson, Alan B. [Northwestern Memorial Hospital, Chicago, Illinois (United States); MacDonald, John [St. Vincent' s Comprehensive Cancer Center, New York, New York (United States); Willett, Christopher G. [Duke University Medical Center, Durham, North Carolina (United States)

    2012-11-01

    Purpose: Radiation Therapy Oncology Group (RTOG) trial 9704 was the largest randomized trial to use adjuvant chemoradiation therapy for patients with pancreatic cancer. This report analyzes 5-year survival by serum level of tumor marker CA 19-9 of {<=}90 vs >90 U/mL and compares results to the those of the CONKO-001 trial. Methods and Materials: CA 19-9 expression was analyzed as a dichotomized variable ({<=}90 vs >90 U/mL). Cox proportional hazard models were used to identify the impact of the CA 19-9 value on overall survival (OS). Actuarial estimates of OS were calculated using the Kaplan-Meier method. Results: Both univariate (hazard ratio [HR] = 3.2; 95% confidence interval [CI], 2.3-4.3, P<.0001) and multivariate (HR = 3.1; 95% CI, 2.2-4.2, P<.0001) analyses demonstrated a statistically significant decrease in OS for CA 19-9 serum level of {>=}90 U/mL. For patients in the gemcitabine (Gem) treatment arm with CA 19-9 <90 U/mL, median survival was 21 months. For patients with CA 19-9 {>=}90 U/mL, this number dropped to 10 months. In patients with pancreatic head tumors in the Gem treatment arm with RT quality assurance per protocol and CA 19-9 of <90 U/mL, median survival and 5-year rate were 24 months and 34%. In comparison, the median survival and 5-year OS rate for patients in the Gem arm of the CONKO trial were 22 months and 21%. Conclusions: This analysis demonstrates that patients with postresection CA 19-9 values {>=}90 U/mL had a significantly worse survival. Patients with pancreatic head tumors treated with Gem with CA 19-9 serum level of <90 U/mL and per protocol RT had favorable survival compared to that seen in the CONKO trial. CA 19-9 is a stratification factor for the current RTOG adjuvant pancreas trial (0848).

  20. miR-199a-5p Is upregulated during fibrogenic response to tissue injury and mediates TGFbeta-induced lung fibroblast activation by targeting caveolin-1.

    Directory of Open Access Journals (Sweden)

    Christian Lacks Lino Cardenas

    Full Text Available As miRNAs are associated with normal cellular processes, deregulation of miRNAs is thought to play a causative role in many complex diseases. Nevertheless, the precise contribution of miRNAs in fibrotic lung diseases, especially the idiopathic form (IPF, remains poorly understood. Given the poor response rate of IPF patients to current therapy, new insights into the pathogenic mechanisms controlling lung fibroblasts activation, the key cell type driving the fibrogenic process, are essential to develop new therapeutic strategies for this devastating disease. To identify miRNAs with potential roles in lung fibrogenesis, we performed a genome-wide assessment of miRNA expression in lungs from two different mouse strains known for their distinct susceptibility to develop lung fibrosis after bleomycin exposure. This led to the identification of miR-199a-5p as the best miRNA candidate associated with bleomycin response. Importantly, miR-199a-5p pulmonary expression was also significantly increased in IPF patients (94 IPF versus 83 controls. In particular, levels of miR-199a-5p were selectively increased in myofibroblasts from injured mouse lungs and fibroblastic foci, a histologic feature associated with IPF. Therefore, miR-199a-5p profibrotic effects were further investigated in cultured lung fibroblasts: miR-199a-5p expression was induced upon TGFβ exposure, and ectopic expression of miR-199a-5p was sufficient to promote the pathogenic activation of pulmonary fibroblasts including proliferation, migration, invasion, and differentiation into myofibroblasts. In addition, we demonstrated that miR-199a-5p is a key effector of TGFβ signaling in lung fibroblasts by regulating CAV1, a critical mediator of pulmonary fibrosis. Remarkably, aberrant expression of miR-199a-5p was also found in unilateral ureteral obstruction mouse model of kidney fibrosis, as well as in both bile duct ligation and CCl4-induced mouse models of liver fibrosis, suggesting that

  1. miR-199a-5p Is Upregulated during Fibrogenic Response to Tissue Injury and Mediates TGFbeta-Induced Lung Fibroblast Activation by Targeting Caveolin-1

    Science.gov (United States)

    Courcot, Elisabeth; Roderburg, Christoph; Cauffiez, Christelle; Aubert, Sébastien; Copin, Marie-Christine; Wallaert, Benoit; Glowacki, François; Dewaeles, Edmone; Milosevic, Jadranka; Maurizio, Julien; Tedrow, John; Marcet, Brice; Lo-Guidice, Jean-Marc; Kaminski, Naftali; Barbry, Pascal; Luedde, Tom; Perrais, Michael

    2013-01-01

    As miRNAs are associated with normal cellular processes, deregulation of miRNAs is thought to play a causative role in many complex diseases. Nevertheless, the precise contribution of miRNAs in fibrotic lung diseases, especially the idiopathic form (IPF), remains poorly understood. Given the poor response rate of IPF patients to current therapy, new insights into the pathogenic mechanisms controlling lung fibroblasts activation, the key cell type driving the fibrogenic process, are essential to develop new therapeutic strategies for this devastating disease. To identify miRNAs with potential roles in lung fibrogenesis, we performed a genome-wide assessment of miRNA expression in lungs from two different mouse strains known for their distinct susceptibility to develop lung fibrosis after bleomycin exposure. This led to the identification of miR-199a-5p as the best miRNA candidate associated with bleomycin response. Importantly, miR-199a-5p pulmonary expression was also significantly increased in IPF patients (94 IPF versus 83 controls). In particular, levels of miR-199a-5p were selectively increased in myofibroblasts from injured mouse lungs and fibroblastic foci, a histologic feature associated with IPF. Therefore, miR-199a-5p profibrotic effects were further investigated in cultured lung fibroblasts: miR-199a-5p expression was induced upon TGFβ exposure, and ectopic expression of miR-199a-5p was sufficient to promote the pathogenic activation of pulmonary fibroblasts including proliferation, migration, invasion, and differentiation into myofibroblasts. In addition, we demonstrated that miR-199a-5p is a key effector of TGFβ signaling in lung fibroblasts by regulating CAV1, a critical mediator of pulmonary fibrosis. Remarkably, aberrant expression of miR-199a-5p was also found in unilateral ureteral obstruction mouse model of kidney fibrosis, as well as in both bile duct ligation and CCl4-induced mouse models of liver fibrosis, suggesting that dysregulation of mi

  2. Association between expression levels of CA 19-9 and N-acetylglucosamine-beta;1,3-galactosyltransferase 5 gene in human pancreatic cancer tissue.

    Science.gov (United States)

    Hayashi, Nobuyasu; Nakamori, Shoji; Okami, Jiro; Nagano, Hiroaki; Dono, Keizo; Umeshita, Koji; Sakon, Masato; Narimatsu, Hisashi; Monden, Morito

    2004-01-01

    CA 19-9, equivalent to Sialyl Lewis antigen, is a well-known tumor marker in pancreatic cancer. At the initial step of the biosynthesis of CA 19-9, N-acetylglucosamine-beta1,3-galactosyltransferase (beta3Gal-T) transfers galactose to N-acetylglucosamine (GlcNAc). Recently, beta3Gal-T5 has been presumed to be related to the formation of the type 1 chain in an in vitro experiment in terms of kinetic enzyme characterization. The purpose of this study was to investigate which beta3Gal-T is related to the synthesis of CA 19-9 in human pancreatic cancer tissues. We examined beta;3Gal-T1, T2, T3, T4, and beta;3Gal-T5 mRNA expressions in 13 noncancerous and cancerous tissues of the human pancreas using real-time polymerase chain reaction, and compared those gene expression levels with the immunoreactivity of CA 19-9 and its precursor DUPAN-2 in cancerous tissues. Beta;3Gal-T5 gene expression significantly augmented in cancerous tissues, when compared with the adjacent noncancerous tissues. Additionally, there was a good correlation between BETA;3GAL-T5 gene transcription levels and immunohistochemical grades of CA 19-9 or its precursor DUPAN-2 in cancerous tissues. However, no correlation was observed between beta;3Gal-T1, T2, T3, and beta;3Gal-T4 gene expression levels and CA 19-9 or DUPAN-2 immunoreactive grades in cancerous tissue. beta3Gal-T5 is presumed to be responsible for the synthesis of CA 19-9 in pancreatic cancer tissue. Copyright 2004 S. Karger AG, Basel

  3. CA 19-9 level in patients with type 2 diabetes mellitus and its relation to the metabolic control and microvascular complications.

    Science.gov (United States)

    Gul, Kamile; Nas, Sevinc; Ozdemir, Didem; Gumus, Mehmet; Ersoy, Reyhan; Cakir, Bekir

    2011-01-01

    The aim of this study is to compare CA 19-9 levels in patients with type 2 diabetes mellitus (DM) and healthy control group. The relation of CA 19-9 levels to metabolic control and microvascular complications in patients with diabetes was also investigated. Three hundred forty patients with type 2 DM and age-, sex- and body mass index-matched 214 healthy controls group were included in the study. HbA₁(c), duration of DM and microvascular complications of DM were reviewed. CA 19-9 levels (normal range, 0-35 U/mL) were measured in all participants. Median CA 19-9 level was significantly higher in patients with diabetes compared with control group [19.5 U/mL (0-214.8 U/mL) versus 7.4 U/mL (0.4-47.0 U/mL)] (P diabetes was 31.2%, and CA 19-9 level was positively correlated with age, duration of diabetes, HbA₁(c) and number of complications. Effects of duration of diabetes, HbA₁(c) and diabetic nephropathy were still continuing in multiple linear regression analysis. Using regression coefficients of all variables in multiple regression analysis, this study tried to determine a new cutoff value for CA 19-9 level in patients with diabetes. The cutoff value at 97th percentile was 57.14 U/mL. High CA 19-9 value in patients with diabetes may indicate the need for a careful evaluation of blood glucose regulation and investigation of complications. Defining a new cutoff value in these patients would prevent unnecessary laboratory or imaging procedures.

  4. A solution for distinguishing Le(a-b-) sera in CA19-9 assays using SphereLight 180 and Architect i2000 assays.

    Science.gov (United States)

    Hanada, Hiroyuki; Mugii, Satomi; Takeoka, Keiko; Maeda, Ikuhiro; Watanabe, Mikio; Hidaka, Yoh; Iwatani, Yoshinori

    2012-01-18

    Measurement of carbohydrate antigen (CA) 19-9 is not applicable in patients with Lewis (Le) blood type, Le(a-b-). It is important to distinguish cases with Le(a-b-) before CA19-9 measurement. Therefore, we prepared a cut-off solution that gives a clear index to distinguish Le(a-b-) sera. The frequencies of Le blood types and the distribution of the CA19-9 values in each Le blood type were examined in 188 healthy subjects. The CA19-9 values for all Le(a-b-) sera and for a portion of Le(a-b+) sera exist below the limit of quantitation as measured by the SphereLight 180 kit. The cut-off solution, which gives a clear cut-off index (COI), was prepared to differentiate Le(a-b-) from Le(a-b+), and was evaluated using the SphereLight 180, Architect i2000, UniCel DxI 800, Elecsys 2010, and Lumipuls ƒ kits. The COI was calculated as the mean +3 SD of the CA19-9 values of a cut-off solution that is adjusted to the limit of detection. Both the sensitivities and specificities of the COIs were 100% using the SphereLight 180 kit and 100% and 91.7%, respectively, using the Architect i2000 kit, but these values were not satisfactory using the other CA19-9 assay kits. The COIs, determined by the cut-off solution, correctly identified all Le(a-b-) sera as Le(a-b-) and differentiated Le(a-b-) sera from other types of sera in CA19-9 assays using only the SphereLight 180 and Architect i2000 kits. Copyright © 2011 Elsevier B.V. All rights reserved.

  5. MicroRNA-199b Modulates Vascular Cell Fate During iPS Cell Differentiation by Targeting the Notch Ligand Jagged1 and Enhancing VEGF Signaling.

    Science.gov (United States)

    Chen, Ting; Margariti, Andriana; Kelaini, Sophia; Cochrane, Amy; Guha, Shaunta T; Hu, Yanhua; Stitt, Alan W; Zhang, Li; Xu, Qingbo

    2015-05-01

    Recent ability to derive endothelial cells (ECs) from induced pluripotent stem (iPS) cells holds a great therapeutic potential for personalized medicine and stem cell therapy. We aimed that better understanding of the complex molecular signals that are evoked during iPS cell differentiation toward ECs may allow specific targeting of their activities to enhance cell differentiation and promote tissue regeneration. In this study, we have generated mouse iPS cells from fibroblasts using established protocol. When iPS cells were cultivated on type IV mouse collagen-coated dishes in differentiation medium, cell differentiation toward vascular lineages were observed. To study the molecular mechanisms of iPS cell differentiation, we found that miR-199b is involved in EC differentiation. A step-wise increase in expression of miR-199 was detected during EC differentiation. Notably, miR-199b targeted the Notch ligand JAG1, resulting in vascular endothelial growth factor (VEGF) transcriptional activation and secretion through the transcription factor STAT3. Upon shRNA-mediated knockdown of the Notch ligand JAG1, the regulatory effect of miR-199b was ablated and there was robust induction of STAT3 and VEGF during EC differentiation. Knockdown of JAG1 also inhibited miR-199b-mediated inhibition of iPS cell differentiation toward smooth muscle markers. Using the in vitro tube formation assay and implanted Matrigel plugs, in vivo, miR-199b also regulated VEGF expression and angiogenesis. This study indicates a novel role for miR-199b as a regulator of the phenotypic switch during vascular cell differentiation derived from iPS cells by regulating critical signaling angiogenic responses. Stem Cells 2015;33:1405-1418. © 2015 AlphaMed Press.

  6. Effect of ultrasound combined with determination of CA19-9 and hs-CRP on the accuracy of early diagnosis of gallbladder cancer

    Directory of Open Access Journals (Sweden)

    Hang-yu ZHANG

    2014-03-01

    Full Text Available Objective  To investigate the value of ultrasound combined with tumor marker CA19-9 and high sensitivity C reactive protein (hs-CRP on the accuracy of early diagnosis of gallbladder cancer. Methods  Ninety-five patients with pathologically confirmed primary gallbladder cancer who received cholecystectomy from Jan. 2008 to Jan. 2013 in our hospital were included in the study. The study also included 51 patients with benign cystic lesions and 51 healthy adults. In all patients, results of pathological examination, B-ultrasound, serum CA19-9 and hs-CRP detection were obtained. In all the healthy adults gallbladder diseases were ruled out, but all of them received serum CA19-9 and hs-CRP determination. Results  Of 95 patients with primary gallbladder cancer, B-ultrasound showed nodules in the gallbladder lumen in 31, tumor mass in 40, and thickened wall in 24. Histological examination showed adenocarcinoma in 87 cases, adenosquamous carcinoma in 6, and squamous carcinoma in 2. There was a statistical difference in hs-CRP and CA19-9 levels between the groups (P<0.05, and the highest level appeared in gallbladder cancer group. There was a high sensitivity but low specificity of CA19-9 or hs-CRP in the diagnosis of primary gallbladder cancer. The sensitivity and specificity were 74.7% and 75.0% when primary gallbladder cancer was diagnosed with B-ultrasound. The positive values of CA19-9 and hs-CRP were ≥100U/ml and ≥6mg/L respectively, when they were combined with B-ultrasound as a single serology factor. When both B-ultrasound and serum levels of CA19-9 and hs-CRP were positive, the diagnostic sensitivity and specificity were 71.6% and 84.4% respectively. When B-ultrasound or serum CA19-9 and hs-CRP were positive, the diagnostic sensitivity and specificity were 98.9% and 66.7% respectively. Conclusions  Combination of B-ultrasound and determination of serum of CA19-9 and hs-CRP can improve the accuracy of the diagnosis of gallbladder

  7. Factors related to serum level of carbohydrate antigen 19-9 and cancer antigen 125 in healthy rural populations in Korea

    Energy Technology Data Exchange (ETDEWEB)

    Lee, S. K.; Yoo, K. Y.; Park, S. K.; Kang, D. H.; Kim, J. K.; Jeong, Z. K.; Lee, M. C. [College of Medicine, Seoul National Univ., Seoul (Korea, Republic of)

    1998-01-01

    This study examines the levels of carbohydrate antigen 19-9(CA 19-9) and cancer antigen 125(CA125) in serum and its related factors in healthy Korean population. Although CA19-9 and CA125 have been widely used tumor markers for gastroenteric cancers and ovarian cancer in Western countries, there are no information available on the serum levels of CA19-9 and CA125 in healthy population and the factors affecting the levels of these tumor markers in Korea. A cross-sectional study was performed to measure CA19-9 and CA125 among 76 healthy males and 95 healthy females in Korea. CA19-9 and CA125 were quantitated using solid-phase radioimmunoassay kits. Informations on the factors which might be related to the levels of these markers were collected by questionnaire(e.g., smoking, alcohol consumption, menstruation, oral pill use, breast-feeding history, etc.). There was no statistically significant difference in the mean of CA19-9 concentration between men(10.4 u/ml) and women (10.1 u/ml), whereas the mean of CA125 levels (11.2 u/ml) was higher in women than that(2.5 u/ml) in men. Although there was a statistically significant association between CA19-9 and average number of cigarette consumed per day (r=0.59, p=0.026) and total number of cigarettes consumed in women (r=0.74, p=0.003), the significance disappeared by multiple regression analysis after adjusting age and body mass index. Later age of menopause(p=0.035) and longer duration of breast-feeding(p=0.050) were significant predictors for CA125 levels in women by multiple regression analysis after adjusting age and body mass index. In conclusion, CA19-9 can be used as a stable tumor marker in clinical practices, however, menstruation and breast-feeding should be considered when CA125 is used in women.

  8. Whole Genome Sequencing of 39 Invasive Streptococcus pneumoniae Sequence Type 199 Isolates Revealed Switches from Serotype 19A to 15B.

    Science.gov (United States)

    Makarewicz, Oliwia; Lucas, Marie; Brandt, Christian; Herrmann, Leonie; Albersmeier, Andreas; Rückert, Christian; Blom, Jochen; Goesmann, Alexander; van der Linden, Mark; Kalinowski, Jörn; Pletz, Mathias W

    2017-01-01

    Streptococcus pneumoniae is a major pathogen that causes different invasive pneumococcal diseases (IPD). The pneumococcal polysaccharide capsule is a main virulence factor. More than 94 capsule types have been described, but only a limited number of capsule types accounted for the majority of IPD cases before the introduction of pneumococcal vaccines. After the introduction of the conjugated pneumococcal vaccine PCV7, which covered the seven most frequent serotypes in IPD in the USA, an increase in IPD caused by non-vaccine serotypes was observed, and serotype 19A, which belongs to sequence type (ST) 199, was among the most prevalent STs. After the introduction of the extended vaccine PCV13, which includes serotype 19A, serogroup 15B/C increased in IPD. Therefore, whole genome sequences of 39 isolates of ST199 from Germany (collected between 1998 and 2011) with serotype 19A (n = 24) and serogroup 15B/C (n = 15) were obtained using an Illumina platform and were analysed to identify capsular switches within ST199. Two 19A to 15B/C serotype switch events were identified. Both events occurred before the introduction of PCV7, which indicates that a capsular switch from 19A to 15B among ST199 isolates is not unusual and is not directly linked to the vaccination. The observed serotype replacement appears to be the result of a vacant niche due to the displacement of vaccine serotypes that is now successfully occupied by ST199 clones.

  9. MiRNA-199a-3p Regulates C2C12 Myoblast Differentiation through IGF-1/AKT/mTOR Signal Pathway

    Directory of Open Access Journals (Sweden)

    Long Jia

    2013-12-01

    Full Text Available MicroRNAs constitute a class of ~22-nucleotide non-coding RNAs. They modulate gene expression by associating with the 3' untranslated regions (3' UTRs of messenger RNAs (mRNAs. Although multiple miRNAs are known to be regulated during myoblast differentiation, their individual roles in muscle development are still not fully understood. In this study, we showed that miR-199a-3p was highly expressed in skeletal muscle and was induced during C2C12 myoblasts differentiation. We also identified and confirmed several genes of the IGF-1/AKT/mTOR signal pathway, including IGF-1, mTOR, and RPS6KA6, as important cellular targets of miR-199a-3p in myoblasts. Overexpression of miR-199a-3p partially blocked C2C12 myoblast differentiation and the activation of AKT/mTOR signal pathway, while interference of miR-199a-3p by antisense oligonucleotides promoted C2C12 differentiation and myotube hypertrophy. Thus, our studies have established miR-199a-3p as a potential regulator of myogenesis through the suppression of IGF-1/AKT/mTOR signal pathway.

  10. 199 years of Parkinson disease - what have we learned and what is the path to the future?

    Science.gov (United States)

    Schulz, Jörg B; Hausmann, Laura; Hardy, John

    2016-10-01

    In 1817, 199 years ago, James Parkinson described for the first time in 'An Essay on the Shaking Palsy' the symptoms of the disease that was later named Parkinson Disease. The current special issue of the Journal of Neurochemistry is dedicated to the discoveries and advances that have been made since, leading to a better understanding of this neurodegenerative disease and of potential treatment options. Reputed researchers cover various aspects from neuroanatomical basics; genetic and molecular risk factors such as LRRK2; the available cell and animal models that mimic crucial features of the pathophysiology; to clinical aspects and treatments, including deep brain stimulation. This article is part of a special issue on Parkinson disease. © 2016 International Society for Neurochemistry.

  11. Double-neutron capture reaction and natural abundance of 183W, 195Pt and 199Hg isotopes

    Science.gov (United States)

    Karamian, S. A.; Aksenov, N. V.; Bozhikov, G. A.

    2016-06-01

    There are much data on neutron cross sections over the chart of nuclides for stable isotopes and not as much for the radioactive ones. Double neutron capture experiments could be fruitful to provide more data. Time-integrated mean flux of slow neutrons reaches the value of 2.3-1012 n/cm2 s at the irradiation port near the active zone of the IBR-2 pulsed reactor of JINR. This is enough to detect the double neutron capture products by the activation method. A high capture cross section is obtained in the present experiment for intermediate radioactive 182Ta and 194Ir target nuclides. Together with the known data for 198Au, these values may prove an essential role of double neutron capture process for nucleosynthesis of 183W, 195Pt and 199Hg isotopes at stellar conditions.

  12. Measurement of a false electric dipole moment signal from $^{199}$Hg atoms exposed to an inhomogeneous magnetic field

    CERN Document Server

    Afach, S; Ban, G; Bison, G; Bodek, K; Chowdhuri, Z; Daum, M; Fertl, M; Franke, B; Geltenbort, P; Green, K; van der Grinten, M G D; Grujic, Z; Harris, P G; Heil, W; Hélaine, V; Henneck, R; Horras, M; Iaydjiev, P; Ivanov, S N; Kasprzak, M; Kermaïdic, Y; Kirch, K; Knowles, P; Koch, H -C; Komposch, S; Kozela, A; Krempel, J; Lauss, B; Lefort, T; Lemière, Y; Mtchedlishvili, A; Naviliat-Cuncic, O; Pendlebury, J M; Piegsa, F M; Pignol, G; Prashant, P N; Quéméner, G; Rebreyend, D; Ries, D; Roccia, S; Schmidt-Wellenburg, P; Severijns, N; Weis, A; Wursten, E; Wyszynski, G; Zejma, J; Zenner, J; Zsigmond, G

    2015-01-01

    We report on the measurement of a Larmor frequency shift proportional to the electric-field strength for $^{199}{\\rm Hg}$ atoms contained in a volume permeated with aligned magnetic and electric fields. This shift arises from the interplay between the inevitable magnetic field gradients and the motional magnetic field. The proportionality to electric-field strength makes it apparently similar to an electric dipole moment (EDM) signal, although unlike an EDM this effect is P- and T-conserving. We have used a neutron magnetic resonance EDM spectrometer, featuring a mercury co-magnetometer and an array of external cesium magnetometers, to measure the shift as a function of the applied magnetic field gradient. Our results are in good agreement with theoretical expectations.

  13. Study of serum antioxidant capacity and relation with CA 19-9 and PSA in patients with gastrointestinal tract and prostate tumors.

    Science.gov (United States)

    López Vélez, M; Martínez Martínez, F

    2011-09-01

    We undertook the present study to investigate the possible relation between total antioxidant capacity (TAC) and tumor marker (TM) values in serum samples of patients with and without gastrointestinal tract and prostate tumors. We measured the TAC using trolox equivalent antioxidant capacity (TEAC) and oxygen radical absorption capacity (ORAC) assays in 80 serum samples: 20 presented elevated values of CA 19-9; 20 had elevated PSA levels and two groups of 20 samples had values within reference ranges respectively. Total antioxidant capacity - measured using the two different analytical methods - was higher in serum samples from patients with elevated CA 19-9 and PSA levels. This antioxidant status, measured by ORAC assay, correlated significantly with CA 19-9 (r: 0.502, Pantioxidant capacity in these pathological processes could contribute to improve diagnosis of these patients. Copyright © 2011 The Canadian Society of Clinical Chemists. Published by Elsevier Inc. All rights reserved.

  14. Treatment of Ruptured Ovarian Endometrioma with Extremely High CA 125, Moderately High CA 19-9 and CA 15-3 Level

    Directory of Open Access Journals (Sweden)

    Muzeyyen Duran

    2013-06-01

    Full Text Available In this case report, a ruptured ovarian endometrioma with a very high CA-125 level, moderately elevated CA 19-9, and CA 15-3 levels is presented. A 20 years old patient, complaining from pelvic pain, 5 cm adnexial mass was detected on left side. Biochemical examination was revealed very high CA-125 value (2556IU/ml, moderately elevated CA 19-9 (134IU/ml, and CA 15-3 (65IU/ml values. Laparoscopy was done and a ruptured ovarian endometrioma of 5 cm was seen during operation. After the total excision of the cyst, tumor markers fell rapidly. Very high CA-125 value, moderately elevated CA19-9, and CA 15-3 values can be seen in cases with ruptured endometrioma. In young patients, endometrioma must be considered firstly and laparoscopy should be applied instead of more invasive methods unless there was any finding or strong suspicion about malignancy.

  15. The progression of liver fibrosis is related with overexpression of the miR-199 and 200 families.

    Science.gov (United States)

    Murakami, Yoshiki; Toyoda, Hidenori; Tanaka, Masami; Kuroda, Masahiko; Harada, Yoshinori; Matsuda, Fumihiko; Tajima, Atsushi; Kosaka, Nobuyoshi; Ochiya, Takahiro; Shimotohno, Kunitada

    2011-01-24

    Chronic hepatitis C (CH) can develop into liver cirrhosis (LC) and hepatocellular carcinoma (HCC). Liver fibrosis and HCC development are strongly correlated, but there is no effective treatment against fibrosis because the critical mechanism of progression of liver fibrosis is not fully understood. microRNAs (miRNAs) are now essential to the molecular mechanisms of several biological processes. In order to clarify how the aberrant expression of miRNAs participates in development of the liver fibrosis, we analyzed the liver fibrosis in mouse liver fibrosis model and human clinical samples. In a CCL(4)-induced mouse liver fibrosis model, we compared the miRNA expression profile from CCL(4) and olive oil administrated liver specimens on 4, 6, and 8 weeks. We also measured expression profiles of human miRNAs in the liver biopsy specimens from 105 CH type C patients without a history of anti-viral therapy. Eleven mouse miRNAs were significantly elevated in progressed liver fibrosis relative to control. By using a large amount of human material in CH analysis, we determined the miRNA expression pattern according to the grade of liver fibrosis. We detected several human miRNAs whose expression levels were correlated with the degree of progression of liver fibrosis. In both the mouse and human studies, the expression levels of miR-199a, 199a*, 200a, and 200b were positively and significantly correlated to the progressed liver fibrosis. The expression level of fibrosis related genes in hepatic stellate cells (HSC), were significantly increased by overexpression of these miRNAs. Four miRNAs are tightly related to the grade of liver fibrosis in both human and mouse was shown. This information may uncover the critical mechanism of progression of liver fibrosis. miRNA expression profiling has potential for diagnostic and therapeutic applications.

  16. The progression of liver fibrosis is related with overexpression of the miR-199 and 200 families.

    Directory of Open Access Journals (Sweden)

    Yoshiki Murakami

    Full Text Available BACKGROUND: Chronic hepatitis C (CH can develop into liver cirrhosis (LC and hepatocellular carcinoma (HCC. Liver fibrosis and HCC development are strongly correlated, but there is no effective treatment against fibrosis because the critical mechanism of progression of liver fibrosis is not fully understood. microRNAs (miRNAs are now essential to the molecular mechanisms of several biological processes. In order to clarify how the aberrant expression of miRNAs participates in development of the liver fibrosis, we analyzed the liver fibrosis in mouse liver fibrosis model and human clinical samples. METHODOLOGY: In a CCL(4-induced mouse liver fibrosis model, we compared the miRNA expression profile from CCL(4 and olive oil administrated liver specimens on 4, 6, and 8 weeks. We also measured expression profiles of human miRNAs in the liver biopsy specimens from 105 CH type C patients without a history of anti-viral therapy. PRINCIPLE FINDINGS: Eleven mouse miRNAs were significantly elevated in progressed liver fibrosis relative to control. By using a large amount of human material in CH analysis, we determined the miRNA expression pattern according to the grade of liver fibrosis. We detected several human miRNAs whose expression levels were correlated with the degree of progression of liver fibrosis. In both the mouse and human studies, the expression levels of miR-199a, 199a*, 200a, and 200b were positively and significantly correlated to the progressed liver fibrosis. The expression level of fibrosis related genes in hepatic stellate cells (HSC, were significantly increased by overexpression of these miRNAs. CONCLUSION: Four miRNAs are tightly related to the grade of liver fibrosis in both human and mouse was shown. This information may uncover the critical mechanism of progression of liver fibrosis. miRNA expression profiling has potential for diagnostic and therapeutic applications.

  17. Biosynthesis of poly(3-hydroxybutyrate) and its copolymers by Yangia sp. ND199 from different carbon sources.

    Science.gov (United States)

    Huu Phong, Tran; Van Thuoc, Doan; Sudesh, Kumar

    2016-03-01

    A halophilic bacterium isolated from mangrove soil sample in Northern Vietnam, Yangia sp. ND199 was found capable of producing homopolymer poly(3-hydroxybutyrate) [P(3HB)], copolymer poly(3-hydroxybutyrate-co-3-hydroxyvalerate) [P(3HB-co-3HV)], and copolymer poly(3-hydroxybutyrate-co-4-hydroxybutyrate) [P(3HB-co-4HB)] from different carbon sources. The presence of 3HB, 3HV, and 4HB monomers were confirmed by gas chromatography and nuclear magnetic resonance analysis. Only P(3HB) was produced using carbon sources such as fructose or by a combination of fructose with 1,5-pentanediol, 1,6-hexanediol, sodium hexanoate, or sodium octanoate. The biosynthesis of P(3HB-co-3HV) was achieved by adding cosubstrates such as sodium valerate and sodium heptanoate. When 1,4-butanediol, γ-butyrolactone or sodium 4-hydroxybutyrate was added to the culture medium, P(3HB-co-4HB) containing 4.0-7.1mol% 4HB fraction was accumulated. The molecular weights and thermal properties of polyesters were determined by gel permeation chromatography and differential scanning calorimeter, respectively. The results showed that Yangia sp. ND199 is able to produce polyester with high weight average molecular weight ranging from 1.3×10(6) to 2.2×10(6) Dalton and number average molecular weight ranging from 4.2×10(5) to 6.9×10(5) Dalton. The molecular weights, glass transition temperature as well as melting temperature of homopolymer P(3HB) are higher than those of copolymer P(3HB-co-3HV) or P(3HB-co-4HB). Copyright © 2015 Elsevier B.V. All rights reserved.

  18. Effect of rabdosia rubescens combined with new assistant chemotherapy on serum CA199, CEA, CA15-3 and T lymphocyte subsets in patients with breast cancer

    Directory of Open Access Journals (Sweden)

    Lei Xi

    2018-07-01

    Full Text Available Objective: To study the effects of Rabdosia rubescens combined with neoadjuvant chemotherapy on serum CA199, CEA, CA15-3 levels and T lymphocyte subsets in patients with breast cancer. Methods: A total of 70 patients with breast cancer in our hospital were enrolled as the subjects of this study. The subjects were divided into control group (n=35 and treatment group (n=35 randomly. Patients in the control group were treated with new assistant chemotherapy, while those who were in the treatment group were treated with rabdosia rubescens combined with new assistant chemotherapy. The two groups of patients were treated for 3 periods. The serum CA199, CEA, CA15-3 levels and peripheral blood CD4+, CD8+, CD4+/CD8+ cells of the two groups before and after treatment were compared. Results: There were no significantly differences among the serum CA199, CEA, CA15-3 levels and peripheral blood CD4+, CD8+, CD4+/CD8+ cells of the two groups before treatment. The serum CA199, CEA and CA15-3 levels of the two groups after treatment were significantly lower than those before treatment, besides, the serum CA199, CEA and CA15-3 levels of the treatment group were significantly lower than those of the control group. The peripheral blood CD4+, CD4+/ CD8+ cells of the control group after treatment were significantly lower than before treatment, and the peripheral blood CD4+, CD4+/CD8+ cells of the treatment group after treatment were significantly higher than those of the control group. Conclusion: Rabdosia rubescens combined with new assistant chemotherapycan can significantly reduce the serum CA199, CEA and CA15-3 levels, and improve peripheral blood CD4+, CD8+, CD4+/CD8+ levels of patients with breast cancer. It is worthy of clinical application.

  19. Herlyn-Werner-Wunderlich Syndrome: A Rare Cause of Pelvic Pain and High CA 19-9 Levels in an Adolescent Girl.

    Science.gov (United States)

    Unal, Emel; Tanyildiz, Hikmet Gulsah; Sonmezer, Murat; Erkol, Hatice Gul; Fitoz, Suat

    2016-01-01

    Herlyn-Werner-Wunderlich (HWW) syndrome is a rare developmental anomaly that includes uterus didelphys with obstructed hemivagina and ipsilateral renal agenesis. A 13-year-old girl presented with chronic abdominal pain. Magnetic resonance imaging revealed uterus didelphys, hematometrocolpos and renal agenesis on the right side with imperforate hymen. Subsequently the patient was found to have Mullerian duct anomalies. CA 19-9 level was high. At laparoscopy combined with vaginoscopy hematocolpos was drained following which she improved clinically and CA 19-9 level returned to normal.

  20. Archaeological Excavation Report for Proposed Well 199-K-131 in Support of the 100-KR-4 Pump-and-Treat Project

    Energy Technology Data Exchange (ETDEWEB)

    Woody, Dave M.; Prendergast-Kennedy, Ellen L.

    2004-06-22

    An archaeological excavation was conducted at the site of proposed groundwater monitoring well 199-K-131 in support of the 100-KR-4 Pump-and-Treat Project between June 2 and 3, 2004. Excavations confirmed that there were no intact cultural deposits at the proposed well location. This report was prepared to document the findings of the test excavation.

  1. The Cu-MOF-199/single-walled carbon nanotubes modified electrode for simultaneous determination of hydroquinone and catechol with extended linear ranges and lower detection limits.

    Science.gov (United States)

    Zhou, Jian; Li, Xi; Yang, Linlin; Yan, Songlin; Wang, Mengmeng; Cheng, Dan; Chen, Qi; Dong, Yulin; Liu, Peng; Cai, Weiquan; Zhang, Chaocan

    2015-10-29

    A novel electrochemical sensor based on Cu-MOF-199 [Cu-MOF-199 = Cu3(BTC)2 (BTC = 1,3,5-benzenetricarboxylicacid)] and SWCNTs (single-walled carbon nanotubes) was fabricated for the simultaneous determination of hydroquinone (HQ) and catechol (CT). The modification procedure was carried out through casting SWCNTs on the bare glassy carbon electrode (GCE) and followed by the electrodeposition of Cu-MOF-199 on the SWCNTs modified electrode. Cyclic voltammetry (CV), electrochemical impedance spectroscopy (EIS) and scanning electron microscopy (SEM) were performed to characterize the electrochemical performance and surface characteristics of the as-prepared sensor. The composite electrode exhibited an excellent electrocatalytic activity with increased electrochemical signals towards the oxidation of HQ and CT, owing to the synergistic effect of SWCNTs and Cu-MOF-199. Under the optimized condition, the linear response range were from 0.1 to 1453 μmol L(-1) (RHQ = 0.9999) for HQ and 0.1-1150 μmol L(-1) (RCT = 0.9990) for CT. The detection limits for HQ and CT were as low as 0.08 and 0.1 μmol L(-1), respectively. Moreover, the modified electrode presented the good reproducibility and the excellent anti-interference performance. The analytical performance of the developed sensor for the simultaneous detection of HQ and CT had been evaluated in practical samples with satisfying results. Copyright © 2015 Elsevier B.V. All rights reserved.

  2. CCL5 promotes vascular endothelial growth factor expression and induces angiogenesis by down-regulating miR-199a in human chondrosarcoma cells.

    Science.gov (United States)

    Liu, Guan-Ting; Huang, Yuan-Li; Tzeng, Huey-En; Tsai, Chun-Hao; Wang, Shih-Wei; Tang, Chih-Hsin

    2015-02-28

    Chondrosarcoma is a primary malignant bone cancer, with a potent capacity to invade locally and cause distant metastasis. Angiogenesis is a critical step in tumor growth and metastasis. Chemokine CCL5 (previously called RANTES) has been shown to facilitate tumor progression and metastasis. However, the relationship of CCL5 with vascular endothelial growth factor (VEGF) expression and angiogenesis in human chondrosarcoma is mostly unknown. In this study, CCL5 increased VEGF expression and also promoted chondrosarcoma medium-mediated angiogenesis in vitro as well as angiogenesis effects in the chick chorioallantoic membrane and Matrigel plug nude mice model in vivo. MicroRNA analysis was performed in CCL5-treated chondrosarcoma cells versus control cells to investigate the mechanism of CCL5-mediated promotion of chondrosarcoma angiogenesis. Among the miRNAs regulated by CCL5, miR-199a was the most downregulated miRNA after CCL5 treatment. In addition, co-transfection with miR-199a mimic reversed the CCL5-mediated VEGF expression and angiogenesis in vitro and in vivo. Moreover, overexpression of CCL5 increased tumor-associated angiogenesis and tumor growth by downregulating miR-199a in the xenograft tumor angiogenesis model. Taken together, these results demonstrated that CCL5 promotes VEGF-dependent angiogenesis in human chondrosarcoma cells by downregulating miR-199a. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  3. MicroRNA-199b targets the nuclear kinase Dyrk1a in an auto-amplification loop promoting calcineurin/NFAT signalling

    NARCIS (Netherlands)

    da Costa Martins, P.A.; Salic, K.; Gladka, M.M.; Armand, A.S.; Leptidis, S.; el Azzouzi, H.; Hansen, A.; Coenen-de Roo, C.J.; Bierhuizen, M.F.A.; van der Nagel, R.; van Kuik, J.; de Weger, R.; de Bruin, A.; Condorelli, G.; Arbones, M.L.; Eschenhagen, T.; de Windt, L.J.

    2010-01-01

    MicroRNAs (miRs) are a class of single-stranded, non-coding RNAs of about 22 nucleotides in length. Increasing evidence implicates miRs in myocardial disease processes. Here we show that miR-199b is a direct calcineurin/NFAT target gene that increases in expression in mouse and human heart failure,

  4. Evaluation of serum D-dimer, fibrinogen, and CA19-9 for postoperative monitoring and survival prediction in resectable pancreatic carcinoma.

    Science.gov (United States)

    Cao, Junli; Fu, Zhanzhao; Gao, Liming; Wang, Xin; Cheng, Shaohui; Wang, Xiuchao; Ren, He

    2017-02-20

    We sought to investigate the efficacy of serum D-dimer, fibrinogen, and CA19-9 for postoperative monitoring and prediction of survival in patients with resectable pancreatic carcinoma (PC). One hundred and nineteen patients with resectable PC were enrolled. Serum D-dimer, fibrinogen, and CA19-9 values were analyzed before surgery and at the stages of relapse-free and progression disease. D-dimer, fibrinogen, and CA19-9 were significantly higher at the active stage of PC than those at the relapse-free stage [1059.2 (1690.1) ng/ml vs 485.18 (289.84) ng/ml, (3.71 ± 0.83) g/l vs (2.75 ± 0.52) g/l, 207.2 (681.8) U/ml vs 24.5 (30) U/ml, respectively, p monitoring of patients with resectable PC, D-dimer, fibrinogen, and CA19-9 may be used as markers for monitoring disease relapse, but only preoperative D-dimer could predict survival.

  5. MLL-Rearranged Acute Lymphoblastic Leukemias Activate BCL-2 through H3K79 Methylation and Are Sensitive to the BCL-2-Specific Antagonist ABT-199

    Directory of Open Access Journals (Sweden)

    Juliana M. Benito

    2015-12-01

    Full Text Available Targeted therapies designed to exploit specific molecular pathways in aggressive cancers are an exciting area of current research. Mixed Lineage Leukemia (MLL mutations such as the t(4;11 translocation cause aggressive leukemias that are refractory to conventional treatment. The t(4;11 translocation produces an MLL/AF4 fusion protein that activates key target genes through both epigenetic and transcriptional elongation mechanisms. In this study, we show that t(4;11 patient cells express high levels of BCL-2 and are highly sensitive to treatment with the BCL-2-specific BH3 mimetic ABT-199. We demonstrate that MLL/AF4 specifically upregulates the BCL-2 gene but not other BCL-2 family members via DOT1L-mediated H3K79me2/3. We use this information to show that a t(4;11 cell line is sensitive to a combination of ABT-199 and DOT1L inhibitors. In addition, ABT-199 synergizes with standard induction-type therapy in a xenotransplant model, advocating for the introduction of ABT-199 into therapeutic regimens for MLL-rearranged leukemias.

  6. Prognostic Significance of Carbohydrate Antigen 19-9 in Unresectable Locally Advanced Pancreatic Cancer Treated With Dose-Escalated Intensity Modulated Radiation Therapy and Concurrent Full-Dose Gemcitabine: Analysis of a Prospective Phase 1/2 Dose Escalation Study

    Energy Technology Data Exchange (ETDEWEB)

    Vainshtein, Jeffrey M., E-mail: jvainsh@med.umich.edu [Department of Radiation Oncology, University of Michigan, Ann Arbor, Michigan (United States); Schipper, Matthew [Department of Radiation Oncology, University of Michigan, Ann Arbor, Michigan (United States); Zalupski, Mark M. [Division of Hematology Oncology, Department of Internal Medicine, University of Michigan, Ann Arbor, Michigan (United States); Lawrence, Theodore S. [Department of Radiation Oncology, University of Michigan, Ann Arbor, Michigan (United States); Abrams, Ross [Department of Radiation Oncology, Rush Medical Center, Chicago, Illinois (United States); Francis, Isaac R. [Department of Radiology, University of Michigan, Ann Arbor, Michigan (United States); Khan, Gazala [Division of Hematology Oncology, Department of Internal Medicine, University of Michigan, Ann Arbor, Michigan (United States); Leslie, William [Division of Hematology Oncology, Department of Internal Medicine, Rush Medical Center, Chicago, Illinois (United States); Ben-Josef, Edgar [Department of Radiation Oncology, University of Pennsylvania, Philadelphia, Pennsylvania (United States)

    2013-05-01

    Purpose: Although established in the postresection setting, the prognostic value of carbohydrate antigen 19-9 (CA19-9) in unresectable locally advanced pancreatic cancer (LAPC) is less clear. We examined the prognostic utility of CA19-9 in patients with unresectable LAPC treated on a prospective trial of intensity modulated radiation therapy (IMRT) dose escalation with concurrent gemcitabine. Methods and Materials: Forty-six patients with unresectable LAPC were treated at the University of Michigan on a phase 1/2 trial of IMRT dose escalation with concurrent gemcitabine. CA19-9 was obtained at baseline and during routine follow-up. Cox models were used to assess the effect of baseline factors on freedom from local progression (FFLP), distant progression (FFDP), progression-free survival (PFS), and overall survival (OS). Stepwise forward regression was used to build multivariate predictive models for each endpoint. Results: Thirty-eight patients were eligible for the present analysis. On univariate analysis, baseline CA19-9 and age predicted OS, CA19-9 at baseline and 3 months predicted PFS, gross tumor volume (GTV) and black race predicted FFLP, and CA19-9 at 3 months predicted FFDP. On stepwise multivariate regression modeling, baseline CA19-9, age, and female sex predicted OS; baseline CA19-9 and female sex predicted both PFS and FFDP; and GTV predicted FFLP. Patients with baseline CA19-9 ≤90 U/mL had improved OS (median 23.0 vs 11.1 months, HR 2.88, P<.01) and PFS (14.4 vs 7.0 months, HR 3.61, P=.001). CA19-9 progression over 90 U/mL was prognostic for both OS (HR 3.65, P=.001) and PFS (HR 3.04, P=.001), and it was a stronger predictor of death than either local progression (HR 1.46, P=.42) or distant progression (HR 3.31, P=.004). Conclusions: In patients with unresectable LAPC undergoing definitive chemoradiation therapy, baseline CA19-9 was independently prognostic even after established prognostic factors were controlled for, whereas CA19-9 progression

  7. Clinical significance and revisiting the meaning of CA 19-9 blood level before and after the treatment of pancreatic ductal adenocarcinoma: analysis of 1,446 patients from the pancreatic cancer cohort in a single institution.

    Directory of Open Access Journals (Sweden)

    Joo Kyung Park

    Full Text Available BACKGROUND: Life expectancy of pancreatic ductal adenocarcinoma (PDAC patients is usually short and selection of the most appropriate treatment is crucial. The aim of this study was to investigate the usefulness of serum CA 19-9 as a surrogate marker under no impress excluding other factors affecting CA 19-9 level other than tumor itself. METHODS: We recruited 1,446 patients with PDACs and patients with Lewis antigen both negative or obstructive jaundice were excluded to eliminate the false effects on CA 19-9 level. The clinicopathologic factors were reviewed including initial and post-treatment CA 19-9, and statistical analysis was done to evaluate the association of clinicopathologic factors with overall survival (OS. RESULTS: The total of 944 patients was enrolled, and205 patients (22% underwent operation with curative intention and 541 patients (57% received chemotherapy and/or radiotherapy. The median CA 19-9 levels of initial and post-treatment were 670 IU/ml and 147 IU/ml respectively. The prognostic factors affecting OS were performance status, AJCC stage and post-treatment CA 19-9 level in multivariate analysis. Subgroup analysis was done for the patients who underwent R0 and R1 resection, and patients with normalized post-operative CA 19-9 (≤37 IU/mL had significantly longer OS and DFS regardless of initial CA 19-9 level; 32 vs. 18 months, P<0.001, 16 vs. 9 months, P = 0.004 respectively. CONCLUSIONS: Post-treatment CA 19-9 and normalized post-operative CA 19-9 (R0 and R1 resected tumors were independent factors associated with OS and DFS, however, initial CA 19-9 level was not statistically significant in multivariate analysis.

  8. Assessment of biosand filter performance in rural communities in southern coastal Nicaragua: an evaluation of 199 households.

    Science.gov (United States)

    Fiore, M M; Minnings, K; Fiore, L D

    2010-01-01

    Lack of access to safe drinking water is a major health issue for more than one billion people globally. In areas where community-wide water treatment is not possible, point-of-use (POU) solutions are necessary. The biosand filter (BSF) is one of several such POU technologies available to treat water in the home to reduce the risk of infection. This study was conducted to evaluate the use and performance of BSFs in the rural communities surrounding San Juan del Sur, Nicaragua. Approximately 600 filters had been installed in this area over the preceding 2 years by local workers supported by US and Canadian NGOs. This field study was conducted In July and August 2009. Unannounced household visits were carried out by US volunteers supported by a local interpreter and driver. Visits were made to a convenience sample of 199 households where BSFs had been in place for an average of 12 months. Water for analysis was collected from wells, filter spouts and storage buckets and an 11 item questionnaire was administered. Laboratory analyses were performed on water samples using the membrane filtration method to determine Escherichia coli colony forming units (CFUs). Forty-five of 199 households visited had discontinued use of their BSF. In the 154 households tested, median CFU of E. coli per 100 mL of water from the source, filter spout and storage vessel were 313, 72, and 144, respectively. Median bacterial removal efficiency for the filters was 80%. Although biosand filtration reduced CFUs in 74% of households in which it was used, in only 26 cases (17%) did it reduce CFUs to filter's performance, citing improved health and better tasting water. Water quality testing of BSFs deployed in the field showed results somewhat inferior to previous reports. Possible explanations include lack of use of best practices and the inclusion of some filers in the analysis that may not have been in active use. Despite these results and high rates of recontamination in the storage bucket

  9. Metabolic tumour burden assessed by {sup 18}F-FDG PET/CT associated with serum CA19-9 predicts pancreatic cancer outcome after resection

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Hua-Xiang; Chen, Tao; Wang, Wen-Quan; Wu, Chun-Tao; Liu, Chen; Long, Jiang; Xu, Jin; Liu, Liang; Yu, Xian-Jun [Fudan University, Shanghai Cancer Center, Pancreatic Cancer Institute and Department of Pancreatic and Hepatobiliary Surgery, Shanghai (China); Fudan University, Department of Oncology, Shanghai Medical College, Shanghai (China); Zhang, Ying-Jian [Fudan University, Shanghai Cancer Center, Department of Nuclear Medicine, Shanghai (China); Fudan University, Department of Oncology, Shanghai Medical College, Shanghai (China); Chen, Run-Hao [Fudan University, Department of General Surgery, Jinshan Hospital, Shanghai (China)

    2014-06-15

    Tumour burden is one of the most important prognosticators for pancreatic ductal adenocarcinoma (PDAC). The aim of this study was to investigate the predictive significance of metabolic tumour burden measured by {sup 18}F-FDG PET/CT in patients with resectable PDAC. Included in the study were 122 PDAC patients who received preoperative {sup 18}F-FDG PET/CT examination and radical pancreatectomy. Metabolic tumour burden in terms of metabolic tumour volume (MTV) and total lesion glycolysis (TLG), pathological tumour burden (tumour size), serum tumour burden (baseline serum CA19-9 level), and metabolic activity (maximum standard uptake value, SUVmax) were determined, and compared for their performance in predicting overall survival (OS) and recurrence-free survival (RFS). MTV and TLG were significantly associated with baseline serum CA19-9 level (P = 0.001 for MTV, P < 0.001 for TLG) and tumour size (P < 0.001 for MTV, P = 0.001 for TLG). Multivariate analysis showed that MTV, TLG and baseline serum CA19-9 level as either categorical or continuous variables, but not tumour size or SUVmax, were independent risk predictors for both OS and RFS. Time-dependent receiving operating characteristics analysis further indicated that better predictive performances for OS and RFS were achieved by MTV and TLG compared to baseline serum CA19-9 level, SUVmax and tumour size (P < 0.001 for all). MTV and TLG showed strong consistency with baseline serum CA19-9 level in better predicting OS and RFS, and might serve as surrogate markers for prediction of outcome in patients with resectable PDAC. (orig.)

  10. Carnitine-acylcarnitine translocase deficiency with c.199-10 T>G and novel c.1A>G mutation: Two case reports and brief literature review.

    Science.gov (United States)

    Yan, Hui-Ming; Hu, Hao; Ahmed, Aisha; Feng, Bing-Bing; Liu, Jing; Jia, Zheng-Jun; Wang, Hua

    2017-11-01

    Carnitine-acylcarnitine translocate deficiency (CACTD) is a rare and life-threatening, autosomal recessive disorder of fatty acid β-oxidation characterized by hypoketotic hypoglycemia, hyperammonemia, cardiomyopathy, liver dysfunction, and muscle weakness; culminating in early death. To date, CACTD cases screened from the Chinese mainland population, especially patient with compound heterozygote with c.199-10T>G and a novel c.1A>G mutation in the SLC25A20 gene has never been described. Herein, we report 2 neonatal cases of CACTD identified from the mainland China. These 2 patients were presented with severe metabolic crisis and their clinical conditions deteriorate rapidly and both died of cardiorespiratory collapse in the first week of life. We present the clinical and biochemical features of 2 probands and a brief literature review of previously reported CACTD cases with the c.199-10T>G mutation. The acylcarnitine profiles by tandem-mass-spectrometry and the mutation analysis of SLC25A20 gene confirmed the diagnosis of CACTD in both patients. Mutation analysis demonstrated that patient No. 1 was homozygous for c.199-10T>G mutation, while patient No. 2 was a compound heterozygote for 2 mutations, a maternally-inherited c.199-10T>G and a paternally-inherited, novel c.1A>G mutation. Both patients were treated with an aggressive treatment regimen include high glucose and arginine infusion, respiratory, and circulatory support. The first proband died 3 days after delivery due to sudden cardiac arrest. The second patient's clinical condition, at one time, was improved by high glucose infusion, intravenous arginine, and circulatory support. However, the patient failed to wean from mechanical ventilation. Unfortunately, her parents refused further treatment due to fear of financial burdens. The patient died of congestive heart failure in the 6th day of life. We report the first 2 cases of CACTD identified from the mainland China. Apart from a founder mutation c.199-10T

  11. Metal-organic framework-199/graphite oxide hybrid composites coated solid-phase microextraction fibers coupled with gas chromatography for determination of organochlorine pesticides from complicated samples.

    Science.gov (United States)

    Zhang, Suling; Du, Zhuo; Li, Gongke

    2013-10-15

    The hybrid material of a copper-based metal-organic framework (MOF-199) and graphite oxide (GO) was explored as the solid-phase microextraction (SPME) coating for the first time. This fiber was fabricated by using 3-amino-propyltriethoxysilane (APTES) as the cross-linking agent, which enhanced its durability and allowed more than 140 replicate extractions. With the incorporation of GO, the MOF-199/GO fibers with GO contents ranging from 5 to 15 wt% exhibited enhanced adsorption affinity to organochlorine pesticides (OCPs) compared to MOF or GO individually. This improvement was linked to the enhanced dispersive forces (increased volume of small pores) that provided by the dense carbon layers of GO. Combining the superior properties of high porosity of MOFs and the unique layered character of GO, the MOF-199/GO (10 wt%) fiber exhibited higher adsorption affinity to some OCPs than commercial polydimethylsiloxane (PDMS) and polydimethylsiloxane/divinylbenzene (PDMS/DVB) fibers. This new fiber was developed for headspace (HS) SPME of eight OCPs followed by GC/ECD analysis. The limits of detection were 2.3-6.9 ng/L. The relative standard deviation (RSD) for five replicate extractions using one fiber ranged from 5.3% to 8.8%. The fiber-to-fiber reproducibility was 5.2-12.8%. This method was successfully used for simultaneous determination of eight OCPs from river water, soil, water convolvulus and longan with satisfactory recoveries of 90.6-104.4%, 82.7-96.8%, 72.2-107.7% and 82.8-94.3%, respectively. These results indicated the MOF-199/GO composite provided a promising alternative in sample pretreatment. © 2013 Elsevier B.V. All rights reserved.

  12. Study of the long-lived excited state in the neutron deficient nuclides $^{195,197,199}$Po by precision mass measurement

    OpenAIRE

    Althubiti, N. A.; Atanasov, D; Blaum, K.; Cocolios, T. E.; Goodacre, T Day; Farooq-Smith, G. J.; Fedorov, D.V.; Fedosseev, V. N.; George, S.; Herfurth, F.; Heyde, K; Kreim, S; Lunney, D.; Lynch, K.M.; Manea, V.

    2017-01-01

    Direct mass measurements of the low-spin $3/2^{(-)}$ and high-spin $13/2^{(+)}$ states in the neutron-deficient isotopes $^{195}$Po, $^{197}$Po, and high-spin $13/2^{(+)}$ state in $^{199}$Po were performed with the Penning-trap mass spectrometer ISOLTRAP at ISOLDE-CERN. These measurements allow the determination of the excitation energy of the isomeric state arising from the $\

  13. The effect of high level natural ionizing radiation on expression of PSA, CA19-9 and CEA tumor markers in blood serum of inhabitants of Ramsar, Iran.

    Science.gov (United States)

    Heidari, Mohammad Hassan; Porghasem, Mohsen; Mirzaei, Nazanin; Mohseni, Jafar Hesam; Heidari, Matine; Azargashb, Eznollah; Movafagh, Abolfazl; Heidari, Reihane; Molouki, Aidin; Larijani, Leila

    2014-02-01

    Since several high level natural radiation areas (HLNRAs) exist on our planet, considerable attention has been drawn to health issues that may develop as the result of visiting or living in such places. City of Ramsar in Iran is an HNLRA, and is a tourist attraction mainly due to its hot spas. However, the growing awareness over its natural radiation sources has prompted widespread scientific investigation at national level. In this study, using an ELISA method, the level of expression of three tumor markers known as carcinoembryonic antigen (CEA), prostate-specific antigen (PSA) and carcino antigen 19-9 (CA19-9) in blood serum of 40 local men of Ramsar (subject group) was investigated and compared to 40 men from the city of Noshahr (control group). Noshahr was previously identified as a normal level natural radiation area (NLNRA) that is some 85 km far from Ramsar. According to statistical analysis, there was a significant difference in the levels of PSA and CA19-9 markers between the two groups (p Ramsar being considerably higher. CEA level did not show any difference. Although some of the volunteers tested positive to the markers, they were in good health as confirmed by the physician. Moreover, the high number of positive markers in Noshahr was considerable. Therefore, future study is needed to further validate this result and to determine the level of positivity to tumor markers in both cities. Copyright © 2013 Elsevier Ltd. All rights reserved.

  14. Reforming of the Judicial System of Kosovo based on the Law no. 03/L-199 on Courts and its challenges

    Directory of Open Access Journals (Sweden)

    Dr.Sc. Azem Hajdari

    2014-06-01

    Full Text Available Law no. 03/L-199 on Courts1 represents a law of significant importance which regulates the organisation, functioning and jurisdiction of courts of the Republic of Kosovo. This law has made numerous reforms in the judicial system of the country. It has set the bases of a modern and sustainable judicial system. In fact the Law on Courts in addition to having changed the judiciary of Kosovo in the aspect of organisation, it has opened the paths in the aspect of ensuring an efficient functioning thereof. Moreover, this law has repealed the application of the Law of former SAP of Kosovo on Regular Courts which in some aspects did not correspond to the trends of contemporary developments in this field. Law on Courts in its solutions embeds the bases of an independent and impartial justice, further on being multiethnic, non-discriminatory, efficient and in principle having an advanced approach of the opportunity for the public opinion to follow the judicial activities. Consequently, within this work, the background of the development of judicial system in Kosovo shall be discussed, some aspects of its reforming and challenges currently the judicial system of the country faces. In the course of preparation of this work, legal-historical method has been applied, the dogmatic method too, method of comparison and the method of analysis and synthesis. Through the legal-historical method, the manner of organisation and activity of the judicial system in Kosovo has been reflected covering the time of Turkish rule up to 2013 basing it on the laws and the Albanian customary law. The dogmatic method has helped on reflecting the manner of organisation and activity of the judicial system in Kosovo, viewing it in the context of regulating these matters through the Law on Courts presently applicable.The comparative method has reflected the features of the new judicial system in Kosovo and a comparison has been undertaken to the characteristics of earlier judicial

  15. Tissue CA-19.9 content in colorectal adenomas and its value in the assesment of dysplasia Detección de CA-19.9 citosólico en adenomas colorrectales: Utilidad en el diagnóstico de la displasia

    Directory of Open Access Journals (Sweden)

    I. Salces

    2004-04-01

    Full Text Available Background: occasionally, the risk of malignant transformation may be difficult to establish in adenomatous polyps due to the fact that they contain areas with variable grades of dysplasia. A measurement of tissue tumor markers may be useful to recognize these adenomas. Objectives: the aims of this study were: to establish firstly the relationship between carbohydrate antigen 19.9 (CA-19.9 content in the colorectal mucosa and the characteristics of polyps, and secondly, the diagnostic value of the former's measurement. Patients and methods: tissue CA-19.9 concentration was measured in 155 colorectal samples obtained from 145 patients (21 normal mucosa; 113 adenomatous polyps; 21 adenocarcinoma. Cytosol CA-19.9 content was determined by enzyme-linked immunoadsorbant assay, and the measurement of this protein was achieved by quantitative assay. Tissue samples were also processed for histological examination. Results: we demonstrated that CA-19.9 levels in adenomatous polyps and adenocarcinomas were significantly higher than in the normal mucosa. These levels varied significantly according to polyp size, histological type, and grade of dysplasia. CA-19.9 contents were higher in polyps with a high risk of malignant transformation than in those with a low risk of severe dysplasia. The cut-off value 214 U/mg of protein properly differentiated both types of risk. The area under the receiver operating characteristic (ROC curves showed that cytosol CA-19.9 levels allow classifying polyps according to their histological features. Conclusions: we concluded that the measurement of CA-19.9 content in adenomatous polyps may be useful to classify these tumors and confirm the feasibility to separate adenomas into two groups: low and high risk of malignant change.Introducción: en ocasiones, el riesgo de transformación maligna de los pólipos adenomatosos es difícil de identificar por existir zonas con distintos grados de displasia simultáneamente. La

  16. Physical and underway data collected aboard the KNORR during cruise KN199-03 in the North Atlantic Ocean from 2010-10-01 to 2010-10-10 (NODC Accession 0104299)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104299 includes physical and underway data collected aboard the KNORR during cruise KN199-03 in the North Atlantic Ocean from 2010-10-01 to...

  17. Physical and underway data collected aboard the KNORR during cruise KN199-05 in the North Atlantic Ocean from 2010-11-08 to 2010-11-26 (NODC Accession 0104302)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104302 includes physical and underway data collected aboard the KNORR during cruise KN199-05 in the North Atlantic Ocean from 2010-11-08 to...

  18. Cu@C nanoporous composites containing little copper oxides derived from dimethyl imidazole modified MOF199 as electrocatalysts for hydrogen evolution reaction

    Science.gov (United States)

    Wei, Xuedong; Li, Na; Zhang, Xianming

    2017-12-01

    It remains a huge challenge to develop non precious electrocatalysts with high activity to substitute commercial Pt catalysts for hydrogen evolution reactions (HER). Here, the C-Cu-DI and C-Cu materials with the copper based nanoporous carbon structures were synthesized by carbonizing MOF199 and DI-MOF199. The composite structure and HER electrocatalytic properties of the C-Cu-DI and C-Cu materials are studied. The results show that C-Cu-DI and C-Cu samples exhibit good catalytic activity. And C-Cu-DI sample through the addition of Dimethyl imidazole(DI) in the DI-MOF199 precursor has higher electrocatalytic activity than the C-Cu sample. The superior catalytic activity is attributed to the special composite structure of nanoscale deposition particles on the framework with plenty of nano pores and nano copper and few copper oxidation particles distributed or wrapped into the amorphous porous carbon phase. The nano copper and few copper oxidation particles in the C-Cu and C-Cu-DI catalysts maybe provide the more effective catalytic activity sites. The C-Cu-DI composite with large size spherical hollow deposition particles has higher conductivity, better BET surface area and reasonable micro-meso-macro porous distribution, so the overpotentials at the current density of 1 mA cm-2 and 10 mA cm-2 are respectively 270 mV and 390 mV vs. RHE. Although the HER activity has a big gap with commercial platinum catalyst, this study can provide an important experimental exploration for the design of copper based non noble metal/nano porous carbon composite HER electrocatalyst.

  19. The diagnostic value of serum tumor markers CEA, CA19-9, CA125, CA15-3, and TPS in metastatic breast cancer.

    Science.gov (United States)

    Wang, Weigang; Xu, Xiaoqin; Tian, Baoguo; Wang, Yan; Du, Lili; Sun, Ting; Shi, Yanchun; Zhao, Xianwen; Jing, Jiexian

    2017-07-01

    This study aims to understand the diagnostic value of serum tumor markers carcinoembryonic antigen (CEA), cancer antigen 19-9 (CA19-9), cancer antigen 125 (CA125), cancer antigen 15-3 (CA15-3), and tissue polypeptide-specific antigen (TPS) in metastatic breast cancer (MBC). A total of 164 metastatic breast cancer patients in Shanxi Cancer Hospital were recruited between February 2016 and July 2016. 200 breast cancer patients without metastasis in the same period were randomly selected as the control group. The general characteristics, immunohistochemical, and pathological results were investigated between the two groups, and tumor markers were determined. There were statistical differences in the concentration and the positive rates of CEA, CA19-9, CA125, CA15-3, and TPS between the MBC and control group (Pspecificity was in CA125 for the diagnosis of MBC when using a single tumor marker at 56.7% and 97.0%, respectively. In addition, two tumor markers were used for the diagnosis of MBC and the CEA and TPS combination had the highest diagnostic sensitivity with 78.7%, while the CA15-3 and CA125 combination had the highest specificity of 91.5%. Analysis of tumor markers of 164 MBC found that there were statistical differences in the positive rates of CEA and CA15-3 between bone metastases and other metastases (χ 2 =6.00, P=0.014; χ 2 =7.32, P=0.007, respectively). The sensitivity and specificity values of the CEA and CA15-3 combination in the diagnosis of bone metastases were 77.1% and 45.8%, respectively. The positive rate of TPS in the lung metastases group was lower than in other metastases (χ 2 =8.06, P=0.005).There were significant differences in the positive rates of CA15-3 and TPS between liver metastases and other metastases (χ 2 =15.42, Pspecificity of the CA15-3 and TPS combination in the diagnosis of liver metastases were 92.3% and 45.6%, respectively, and the positive rate of CEA in triple-negative metastatic breast cancer is lower than in other

  20. Catalytic residues Lys197 and Arg199 of Bacillus subtilis phosphoribosyl diphosphate synthase. Alanine-scanning mutagenesis of the flexible catalytic loop

    DEFF Research Database (Denmark)

    Hove-Jensen, Bjarne; Bentsen, Ann-Kristin K; Harlow, Kenneth W

    2005-01-01

    Eleven of the codons specifying the amino acids of the flexible catalytic loop [KRRPRPNVAEVM(197-208)] of Bacillus subtilis phosphoribosyl diphosphate synthase have been changed individually to specify alanine. The resulting variant enzyme forms, as well as the wildtype enzyme, were produced...... in an Escherichia coli strain lacking endogenous phosphoribosyl diphosphate synthase activity and purified to near homogeneity. The B. subtilis phosphoribosyl diphosphate synthase mutant variants K197A and R199A were studied in detail. The physical properties of the two enzymes were similar to those of the wildtype...

  1. Evidence for {open_quotes}magnetic rotation{close_quotes} in nuclei: New results on the M1-bands of {sup 198,199}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Clark, R.M. [Lawrence Berkeley National Lab., CA (United States)

    1996-12-31

    Lifetimes of states in four of the M1-bands in {sup 198,199}Pb have been determined through a Doppler Shift Attenuation Method measurement performed using the Gammasphere array. The deduced B(M1) values, which are a sensitive probe of the underlying mechanism for generating these sequences, show remarkable agreement with Tilted Axis Cranking (TAC) calculations. Evidence is also presented for the possible termination of the bands. The results represent clear evidence for a new concept in nuclear excitations: {open_quote}magnetic rotation{close_quote}.

  2. Further evidence of the prognostic role of pretreatment levels of CA 19-9 in advanced pancreatic cancer Evidência adicional do papel prognóstico do nível pré-tratamento de CA 19-9 em câncer de pâncreas avançado

    Directory of Open Access Journals (Sweden)

    Everardo D. Saad

    2010-01-01

    Full Text Available OBJECTIVE: We and others have previously suggested that pretreatment levels of CA 19-9 correlate with overall survival (OS among patients with advanced pancreatic cancer treated with gemcitabine. We sought to confirm the prognostic role of the pretreatment level of CA 19-9 in patients with advanced pancreatic cancer treated with chemotherapy. METHODS: We retrospectively identified 50 patients with locally advanced or metastatic pancreatic cancer treated in the first-line with single-agent gemcitabine or combinations. Patients could also have received second-line treatment. Kaplan-Meier estimates of OS were compared with the log-rank test, and multivariate analysis was done using the Cox model. RESULTS: Twenty-seven patients were female with a mean age of 64.3 years, and 82% were metastatic upon diagnosis. The median OS for the entire sample was 11 months, and the median CA 19-9 level was 542 U/mL. Significant predictors of OS in univariate analyses were the first-line use of combined chemotherapy (p=0.006 and use of erlotinib in any line (p=0.002, with borderline significance for pretreatment levels of CA 19-9 (p=0.052. In multivariate analysis, only use of erlotinib (p=0.003 and pretreatment CA 19-9 level (p=0.026 were significantly associated with OS. CONCLUSION: Our study lends further support to use of the pre-chemotherapy level of CA 19-9 as a prognostic indicator in clinical practice and as a stratification factor in clinical trials. The association between erlotinib use and OS may have been biased by patient selection, notwithstanding the positive results from a previous randomized trial.OBJETIVO: Estudos anteriores pelo nosso grupo e por outros autores sugerem que o nível pré-tratamento do marcador tumoral CA 19-9 se correlaciona com a sobrevida global (SG em pacientes com câncer de pâncreas avançado tratados com gencitabina. Nosso objetivo foi o de confirmar o papel prognóstico do nível pré-tratamento do CA 19-9 em pacientes com

  3. INFRACŢIUNI CONTRA PATRIMONIULUI, SĂVÂRŞITE ÎN LIPSA UNUI SCOP SPECIAL (art.193, 197 şi 199 CP RM: ASPECTE TEORETICE ŞI PRACTICE

    Directory of Open Access Journals (Sweden)

    Sergiu BRÎNZA

    2016-03-01

    Full Text Available Prezentul articol este dedicat analizei juridico-penale a infracţiunilor contra patrimoniului, săvârşite în lipsa unui scop special. Acestea sunt prevăzute la art.193, 197 şi 199 CP RM. Sunt examinate elementele constitutive (obiectul, latura obiectivă, latura subiectivă şi subiectul, precum şi elementele circumstanţiale agravante ale infracţiunilor în cauză. Sunt propuse criterii de delimitare a infracţiunilor specificate la art.193, 197 şi 199 CP RM de faptele conexe de factură penală sau nepenală. Regulile de calificare a faptelor conform acestor articole, precum şi procedeele de interpretare a art.193, 197 şi 199 CP RM, urmăresc scopul eficientizării aplicării răspunderii pentru faptele infracţionale corespunzătoare. OFFENCES AGAINST PATRIMONY, COMMITED IN THE ABSENCE OF A SPECIAL PURPOSE (art.193, 197 and 199 PC RM: THEORETICAL AND PRACTICAL ASPECTSThis article is dedicated to the legal-penal analysis of the offences against patrimony, committed in the absence of a special purpose. The offences mentioned above are included in art.193, 197 and 199 PC RM; there are examined the constituents (the object, objective side, subjective side and the subject, as well as the circumstantial aggravating elements of the offences in question. There are also proposed delimitation criteria of the offences specified at art.193, 197 and 199 PC RM from the ancillary penal or non-penal acts. The rules of qualification of the acts under these articles, including the methods of interpretation of art.193, 197 and 199 PC RM, aim to streamline the application of penal liability for the appropriate criminal acts. 

  4. Residues R{sup 199}H{sup 200} of prototype foamy virus transactivator Bel1 contribute to its binding with LTR and IP promoters but not its nuclear localization

    Energy Technology Data Exchange (ETDEWEB)

    Ma, Qinglin; Tan, Juan [Key Laboratory of Molecular Microbiology and Biotechnology (Ministry of Education) and Key Laboratory of Microbial Functional Genomics (Tianjin), College of Life Sciences, Nankai University, Tianjin 300071 (China); Cui, Xiaoxu [Key Laboratory of Molecular Microbiology and Biotechnology (Ministry of Education) and Key Laboratory of Microbial Functional Genomics (Tianjin), College of Life Sciences, Nankai University, Tianjin 300071 (China); Centre Laboratory, TianJin 4th Centre Hospital, Tianjin 300140 (China); Luo, Di; Yu, Miao [Key Laboratory of Molecular Microbiology and Biotechnology (Ministry of Education) and Key Laboratory of Microbial Functional Genomics (Tianjin), College of Life Sciences, Nankai University, Tianjin 300071 (China); Liang, Chen [Lady Davis Institute, Jewish General Hospital, Montreal, QC, Canada H3T 1E2 (Canada); Departments of Medicine McGill University, Montreal, QC (Canada); Microbiology and Immunology, McGill University, Montreal, QC (Canada); Qiao, Wentao, E-mail: wentaoqiao@nankai.edu.cn [Key Laboratory of Molecular Microbiology and Biotechnology (Ministry of Education) and Key Laboratory of Microbial Functional Genomics (Tianjin), College of Life Sciences, Nankai University, Tianjin 300071 (China)

    2014-01-20

    Prototype foamy virus encodes a transactivator called Bel1 that enhances viral gene transcription and is essential for PFV replication. Nuclear localization of Bel1 has been reported to rely on two proximal basic motifs R{sup 199}H{sup 200} and R{sup 221}R{sup 222}R{sup 223} that likely function together as a bipartite nuclear localization signal. In this study, we report that mutating R{sup 221}R{sup 222}R{sup 223}, but not R{sup 199}H{sup 200}, relocates Bel1 from the nucleus to the cytoplasm, suggesting an essential role for R{sup 221}R{sup 222}R{sup 223} in the nuclear localization of Bel1. Although not affecting the nuclear localization of Bel1, mutating R{sup 199}H{sup 200} disables Bel1 from transactivating PFV promoters. Results of EMSA reveal that the R{sup 199}H{sup 200} residues are vital for the binding of Bel1 to viral promoter DNA. Moreover, mutating R{sup 199}H{sup 200} in Bel1 impairs PFV replication to a much greater extent than mutating R{sup 221}R{sup 222}R{sup 223}. Collectively, our findings suggest that R{sup 199}H{sup 200} directly participate in Bel1 binding to viral promoter DNA and are indispensible for Bel1 transactivation activity. - Highlights: • The R{sup 221}R{sup 222}R{sup 223} residues are essential for the nuclear localization of Bel1. • Although not affecting the nuclear localization of Bel1, mutating R{sup 199}H{sup 200} disables Bel1 from transactivating PFV promoters. • The R{sup 199}H{sup 200} residues directly participate in Bel1 binding to viral promoter DNA. • Mutating R{sup 199}H{sup 200} in Bel1 impairs PFV replication to a much greater extent than mutating R{sup 221}R{sup 222}R{sup 223}.

  5. Simple and effective label-free electrochemical immunoassay for carbohydrate antigen 19-9 based on polythionine-Au composites as enhanced sensing signals for detecting different clinical samples.

    Science.gov (United States)

    Huang, Zhengjun; Jiang, Zhouqian; Zhao, Chengfei; Han, Wendi; Lin, Liqing; Liu, Ailin; Weng, Shaohuang; Lin, Xinhua

    2017-01-01

    Carbohydrate antigen 19-9 (CA19-9) is an important biomarker for the early diagnosis and clinical monitoring of pancreatic cancer. Reliable, simple, and accurate methods for the detection of CA19-9 are still urgently needed. In this study, polythionine-Au composites (AuNPs@ PThi) were designed and prepared through one-pot reaction using HAuCl4 as the co-oxidant and raw material in thionine solution containing FeCl3 as the oxidant. AuNPs@PThi-immobilized glassy carbon electrode was used as a sensitive redox probe for electrochemical interface. AuNPs@PThi not only favored the amplification of electrochemical signals but also facilitated excellent environmental friendliness for bioassay. Maximizing the electrochemical properties of AuNPs@PThi, an effective label-free electrochemical immunoassay for the ultrasensitive and reliable detection of CA19-9 was developed. Under optimal conditions, the linear range of the proposed immunosensor was estimated to range from 6.5 to 520 U/mL, with a detection limit of 0.26 U/mL at a signal-to-noise ratio of 3. The prepared immunosensor for CA19-9 detection showed high sensitivity, stability, and reproducibility. Furthermore, the fabricated immunosensor based on AuNPs@PThi can effectively detect and distinguish clinical serum samples of pancreatic cancer and normal control with accuracy and convenience.

  6. Environment Canada's new on-line reporting system for environmental emergency plans under CEPA, Sections 199 and 200

    Energy Technology Data Exchange (ETDEWEB)

    Rudin-Brown, P. [Environment Canada, Hull, PQ (Canada)

    2003-07-01

    One of the objectives of Canada's Environmental Emergencies program is to reduce the frequency, severity and consequences of spill events by promoting preventative measures and emergency preparedness. The program also offers advice on response methods and advancing science and technology. This paper from a poster session announces that the E2 program is expected to be administered online by late 2003. The compiled database is expected to serve as a useful statistical reference for the public, decision makers, and first responders. Users will be able to access information regarding controlled substances. In particular, sections 199 and 200 of the Environmental Emergency regulations in the Canadian Environmental Protection Act (CEPA) require that any person in Canada who manages a listed substance in large quantities provide Environment Canada with information on the quantity of the substance, the facility location, and prepare a contingency plan.

  7. Study of the decay K+→π+νν¯ in the momentum region 140199MeV/c

    Science.gov (United States)

    Artamonov, A. V.; Bassalleck, B.; Bhuyan, B.; Blackmore, E. W.; Bryman, D. A.; Chen, S.; Chiang, I.-H.; Christidi, I.-A.; Cooper, P. S.; Diwan, M. V.; Frank, J. S.; Fujiwara, T.; Hu, J.; Ives, J.; Jaffe, D. E.; Kabe, S.; Kettell, S. H.; Khabibullin, M. M.; Khotjantsev, A. N.; Kitching, P.; Kobayashi, M.; Komatsubara, T. K.; Konaka, A.; Kozhevnikov, A. P.; Kudenko, Yu. G.; Kushnirenko, A.; Landsberg, L. G.; Lewis, B.; Li, K. K.; Littenberg, L. S.; MacDonald, J. A.; Mildenberger, J.; Mineev, O. V.; Miyajima, M.; Mizouchi, K.; Mukhin, V. A.; Muramatsu, N.; Nakano, T.; Nomachi, M.; Nomura, T.; Numao, T.; Obraztsov, V. F.; Omata, K.; Patalakha, D. I.; Petrenko, S. V.; Poutissou, R.; Ramberg, E. J.; Redlinger, G.; Sato, T.; Sekiguchi, T.; Shinkawa, T.; Strand, R. C.; Sugimoto, S.; Tamagawa, Y.; Tschirhart, R.; Tsunemi, T.; Vavilov, D. V.; Viren, B.; Wang, Zhe; Yershov, N. V.; Yoshimura, Y.; Yoshioka, T.

    2009-05-01

    Experiment E949 at Brookhaven National Laboratory has observed three new events consistent with the decay K+→π+νν¯ in the pion momentum region 140199MeV/c in an exposure of 1.71×1012 stopped kaons with an estimated total background of 0.93±0.17(stat)-0.24+0.32(syst) events. This brings the total number of observed K+→π+νν¯ events to seven. Combining this observation with previous results, assuming the pion spectrum predicted by the standard model, results in a branching ratio of B(K+→π+νν¯)=(1.73-1.05+1.15)×10-10. An interpretation of the results for alternative models of the decay K+→π++nothing is also presented.

  8. Study of the k+ to pi+, neutrino, anti-neutrino decay in the momentum region p(pi+) < 199 MeV/C

    Energy Technology Data Exchange (ETDEWEB)

    Artamonov, A.V.; Bassalleck, B.; Bhuyan, B.; Blackmore, E.W.; Bryman, D.A.; Chen, S.; Chiang, I.-H.; Christidi, I.-A.; Cooper, P.S.; Diwan, M.V.; Frank, J.S.; /Serpukhov, IHEP /New Mexico U. /Brookhaven /TRIUMF /British Columbia U. /Tsinghua U., Beijing /SUNY, Stony Brook /Fermilab /Kyoto U. /KEK, Tsukuba /Moscow, INR

    2009-01-01

    Experiment E949 at Brookhaven National Laboratory has observed three candidate events for the decay K{sup +} {yields} {pi}{sup +}{nu}{bar {nu}} in the pion momentum region 140 < P{sub {pi}} < 199 MeV/c in a exposure of 1.71 x 10{sup 12} stopped kaons with an estimated total background of 0.93 {+-} 0.17(stat.){sub -0.24}{sup +0.32}(syst.) events. Combination of this observation with previous results, assuming a pion spectrum as predicted by the standard model, produces a branching fraction of {beta} = (1.73{sub -1.05}{sup +1.15}) x 10{sup -10}. We also give the interpretation of the combined results for alternative model of the decay K{sup +} {yields} {pi}{sup +} + nothing.

  9. Rendimiento diagnóstico del marcador tumoral CA 19-9 en la diferenciación entre patología bilio-pancreática benigna y maligna

    OpenAIRE

    Jans B,Jaime; Talma R,María J; Almonacid R,Mario; Cruz M,Javier; CÁCERES P,MAURICIO; Rosenfeld M,Carla; Jara O,Gladys

    2013-01-01

    Introducción: El CA 19-9 se ha identificado como un derivado siálico del grupo sanguíneo Lewis A y se expresa en el 95% de la población. Numerosos estudios han documentado una sobreproducción de CA 19-9 en tumores malignos del árbol biliar y páncreas. El objetivo de este estudio es determinar la utilidad del marcador tumoral CA 19-9 en la diferenciación de patología bilio-pancreática benigna y maligna. Material y Métodos: Estudio de pruebas diagnósticas. Se revisaron los antecedentes de todos...

  10. Novel redox species polyaniline derivative-Au/Pt as sensing platform for label-free electrochemical immunoassay of carbohydrate antigen 199

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Liyuan; Shan, Jiao; Feng, Feng; Ma, Zhanfang, E-mail: mazhanfang@cnu.edu.cn

    2016-03-10

    A novel electrochemical redox-active nanocomposite was synthesized by a one-pot method using N,N′-diphenyl-p-phenylediamine as monomer, and HAuCl{sub 4} and K{sub 2}PtCl{sub 4} as co-oxidizing agents. The as-prepared poly(N,N′-diphenyl-p-phenylediamine)-Au/Pt exhibited admirable electrochemical redox activity at 0.15 V, excellent H{sub 2}O{sub 2} electrocatalytic ability and favorable electron transfer ability. Based on these, the evaluation of the composite as sensing substrate for label-free electrochemical immunosensing to the sensitive detection of carbohydrate antigen 199 was described. This technique proved to be a prospective detection tool with a wide liner range from 0.001 U mL{sup −1} to 40 U mL{sup −1}, and a low detection limit of 2.3 × 10{sup −4} U mL{sup −1} (S/N = 3). In addition, this method was used for the analysis of human serum sample, and good agreement was obtained between the values and those of enzyme-linked immunosorbent assay, implying the potential application in clinical research. Importantly, the strategy of the present substrate could be extended to other polymer-based nanocomposites such as polypyrrole derivatives or polythiophene derivatives, and this could be of great significance for the electrochemical immunoassay. - Highlights: • A novel electrochemical redox composite PPPD-Au/Pt was synthesized by one-pot method. • PPPD-Au/Pt was used as sensing substrate for label-free electrochemical immunosensor. • The immunosensor showed wide detection range and ultralow detection limit for the detection of CA199.

  11. miR-199a-3p is involved in estrogen-mediated autophagy through the IGF-1/mTOR pathway in osteocyte-like MLO-Y4 cells.

    Science.gov (United States)

    Fu, Jiayao; Hao, Lingyu; Tian, Yawen; Liu, Yang; Gu, Yijing; Wu, Junhua

    2018-03-01

    To date, evidence indicates that estrogen partially modulates cellular processes through microRNAs. Autophagy is a catabolic process that is regulated by multiple factors and is associated with skeletal diseases. However, whether estrogen regulates osteocyte autophagy via microRNAs is largely unknown. In this study, we observed the up-regulation of microRNA-199a-3p, a post-transcriptional regulatory factor, in osteocytic areas in ovariectomized (OVX) mice. The mature forms of miR-199a-3p and pri-miR-199a were produced in response to estrogen signaling in osteocyte-like MLO-Y4 cells. Western blotting, autophagic flux detection, mRFP-GFP-LC3 fluorescence, and electron microscopy confirmed that miR-199a-3p induced autophagy in MLO-Y4 cells, although cellular apoptosis was not affected. Additionally, we documented the ability of estrogen to mediate osteocyte autophagy. Based on our in vivo data, estrogen deficiency induced autophagy in osteocytes. Treatment of starved MLO-Y4 cells with 17β-estradiol suppressed the excess autophagy induced by starvation via activation of mammalian target of rapamycin (mTOR)-related signaling cascades, while administration of rapamycin reversed the effects of 17β-estradiol. Meanwhile, miR-199a-3p overexpression reversed 17β-estradiol-mediated regulation of autophagy in MLO-Y4 cells. According to mechanistic studies, miR-199a-3p inhibited the mTOR pathway by directly binding to the 3'-untranslated regions of insulin growth factor-1 (IGF-1) and mTOR. However, overexpression of miR-199a-3p inhibited IGF-1 phosphorylation and mTOR-related pathways. Knockdown of mTOR and IGF-1 abolished estrogen signaling and restored LC3-II expression through mTOR re-activation, respectively. Thus, miR-199a-3p appears to be involved in the estrogen regulatory networks that mediate bone cell autophagy, potentially by targeting IGF-1 and mTOR. © 2017 Wiley Periodicals, Inc.

  12. EVALUATION OF THE GROWTH FACTOR IGF-I IN THE IN VITRO MATURATION OF CANINE OOCYTES IN THE TCM 199 MEDIUM Evaluación del factor de crecimiento IGF-I en la maduración in vitro de ovocitos de perras en el medio TCM 199 AVALIAÇÃO DO FATOR DE CRESCIMENTO IGF-I NA MATURAÇÃO IN VITRO DE OÓCITOS CANINOS NO MEIO TCM 199

    Directory of Open Access Journals (Sweden)

    Maricy Apparício Ferreira

    2009-07-01

    Full Text Available The aim was to evaluate the supplementation of recombinant IGF-I growth factor at concentration of 100?g/mL in 500µL of TCM 199 medium in the in vitro maturation of canine oocytes. The oocytes were stained with isotiocianate of fluorescein (Lens cullinaris and Hoeschst 33342 for nuclear and cytoplasmatic assessment using an epifluorescence microscope (filter FITC: excitement 490nm and emission 520nm. There were no statistical differences between control and supplemented groups regarding cytoplasmatic and nuclear maturation when using Kruskal-Wallis test, p<0,05.

    Key words: Canine, IGF-I, maturation, oocyte.
    El estudio presente tuvo como objetivo principal evaluar la adición del factor de crecimiento IGF-I recombinante en la concentración de 100hg/mL en 500mL del medio TCM 199 en la maduración in vitro de ovocitos de perras. Se evaluó con eso el grado de maduración citoplasmático y nuclear por medio de tinción con isotiocianato de fluoresceína (Lens cullinaris y Hoeschst 33342 respectivamente bajo microscopía epifluorescente filtro FITC: 490nn y emisión 520nm. No hubo diferencias estadísticas entre los grupos control y tratamiento en la maduración in vitro, citoplasmática y nuclear de ovocitos de perras por el test de Kruskal – Wallis, p< 0,05. Palabras-clave: maduración, ovocito, perras, IGF-I pt Objetivou-se avaliar a adição do fator de crescimento recombinante IGF–I na concentração de 100?g/mL em 500µL de meio TCM 199 na maturação in vitro de oócitos caninos. Avaliou-se, com isso, o grau de maturação citoplasmática e nuclear por meio de coloração com isotiocianato de fluoresceína (Lens cullinaris e Hoeschst 33342, respectivamente, em microscópio epifluorescente filtro FITC: excitação 490nm e emissão 520nm. Como resultado, verificou-se que não houve diferenças estatísticas entre os grupos controle e tratamento na maturação in vitro, citoplasmática e nuclear, de oócitos caninos pelo

  13. Physical and underway data collected aboard the KNORR during cruise KN199-02 in the Davis Strait from 2010-09-07 to 2010-09-29 (NODC Accession 0104295)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104295 includes physical and underway data collected aboard the KNORR during cruise KN199-02 in the Davis Strait from 2010-09-07 to 2010-09-29. These...

  14. Upregulation of miR-199a/b contributes to cisplatin resistance via Wnt/β-catenin-ABCG2 signaling pathway in ALDHA1(+) colorectal cancer stem cells.

    Science.gov (United States)

    Chen, Binghe; Zhang, Dezhong; Kuai, Jun; Cheng, Mingkun; Fang, Xiangjie; Li, Guangyan

    2017-06-01

    Cisplatin resistance in colorectal cancer largely results from the colorectal cancer stem cells which could be targeted to improve the efficacy of chemotherapy. MicroRNAs are possible modulators of cancer stem cell characteristics and maybe involved in the retention of cancer stem cell chemoresistance. The aim of this study was to investigate the biological function of miR-199a/b on cisplatin resistance in colorectal cancer stem cells and its related mechanisms. Here, ALDHA1(+) cells from primary colorectal cancer tissues behaved similar to cancer stem cells and were chemoresistant to cisplatin. The presence of a variable fraction of ALDHA1 was detected in 9 out of 10 colorectal cancer specimens. Significantly, increased miR-199a/b expression was detected in ALDHA1(+) colorectal cancer stem cells, accompanied by a downregulation of Gsk3β and an overexpression of β-catenin and ABCG2. In patient cohort, enhanced miR-199a/b expression in colorectal cancer tissues was associated with cisplatin response and poor patient survival. In addition, 80% of colorectal cancer samples showed lower level of Gsk3β than their adjacent normal counterparts. Furthermore, Gsk3β was the direct target of miR-199a/b. MiR-199a/b regulated Wnt/β-catenin pathway by targeting Gsk3β in ALDHA1(+) colorectal cancer stem cells. By blocking Wnt/β-catenin pathway, we implied that ABCG2 lies downstream of Wnt/β-catenin pathway. ABCG2 was further demonstrated to contribute cisplatin resistance in ALDHA1(+) colorectal cancer stem cells and can be regulated by miR-199a/b. Thus, our data suggested that upregulation of miR-199a/b in ALDHA1(+) colorectal cancer stem cells contributed to cisplatin resistance via Wnt/β-catenin-ABCG2 signaling, which sheds new light on understanding the mechanism of cisplatin resistance in colorectal cancer stem cells and facilitates the development of potential therapeutics against colorectal cancer.

  15. Human Pluripotent Stem Cells and Derived Neuroprogenitors Display Differential Degrees of Susceptibility to BH3 Mimetics ABT-263, WEHI-539 and ABT-199.

    Directory of Open Access Journals (Sweden)

    Carolina Paola García

    Full Text Available Human embryonic stem cells (hESCs are hypersensitive to genotoxic stress and display lower survival ability relative to their differentiated progeny. Herein, we attempted to investigate the source of this difference by comparing the DNA damage responses triggered by the topoisomerase I inhibitor camptothecin, in hESCs, human induced pluripotent stem cells (hiPSCs and hESCs-derived neuroprogenitors (NP. We observed that upon camptothecin exposure pluripotent stem cells underwent apoptosis more swiftly and at a higher rate than differentiated cells. However, the cellular response encompassing ataxia-telangiectasia mutated kinase activation and p53 phosphorylation both on serine 15 as well as on serine 46 resulted very similar among the aforementioned cell types. Importantly, we observed that hESCs and hiPSCs express lower levels of the anti-apoptotic protein Bcl-2 than NP. To assess whether Bcl-2 abundance could account for this differential response we treated cells with ABT-263, WEHI-539 and ABT-199, small molecules that preferentially target the BH3-binding pocket of Bcl-xL and/or Bcl-2 and reduce their ability to sequester pro-apoptotic factors. We found that in the absence of stress stimuli, NP exhibited a higher sensitivity to ABT- 263 and WEHI-539 than hESCs and hiPSCs. Conversely, all tested cell types appeared to be highly resistant to the Bcl-2 specific inhibitor, ABT-199. However, in all cases we determined that ABT-263 or WEHI-539 treatment exacerbated camptothecin-induced apoptosis. Importantly, similar responses were observed after siRNA-mediated down-regulation of Bcl-xL or Bcl-2. Taken together, our results suggest that Bcl-xL contrary to Bcl-2 contributes to ensure cell survival and also functions as a primary suppressor of DNA double-strand brake induced apoptosis both in pluripotent and derived NP cells. The emerging knowledge of the relative dependence of pluripotent and progenitor cells on Bcl-2 and Bcl-xL activities may help

  16. Targeted Inhibition of the miR-199a/214 Cluster by CRISPR Interference Augments the Tumor Tropism of Human Induced Pluripotent Stem Cell-Derived Neural Stem Cells under Hypoxic Condition

    Directory of Open Access Journals (Sweden)

    Yumei Luo

    2016-01-01

    Full Text Available The human induced pluripotent stem cell (hiPSC provides a breakthrough approach that helps overcoming ethical and allergenic challenges posed in application of neural stem cells (NSCs in targeted cancer gene therapy. However, the tumor-tropic capacity of hiPSC-derived NSCs (hiPS-NSCs still has much room to improve. Here we attempted to promote the tumor tropism of hiPS-NSCs by manipulating the activity of endogenous miR-199a/214 cluster that is involved in regulation of hypoxia-stimulated cell migration. We first developed a baculovirus-delivered CRISPR interference (CRISPRi system that sterically blocked the E-box element in the promoter of the miR-199a/214 cluster with an RNA-guided catalytically dead Cas9 (dCas9. We then applied this CRISPRi system to hiPS-NSCs and successfully suppressed the expression of miR-199a-5p, miR-199a-3p, and miR-214 in the microRNA gene cluster. Meanwhile, the expression levels of their targets related to regulation of hypoxia-stimulated cell migration, such as HIF1A, MET, and MAPK1, were upregulated. Further migration assays demonstrated that the targeted inhibition of the miR-199a/214 cluster significantly enhanced the tumor tropism of hiPS-NSCs both in vitro and in vivo. These findings suggest a novel application of CRISPRi in NSC-based tumor-targeted gene therapy.

  17. Unexpected distribution of CA19.9 and other type 1 chain Lewis antigens in normal and cancer tissues of colon and pancreas: Importance of the detection method and role of glycosyltransferase regulation.

    Science.gov (United States)

    Aronica, Adele; Avagliano, Laura; Caretti, Anna; Tosi, Delfina; Bulfamante, Gaetano Pietro; Trinchera, Marco

    2017-01-01

    CA19.9 antigen has been assumed as an abundant product of cancer cells, due to the reactivity found by immunohistochemical staining of cancer tissues with anti-CA19.9 antibody. Expression and biosynthesis of type 1 chain Lewis antigens in the colon and the pancreas were studied by immunodetection in tissue sections and lysates, quantification of glycosyltransferase transcripts, bisulfite sequencing, and chromatin immunoprecipitation assays. CA19.9 was poorly detectable in normal colon mucosa and almost undetectable in colon cancer, while it was easily detected in the pancreatic ducts, together with Lewis b antigen, under both normal and cancer conditions. B3GALT5 transcripts were down-regulated in colon cancer, while they remained expressed in pancreatic cancer. Even ST3GAL3 transcript appeared well expressed in the pancreas but poorly in the colon, irrespective of normal or cancer conditions. CpG islands flanking B3GALT5 native promoter presented an extremely low degree of methylation in pancreatic cancer with respect to colon cancer. In a DNA region about 1kb away from the B3GALT5 retroviral promoter, a stretch of CG dinucleotides presented a methylation pattern potentially associated with transcription. Such a DNA region and the transcription factor binding site provided overlapping results by chromatin immunoprecipitation assays, corroborating the hypothesis. CA19.9 appears as a physiological product whose synthesis strongly depends on the tissue specific and epigenetically-regulated expression of B3GALT5 and ST3GAL3. CA19.9 and other Lewis antigens acquire tumor marker properties in the pancreas due to mechanisms giving rise to reabsorption into vessels and elevation in circulating levels. Copyright © 2016 Elsevier B.V. All rights reserved.

  18. AXIOLOGY ARBITRATION VALUE RULING IN THE CASE SETTLEMENT TRADE (Case Study Decision Of Supreme Court Number : 199 K / Pdt.Sus / 2012

    Directory of Open Access Journals (Sweden)

    Safrin Salam

    2016-12-01

    Full Text Available The existence of the Indonesian National Arbitration Board (BANI in Indonesia that still exist to this day is one manifestation of diakomodasinya patterns of dispute resolution outside the court. Legal Considerations Application Reasons Cancellation Arbitral Article 70 of Law No. 30 of 1999 on Arbitration and Alternative Dispute Resolution in Supreme Court Decision No. 199 K / Pdt.Sus / 2012 Relation Ensure Legal Certainty In the disputing parties are legal considerations of the cancellation decision was not all acceptance or rejection of the cancellation request arbitration decision based on legal grounds contained in Article 70 of Law No. 30 of 1999. Act No. 30 of 1999 on the ADR needs to be improved, especially the explanation of article 60 and article 70 which could lead to legal uncertainty for justice seekers among businesses in the dispute and the opportunity loss of trust businesses to resolve the dispute out of court through arbitration institution (the Arbitration Tribunal Ad-Hoc, BANI, etc.

  19. The most common complications after wisdom-tooth removal: part 1: a retrospective study of 1,199 cases in the mandible.

    Science.gov (United States)

    Sigron, Guido R; Pourmand, Pièrre P; Mache, Beatrice; Stadlinger, Bernd; Locher, Michael C

    2014-01-01

    The knowledge of potential complications after surgical removal of third molars and adequate risk assessment is indispensable in oral surgery. The present retrospective study analyzed the influence of different parameters, such as the patient’s age and gender, retention type, and radiological projection (using orthopantomography) of wisdom teeth on the mandibular canal on postoperative complications after the removal of 1,199 wisdom teeth. Overall, 101 (8.4%) complications occurred: 50 cases of alveolar osteitis (4.2%), 12 temporary (1%) and 6 persistent (0.5%) sensation disorders, 15 abscesses (1.25%), 7 dehiscences (0.6%), 5 cases of post-operative bleeding (0.4%), 4 sequestra (0.32%), 1 fistula (0.08%) and 1 hematoma (0.08%). The risk for developing alveolar osteitis was 6% for patients who suffered from a previous pericoronal infection and was higher for female than male patients. Smoking showed no influence on alveolar osteitis. A significant correlation (pwisdom teeth on the mandibular canal and post-operative sensation disorders. The experience of the surgeon and pre-operative 3-dimensional imaging (cone- beam computed tomography, computed tomography) did not reduce this risk. No correlation was found for patient’s age and gender. In conclusion, the surgical decision to remove wisdom teeth must be made with caution in cases of complete radiological projection of the wisdom tooth on the mandibular canal.

  20. $^{204m}$Pb: A new Probe for TDPAC Experiments in Biology Complementing the Well Established Probes $^{111}$Cd and $^{199m}$Hg

    CERN Multimedia

    2002-01-01

    The short-lived nuclear probes $\\,^{111m}$Cd( t$_{1/2}$ = 49 min) , $^{199m}$Hg ( t$_{1/2}$ = 43 min) , and $^{204m}$Pb( t$_{1/2}$ = 43 min) supplied by ISOLDE are used to study the interaction of metals with biological macromolecules like, e.g., DNA and proteins. The structure and dynamics of metal sites in biomolecules are important in determining the functional efficiency of these macromolecules. Many life processes are based on such interactions. In order to study those metal sites close to physiological conditions a highly sensitive spectroscopic method is required, like Time Differential Perturbed Angular Correlation (TDPAC). Here, a radioactive atom is placed at the site of interest and by correlating the emitted $\\gamma$-quanta in space and on a nanosecond time scale local structural information is provided via the Nuclear Quadrupole Interaction. These investigations will allow a deeper insight into the adaptivity and rigidity of metal sites in the blue copper proteins (electron transfer proteins), th...

  1. A Breakthrough Efficiency of 19.9% Obtained in Inverted Perovskite Solar Cells by Using an Efficient Trap State Passivator Cu(thiourea)I.

    Science.gov (United States)

    Ye, Senyun; Rao, Haixia; Zhao, Ziran; Zhang, Linjuan; Bao, Hongliang; Sun, Weihai; Li, Yunlong; Gu, Feidan; Wang, Jianqiang; Liu, Zhiwei; Bian, Zuqiang; Huang, Chunhui

    2017-06-07

    It is extremely significant to study the trap state passivation and minimize the trap states of perovskite to achieve high-performance perovskite solar cells (PSCs). Here, we have first revealed and demonstrated that a novel p-type conductor Cu(thiourea)I [Cu(Tu)I] incorporated in perovskite layer can effectively passivate the trap states of perovskite via interacting with the under-coordinated metal cations and halide anions at the perovskite crystal surface. The trap state energy level of perovskite can be shallowed from 0.35-0.45 eV to 0.25-0.35 eV. In addition, the incorporated Cu(Tu)I can participate in constructing the p-i bulk heterojunctions with perovskite, leading to an increase of the depletion width from 126 to 265 nm, which is advantageous for accelerating hole transport and reducing charge carrier recombination. For these two synergistic effects, Cu(Tu)I can play a much better role than that of the traditional p-type conductor CuI, probably due to its identical valence band maximum with that of perovskite, which enables to not only lower the trap state energy level to a greater extent but also eliminate the potential wells for holes at the p-i heterojunctions. After optimization, a breakthrough efficiency of 19.9% has been obtained in the inverted PSCs with Cu(Tu)I as the trap state passivator of perovskite.

  2. CA 19-9 (Cancer Antigen 19-9)

    Science.gov (United States)

    ... called Lewis antigen that is similar to the ABO antigens that are used in blood typing for ... Guidelines for the Use of Tumor Markers in Breast and Colorectal Cancer [On-line guidelines]. Available online at http://www. ...

  3. Sensitivity of Symptomatology Versus Diagnostic Procedures and Concentration of CEA and CA19-9 in the Early Detection of Colorectal Cancer.

    Science.gov (United States)

    Vukobrat-Bijedic, Zora; Husic-Selimovic, Azra; Bijedic, Nina; Mujkic, Admir; Sofic, Amela; Gogov, Bisera; Mehmedovic, Amila; Bjelogrlic, Ivana; Glavas, Sanjin; Djuran, Aleksandra

    2014-04-01

    Colorectal cancer is the major diagnostic and therapeutic problem. The number of patients in the world has increased recently. In our country it is detected late and patients visit doctor in the advanced stage of the disease with already developed metastases. A clinical study was conducted at the Clinic of gastroenterohepatologists, Clinical Center of Sarajevo University on 164 patients. Special attention was given to the symptoms, which are considered to be a macroscopically visible as bleeding, anemia pain, weight loss and disturbance of defecation. Smoking had no effect because a small number of observed patients smoked. Endoscopic examination revealed localization of the tumor in the colon and then underwent targeted biopsy, histological analysis by pathologist, and we determined the concentration of CEA and CA19-9 in the serum. In order to get the most relevant results we used larger data set. The program used to prepare the data was Microsoft Excel 2013, and for the creation of decision trees is a used software RapidMiner version 5. Our research has shown that patients older than 55 years with significant stenosis, metastasis and diarrhea that lasted longer than 3.5 months and bleeding that lasted up to 10 months had cancer of the rectum. Bleeding that lasts longer than 10 months indicated that it was the case of cancer that was localized in the rectum in men and sigma in women. Patients older than 82.5 years and had diarrhea up to 3.5 months developed cancer in the sigma part of the colon. Analyzing pain as a symptom of an alarm, the study found that pain that lasts longer than a few days, is caused by rectal cancer, and occurs after the age of 70.5 years, and in patients younger than 63 years anemia as a alarm symptom, which lasted more than two months in men was caused by cancer of the rectum and in women cancer in other localizations within colon. In patients without stenosis developed bleeding as the most important symptom. We can say that after the age

  4. Surgical management of medium and large petroclival meningiomas: a single institution's experience of 199 cases with long-term follow-up.

    Science.gov (United States)

    Li, Da; Tang, Jie; Ren, Cong; Wu, Zhen; Zhang, Li-Wei; Zhang, Jun-Ting

    2016-03-01

    Petroclival meningiomas (PCMs) were once regarded as 'inoperable' due to their complex anatomy and limited surgical exposure. This study aimed to evaluate the long-term outcomes of surgically treated PCMs larger than 2 cm. A series of 199 consecutive patients (137 females, 68.8 %) with PCMs larger than 2 cm from between 1993 and 2003 were included. The clinical charts, radiographs, and follow-ups were evaluated. Gross total resection (GTR) was achieved in 111 (55.8 %) patients, subtotal resection (STR) in 65, and partial resection (PR) in 23. Cranial nerve dysfunctions were the most common complications and occurred in 133 (66.8 %) cases. The surgical mortality was 2.0 %. The Karnofsky Performance Scale (KPS) scores significantly decreased 1 month after the operations (preoperative KPS = 76.8 and postoperative KPS = 64.8; p = 0.011, Paired-samples t test). Long-term follow-ups were obtained in 142 patients, the follow-up duration was 171.6 months, and the most recent KPS was 83.2. Permanent morbidities remained in 24 patients (18.9 %). Multivariate analysis revealed that brainstem edema and tumors larger than 4 cm in diameter were independent risk factors in terms of outcomes (KPS Pearson χ (2) test). Gamma Knife radiosurgery for the remnants exhibited good tumor control. Favorable outcomes and low mortality were achieved with the microsurgical management of medium and large PCMs; however, the rates of cranial nerves dysfunction remained high. Radically aggressive resection might not be judicious in terms of postoperative morbidity. The preoperative evaluations and intraoperative findings were informative regarding the outcomes. The low follow-up rate likely compromised our findings, and additional consecutive studies were required.

  5. Independent and joint associations of grip strength and adiposity with all-cause and cardiovascular disease mortality in 403,199 adults: the UK Biobank study.

    Science.gov (United States)

    Kim, Youngwon; Wijndaele, Katrien; Lee, Duck-Chul; Sharp, Stephen J; Wareham, Nick; Brage, Soren

    2017-09-01

    Background: Higher grip strength (GS) is associated with lower mortality risk. However, whether this association is independent of adiposity is uncertain.Objective: The purpose of this study was to examine the associations between GS, adiposity, and mortality.Design: The UK Biobank study is an ongoing prospective cohort of >0.5 million UK adults aged 40-69 y. Baseline data collection (2006-2010) included measurements of GS and adiposity indicators, including body mass index (BMI; in kg/m(2)). Age- and sex-specific GS quintiles were used. BMI was classified according to clinical cutoffs.Results: Data from 403,199 participants were included in analyses. Over a median 7.0-y of follow-up, 8287 all-cause deaths occurred. The highest GS quintile had 32% (95% CI: 26%, 38%) and 25% (95% CI: 16%, 33%) lower all-cause mortality risks for men and women, respectively, compared with the lowest GS quintile, after adjustment for confounders and BMI. Obesity class II (BMI ≥35) was associated with a greater all-cause mortality risk. The highest GS quintile and obesity class II category showed relatively higher all-cause mortality hazards (not statistically significant in men) than the highest GS quintile and the normal weight category; however, the increased risk was relatively lower than the risk for the lowest GS quintile and obesity class II category. All-cause mortality risks were generally lower for obese but stronger individuals than for nonobese but weaker individuals. Similar patterns of associations were observed for cardiovascular mortality.Conclusions: Lower grip strength and excess adiposity are both independent predictors of higher mortality risk. The higher mortality risk associated with excess adiposity is attenuated, although not completely attenuated, by greater GS. Interventions and policies should focus on improving the muscular strength of the population regardless of their degree of adiposity. © 2017 American Society for Nutrition.

  6. Safety and pharmacodynamics of venetoclax (ABT-199) in a randomized single and multiple ascending dose study in women with systemic lupus erythematosus.

    Science.gov (United States)

    Lu, P; Fleischmann, R; Curtis, C; Ignatenko, S; Clarke, S H; Desai, M; Wong, S L; Grebe, K M; Black, K; Zeng, J; Stolzenbach, J; Medema, J K

    2018-02-01

    Objective The anti-apoptotic protein B-cell lymphoma 2 (Bcl-2) may contribute to the pathogenesis of systemic lupus erythematosus. The safety, tolerability, and pharmacodynamics of the selective Bcl-2 inhibitor venetoclax (ABT-199) were assessed in women with systemic lupus erythematosus. Methods A phase 1, double-blind, randomized, placebo controlled study evaluated single ascending doses (10, 30, 90, 180, 300, and 500 mg) and multiple ascending doses (2 cycles; 30, 60, 120, 240, 400, and 600 mg for 1 week, and then 3 weeks off per cycle) of orally administered venetoclax. Eligible participants were aged 18-65 years with a diagnosis of systemic lupus erythematosus for 6 months or more receiving stable therapy for systemic lupus erythematosus (which could have included corticosteroids and/or stable antimalarials). Results All patients (48/48) completed the single ascending dose, 25 continued into the multiple ascending dose, and 44/50 completed the multiple ascending dose; two of the withdrawals (venetoclax 60 mg and 600 mg cohorts) were due to adverse events. Adverse event incidences were slightly higher in the venetoclax groups compared with the placebo groups, with no dose dependence. There were no serious adverse events with venetoclax. The most common adverse events were headache, nausea, and fatigue. Venetoclax 600 mg multiple ascending dose treatment depleted total lymphocytes and B cells by approximately 50% and 80%, respectively. Naive, switched memory, and memory B-cell subsets enriched in autoreactive B cells exhibited dose-dependent reduction of up to approximately 80%. There were no consistent or marked changes in neutrophils, natural killer cells, hemoglobin, or platelets. Conclusions Venetoclax was generally well tolerated in women with systemic lupus erythematosus and reduced total lymphocytes and disease-relevant subsets of antigen-experienced B cells. Registration ClinicalTrials.gov: NCT01686555.

  7. A fundamental study of immunoscintigraphy with sup 131 I-labeled anti-CA 19-9 and anti-CEA monoclonal antibodies; Imaging of tumor-bearing mice by IMACIS-1 and cell ELISA with human tumor cells

    Energy Technology Data Exchange (ETDEWEB)

    Nogami, Toshihiko; Miura, Hiroshi; Ohmi, Shoichi; Kazahaya, Yasuhiro (CIS DIAGNOSTIC K.K., Chiba (Japan))

    1990-05-01

    A study was made on 2 types of {sup 131}I-labeled anti-CA 19-9 and anti-CEA mouse monoclonal antibodies (IMACIS-1) against human cancer related antigen as to their usefulness in radioimmunoimaging. Tumor-bearing nude mice were used for comparison. The transplanted tumors (SW948, COLO 201) were clearly visualized 48-72 hours after administration of IMACIS-1. Tumor/blood ratio 72 hours after administration: 8.69 in COLO 201 and 5.70 in SW948, showing ca. 10-15 times as high as those in PC-3 and HEp-2. IMACIS-1 therefore is considered useful in radioimmunoimaging of cancer. Analysis was made by in vitro cell ELISA. As a result, both of the cells specifically reacted with anti-CA 19-9 but not anti-CEA. (author).

  8. Ultrasensitive photoelectrochemical immunoassay for CA19-9 detection based on CdSe@ZnS quantum dots sensitized TiO2NWs/Au hybrid structure amplified by quenching effect of Ab2@V(2+) conjugates.

    Science.gov (United States)

    Zhu, Hua; Fan, Gao-Chao; Abdel-Halim, E S; Zhang, Jian-Rong; Zhu, Jun-Jie

    2016-03-15

    A novel, enhanced photoelectrochemical immunoassay was established for sensitive and specific detection of carbohydrate antigen 19-9 (CA19-9, Ag). In this protocol, TiO2 nanowires (TiO2NWs) were first decorated with Au nanoparticles to form TiO2NWs/Au hybrid structure, and then coated with CdSe@ZnS quantum dots (QDs) via the layer-by-layer method, producing TiO2NWs/Au/CdSe@ZnS sensitized structure, which was employed as the photoelectrochemical matrix to immobilize capture CA19-9 antibodies (Ab1); whereas, bipyridinium (V(2+)) molecules were labeled on signal CA19-9 antibodies (Ab2) to form Ab2@V(2+) conjugates, which were used as signal amplification elements. The TiO2NWs/Au/CdSe@ZnS sensitized structure could adequately absorb light energy and dramatically depress electron-hole recombination, resulting in evidently enhanced photocurrent intensity of the immunosensing electrode. While target Ag were detected, the Ab2@V(2+) conjugates could significantly decrease the photocurrent detection signal because of strong electron-withdrawing property of V(2+) coupled with evident steric hindrance of Ab2. Thanks to synergy effect of TiO2NWs/Au/CdSe@ZnS sensitized structure and quenching effect of Ab2@V(2+) conjugates, the well-established photoelectrochemical immunoassay exhibited a low detection limit of 0.0039 U/mL with a wide linear range from 0.01 U/mL to 200 U/mL for target Ag detection. This proposed photoelectrochemical protocol also showed good reproducibility, specificity and stability, and might be applied to detect other important biomarkers. Copyright © 2015 Elsevier B.V. All rights reserved.

  9. Altered expression of micro-RNA 199a and increased levels of cardiac SIRT1 protein are associated with the occurrence of atrial fibrillation after coronary artery bypass graft surgery.

    Science.gov (United States)

    Yamac, Aylin Hatice; Kucukbuzcu, Sitki; Ozansoy, Mehmet; Gok, Ozlem; Oz, Kursat; Erturk, Mehmet; Yilmaz, Emre; Ersoy, Burak; Zeybek, Rahmi; Goktekin, Omer; Kilic, Ulkan

    2016-01-01

    Postoperative atrial fibrillation (POAF) is a potentially life-threatening complication after coronary artery bypass graft (CABG) surgery. The expression of the cardioprotective SIRT1 protein with its antioxidant activity is increased in cardiac tissue of patients suffering from POAF. So far, information is lacking about the relationship between SIRT1 regulating micro RNAs (miRs), SIRT1 protein and the occurrence of POAF. A total of 63 patients undergoing CABG were recruited, and biopsies were obtained from the right atrial appendage during cannulation. Postoperative, all patients were rhythm-monitored until discharge and randomized to POAF (n=20) or sinus rhythm (n=43). The expression of the micro RNAs miR-199a and miR-195 was quantified by real-time PCR. SIRT1 protein was detected by western blot analysis. The relative expression of miR-199a in the POAF group was significantly decreased compared to the control group (0.77±0.27 vs. 1.11±0.69, P=.022) Accordingly, SIRT 1 protein was significantly induced in tissue probes of patients with POAF (P<.001). Altered expression of the SIRT1 protein regulating miR-199a in human atrial tissue was found to be related to the occurrence of POAF, indicating its usefulness as a biomarker for cardiac surgery management. Copyright © 2016 Elsevier Inc. All rights reserved.

  10. Histomorfologia do gânglio de Gasser, da rete mirabile carotídea e da hipófise de bovinos: estudo de 199 casos Histomorphology of the Gasserian ganglion, carotid rete mirabile and pituitary gland in cattle: a study of 199 cases

    Directory of Open Access Journals (Sweden)

    Raquel R. Rech

    2006-06-01

    Full Text Available O complexo heterogêneo de tecidos formado pelo gânglio de Gasser, rete mirabile carotídea e hipófise (GRH de 199 bovinos foram macro e microscopicamente avaliados. Vinte e um GRH eram de casos confirmados de raiva, 19 com diagnóstico de meningoencefalite por herpesvírus bovino-5 (BoHV-5, 11 casos de febre catarral maligna (FCM, 7 tinham abscesso de pituitária, 17 apresentaram lesões de encefalopatia hepática (status spongiosus atribuído à fibrose crônica por intoxicação por Senecio sp; e os 124 GRH restantes eram provenientes de bovinos que não apresentaram sinais neurológicos e que morreram ou foram eutanasiados por causas diversas. Nenhuma alteração histológica significativa foi observada no GRH dos 124 bovinos que não tinham sinais neurológicos, nos 17 bovinos com encefalopatia hepática, nem nos 19 bovinos afetados por meningoencefalite por BoHV-5. Alterações inflamatórias foram encontradas em 20 dos 21 casos de raiva e consistiam de proliferação de células satélites, nódulos gliais e infiltrado linfo-plasmocitário; alterações degenerativas incluíam cromatólise central, vacuolização neuronal e necrose neuronal com neuronofagia. Corpúsculos de inclusão eosinofílicos intracitoplasmáticos (de Negri foram encontrados em 19 dos 21 casos de raiva; neurite do nervo trigêmeo em 11 casos e neuroipofisite em 4 casos. O complexo GRH de 9 de 11 casos de FCM apresentava arterite necrosante, que afetava as artérias da rete mirabile carotídea. Em 7 dos 199 GRH examinados havia abscessos de pituitária caracterizados por agregados de neutrófilos e detritos celulares circundados por infiltrado mononuclear e cápsula fibrosa. Vários achados incidentais foram observados nos 199 GRH examinados histologicamente e não foram correlacionados com alterações ligadas a doenças. Estes incluíam cistos na cavidade hipofisária, agregados de fibrina e neutrófilos no seio cavernoso da rete mirabile carotídea, leve aumento

  11. Alternative antibody for the detection of CA19-9 antigen: a European multicenter study for the evaluation of the analytical and clinical performance of the Access GI Monitor assay on the UniCel Dxl 800 Immunoassay System.

    Science.gov (United States)

    Stieber, Petra; Molina, Rafael; Gion, Massimo; Gressner, Axel; Troalen, Frédéric; Holdenrieder, Stefan; Auge, Jose Maria; Zancan, Matelda; Wycislo, Matthias; Jarrige, Véronique

    2008-01-01

    Gastrointestinal cancer antigen CA19-9 is known as a valuable marker for the management of patients with pancreatic cancer. The analytical and clinical performance of the Access GI Monitor assay (Beckman Coulter) was evaluated on the UniCel Dxl 800 Immunoassay System at five different European sites and compared with a reference method, defined as CA19-9 on the Elecsys System (Roche Diagnostics). Total imprecision (%CV) of the GI Monitor ranged between 3.4% and 7.7%, and inter-laboratory reproducibility between 3.6% and 4.0%. Linearity upon dilution showed a mean recovery of 97.4% (SD + 7.2%). Endogenous interferents had no influence on GI Monitor levels (mean recoveries: hemoglobin 103%, bilirubin 106%, triglycerides 106%). There was no high-dose hook effect up to 115,000 kU/L. Clinical performance investigated in sera from 1811 individuals showed a good correlation between the Access GI Monitor and Elecsys CA19-9 (R = 0.959, slope = 1.004, intercept = +0.17). GI Monitor serum levels were low in healthy individuals (n = 267, median = 6.0 kU/L, 95th percentile=23.1 kU/L), higher in individuals with various benign diseases (n = 550, medians = 5.8-13.4 kU/L, 95th percentiles = 30.1-195.5 kU/L) and even higher in individuals suffering from various cancers (n = 995, medians = 8.4-233.8 kU/L, 95th percentiles = 53.7-13,902 kU/L). Optimal diagnostic accuracy for cancer detection against the relevant benign control group by the GI Monitor was found for pancreatic cancer [area under the curve (AUC) 0.83]. Results for the reference CA19-9 assay were comparable (AUC 0.85). The Access GI Monitor provides very good methodological characteristics and demonstrates an excellent analytical and clinical correlation with the Elecsys CA19-9. The GI Monitor shows the best diagnostic accuracy in pancreatic cancer. Our results also suggest a clinical value of the GI Monitor in other cancers.

  12. Clinical performance of LOCI™-based tumor marker assays for tumor markers CA 15-3, CA 125, CEA, CA 19-9 and AFP in gynecological cancers.

    Science.gov (United States)

    Dolscheid-Pommerich, Ramona C; Keyver-Paik, Mignon; Hecking, Thomas; Kuhn, Walther; Hartmann, Gunther; Stoffel-Wagner, Birgit; Holdenrieder, Stefan

    2017-10-01

    Evidence is sparse regarding the clinical performance of luminescent oxygen channeling immunoassays-based tumor marker assays in gynecological cancer. Analyzing serum samples of 336 patients with Dimension™Vista1500, we investigated the diagnostic power of carbohydrate antigen 15-3, carbohydrate antigen 125, carcinoembryonic antigen, carbohydrate antigen 19-9, and alpha-fetoprotein in patients suffering from different types of gynecological cancer and precancerous gynecological diseases and compared findings to appropriate control groups. The cohort comprised 177 female patients with gynecological cancers (73 breast, 22 cervical, 16 endometrial, 17 vulva, and 49 ovarian cancers), 26 patients with precancerous gynecological diseases (11 vulva, 4 cervical, and 10 breast), 109 patients with benign gynecological diseases, and 24 healthy controls. Discriminative power was assessed by areas under the curve in receiver operating characteristic curves, and sensitivities were determined at a fixed specificity of 95%. Levels of biomarkers in healthy controls were in the expected ranges and a discriminative power between gynecological cancers and healthy controls was observed for several tumor markers. Established tumor type-associated markers were elevated in specific gynecological cancers and benign controls as well as within precancerous gynecological diseases and healthy control group. In ovarian cancer, carbohydrate antigen 125 and carbohydrate antigen 15-3 were significantly elevated compared to the respective benign diseases. Carbohydrate antigen 125 was the most conclusive marker (area under the curve = 0.86% and 77.6% sensitivity at 95% specificity). In breast cancer, carcinoembryonic antigen and carbohydrate antigen 15-3 were significantly higher than in the respective benign diseases. Carcinoembryonic antigen achieved the most conclusive area under the curve (0.65) with 31.5% sensitivity at 95% specificity. None of the investigated markers was found to be of

  13. Cruise report; RV Coastal Surveyor Cruise C1-99; multibeam mapping of the Long Beach, California continental shelf; April 12 through May 19, 1999

    Science.gov (United States)

    Gardner, James V.; Hughes-Clarke, John E.; Mayer, Larry A.

    1999-01-01

    The greater Los Angeles area of California is home to more than 10 million people. This large population puts increased pressure on the adjacent offshore continental shelf and margin with activities such as ocean disposal for dredged spoils, explosive disposal, waste-water outfall, and commercial fishing. The increased utilization of the shelf and margin in this area has generated accelerated multi-disciplinary research efforts in all aspects of the environment of the coastal zone. Prior to 1996 there were no highly accurate base maps of the continental shelf and slope upon which the research activities could be located and monitored. In 1996, the United States Geological Survey (USGS) Pacific Seafloor Mapping Project began to address this problem by mapping the Santa Monica shelf and margin (Fig. 1) using a state-of-the-art, high-resolution multibeam sonar system (Gardner, et al., 1996; 1999). Additional seafloor mapping in 1998 provided coverage of the continental margin from south of Newport to the proximal San Pedro Basin northwest of Palos Verdes Peninsula (Gardner, et al., 1998) (Fig. 1). The mapping of the seafloor in the greater Los Angeles continental shelf and margin was completed with a 30-day mapping of the Long Beach shelf in April and May 1999, the subject of this report. The objective of Cruise C-1-99-SC was to completely map the broad continental shelf from the eastern end of the Palos Verdes Peninsula to the narrow shelf south of Newport Beach, from the break in slope at about 120-m isobath to the inner shelf at about the 10-m isobath. Mapping the Long Beach shelf was jointly funded by the U.S. Geological Survey and the County of Orange (CA) Sanitation District and was conducted under a Cooperative Agreement with the Ocean Mapping Group from the University of New Brunswick (OMG/UNB). The OMG/UNB contracted with C&C Technologies, Inc. of Lafayette, LA for use of the RV Coastal Surveyor and the latest evolution of high-resolution multibeam sonars, a

  14. CA 19-9 to peritoneal carcinomatosis index (PCI) ratio is prognostic in patients with epithelial appendiceal mucinous neoplasms and peritoneal dissemination undergoing cytoreduction surgery and intraperitoneal chemotherapy: A retrospective cohort study.

    Science.gov (United States)

    Kozman, Mathew A; Fisher, Oliver M; Rebolledo, Bree-Anne J; Valle, Sarah J; Alzahrani, Nayef; Liauw, Winston; Morris, David L

    2017-12-01

    Serum tumour levels have been shown to be prognostic in patients with epithelial appendiceal mucinous neoplasms with peritoneal dissemination (pseudomyxoma peritonei (PMP)). A singular index which incorporates both tumour activity (as depicted by serum tumour marker levels) and tumour volume (as depicted by peritoneal carcinomatosis index (PCI)), may give a more precise surrogate of tumour biological behaviour. The prognostic implication of this index has not yet been reported. A retrospective cohort study of all patients with PMP managed from 1996 to 2016 with cytoreductive surgery (CRS) and intraperitoneal chemotherapy (IPC) was performed by analysing the survival effect of the ratio of preoperative serum CEA, CA19.9 and CA125 to PCI. Three hundred and eighty-six patients were included. In patients with low-grade PMP, elevated CA19-9/PCI ratio resulted in poorer median overall survival times (104 months vs NR, 95%CI 83 - NR, log-rank p < 0.001) and was an independent predictor of reduced overall survival on multivariable analysis (adjusted HR 5.60, 95%CI 1.60-19.68, p = 0.007). In patients with high-grade PMP, no statistically significant difference in survival was recognised. CA19-9/PCI ratio is an independent prognostic factor for overall survival in patients with low-grade PMP undergoing CRS and IPC. By accounting for both tumour activity and tumour volume simultaneously, this novel index behaves as a surrogate of tumour biology and provides a useful adjunct for decisions regarding treatment allocation in this patient group. Copyright © 2017 Elsevier Ltd, BASO ~ The Association for Cancer Surgery, and the European Society of Surgical Oncology. All rights reserved.

  15. Influence of Insulin-Like Growth Factor-I on Maturation and Fertilization Rate of Immature Oocyte and Embryo Development in NMRI Mouse with TCM199 and α-MEM Medium.

    Science.gov (United States)

    Toori, Mehdi Akbartabar; Mosavi, Esmaeil; Nikseresht, Mohsen; Barmak, Mehrzad Jafari; Mahmoudi, Reza

    2014-12-01

    In vitro maturation (IVM) of oocytes and subsequent, in vitro fertilization (IVF) for the generation of embryos in the laboratory has important values. Growth factors are a component of a complex system of autocrine and paracrine factors that have a regulatory role in ovarian function and affect oocyte maturation. Therefore, the aim of this study is to evaluate the effect of IGF-I on IVM and IVF of mice oocytes during culture with α-MEM and TCM199 medium. Cumulus oocyte complexes (COCs) and denuded oocyte were obtained from 4-6 week old NMRI mice and underwent in vitro maturation and in vitro fertilization in presence or absence of IGF-I with α-MEM and TCM199. Maturation rate (79.6%), fertilization rate (87.2%), two cells development rate (79.5%) and blastocyst rate(43.2%) was higher in COCs cultured in α-MEM with IGF-I, while lower maturation rate (50.6%) fertilization rate (61%), two cells development rate (48.8%) and blastocyst rate(14.6%) were seen in cultured denuded oocytes (DOs) in TCM199 without growth factor. As well as, maturation fertilization, two cells development and blastocyst rates in COCs were higher than DOs. Our findings have shown that IGF-I is involved in the oocyte biology and improve the oocyte maturation, fertilization and embryo development to blastocyst competence in vitro. In addition, it has also shown that cumulus cells are vital for oocyte development when IGF-1 added to the mediums.

  16. 小型カーフェリーの模型試験 : 199G.T.型カーフェリーと両頭型カーフェリー

    OpenAIRE

    菅井, 信夫; 高橋, 孝仁; 塚田, 吉昭; 上田, 隆康; Nobuo, SUGAI; Takahito, TAKAHASHI; Yoshiaki, TUKADA; Takayasu, UEDA; 船舶技術研究所推進性能部; 船舶技術研究所推進性能部; 船舶技術研究所推進性能部; 船舶技術研究所氷海技術部

    1993-01-01

    Model tests were carried out using two models ; one is a 199G.T. car-ferry with a twin skeg stern form, and the other is a double ender car-ferry. The hull form of the twin skeg ship is determined through a modification of hull form on a car-ferry with single propeller. The objective of the tank test using the twin skeg ship model is to reduce stern vibration and to improve a propulsive performance. The aim of the model test using the double ender hull ship is to investigate the resistance du...

  17. Pb(II) and Hg(II) binding to $\\textit{de novo}$ designed proteins studied by $^{204m}$Pb- and $^{199m}$Hg-Perturbed Angular Correlation of $\\gamma$-rays (PAC) spectroscopy : Clues to heavy metal toxicity

    CERN Multimedia

    2002-01-01

    $\\textit{De novo}$ design of proteins combined with PAC spectroscopy offers a unique and powerful approach to the study of fundamental chemistry of heavy metal-protein interactions, and thus of the mechanisms underlying heavy metal toxicity. In this project we focus on Pb(II) and Hg(II) binding to designed three stranded coiled coil proteins with one or two binding sites, mimicking a variety of naturally occurring thiolate-rich metal ion binding sites in proteins. The $^{204m}$Pb- and $^{199m}$Hg-PAC experiments will complement data already recorded with EXAFS, NMR, UV-Vis and CD spectroscopies.

  18. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  19. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  20. Arctigenin Confers Neuroprotection Against Mechanical Trauma Injury in Human Neuroblastoma SH-SY5Y Cells by Regulating miRNA-16 and miRNA-199a Expression to Alleviate Inflammation.

    Science.gov (United States)

    Song, Jie; Li, Na; Xia, Yang; Gao, Zhong; Zou, Sa-Feng; Yan, Yu-Hui; Li, Shao-Heng; Wang, Yue; Meng, Ya-Kun; Yang, Jing-Xian; Kang, Ting-Guo

    2016-09-01

    Mechanical trauma injury is a severe insult to neural cells. Subsequent secondary injury involves the release of inflammatory factors that have dramatic consequences for undamaged cells, leading to normal cell death after the initial injury. The present study investigated the capacity for arctigenin (ARC) to prevent secondary effects and evaluated the mechanism underlying the action of microRNA (miRNA)-199a and miRNA-16 in a mechanical trauma injury (MTI) model using SH-SY5Y cells in vitro. SH-SY5Y cells are often applied to in vitro models of neuronal function and differentiation. Recently, miRNAs have been demonstrated to play a crucial role in NF-κB and cholinergic signaling, which can regulate inflammation. The cell model was established by scratch-induced injury of human SH-SY5Y cells, which mimics the characteristics of MTI. A cell counting kit-8 (CCK-8), terminal deoxynucleotidyl transferase dUTP nick end labeling (TUNEL), and immunocytochemistry were used to measure cell viability. Enzyme-linked immunosorbent assay (ELISA) was used to evaluate the inflammatory cytokine and cholinesterase (CHE) content. The lactate dehydrogenase (LDH) content was measured to assess the degree of cell injury. The mRNA levels were measured by RT-PCR to analyze ARC's mechanism of action. miRNA inhibitors and mimics were used to inhibit and strengthen the expression of miRNAs. Protein expression was detected by western blotting analysis. ARC treatment reduced the TNF-α and IL-6 levels as well as the number of TUNEL+ apoptotic SH-SY5Y cells surrounding the scratch and increased the IL-10 level compared to the controls. ARC attenuated the increase of the cell damage degree and LDH content induced by scratching, indicating increased cell survival. Mechanistic studies showed that ARC upregulated the miRNA-16 and miRNA-199a levels to reduce upstream protein (IKKα and IKKβ) expression and inhibit NF-κB signaling pathway activity; moreover, the increased miRNA-199a suppresses

  1. Large-Scale Single-Nucleotide Polymorphism (SNP) and Haplotype Analyses, Using Dense SNP Maps, of 199 Drug-Related Genes in 752 Subjects: the Analysis of the Association between Uncommon SNPs within Haplotype Blocks and the Haplotypes Constructed with Haplotype-Tagging SNPs

    National Research Council Canada - National Science Library

    Kamatani, Naoyuki; Sekine, Akihiro; Kitamoto, Takuya; Iida, Aritoshi; Saito, Susumu; Kogame, Akifumi; Inoue, Eisuke; Kawamoto, Manabu; Harigai, Masayoshi; Nakamura, Yusuke

    2004-01-01

    ...) and haplotypes in 199 drug-related genes, through use of 4,190 SNPs in 752 control subjects. Drug-related genes, like other genes, have a haplotype-block structure, and a few haplotype-tagging SNPs (htSNPs...

  2. Both the frequency of HbA1c testing and the frequency of self-monitoring of blood glucose predict metabolic control: A multicentre analysis of 15 199 adult type 1 diabetes patients from Germany and Austria.

    Science.gov (United States)

    Schwandt, A; Best, F; Biester, T; Grünerbel, A; Kopp, F; Krakow, D; Laimer, M; Wagner, C; Holl, R W

    2017-10-01

    The objective of this study was to examine the association between metabolic control and frequency of haemoglobin A1c (HbA1c ) measurements and of self-monitoring of blood glucose, as well as the interaction of both. Data of 15 199 adult type 1 diabetes patients registered in a standardized electronic health record (DPV) were included. To model the association between metabolic control and frequency of HbA1c testing or of self-monitoring of blood glucose, multiple hierarchic regression models with adjustment for confounders were fitted. Tukey-Kramer test was used to adjust P values for multiple comparisons. Vuong test was used to compare non-nested models. The baseline variables of the study population were median age 19.9 [Q1; Q3: 18.4; 32.2] years and diabetes duration 10.4 [6.8; 15.7] years. Haemoglobin A1c was 60.4 [51.5; 72.5] mmol/mol. Frequency of HbA1c testing was 8.0 [5.0; 9.0] within 2 years, and daily self-monitoring of blood glucose frequency was 5.0 [4.0; 6.0]. After adjustment, a U-shaped association between metabolic control and frequency of HbA1c testing was observed with lowest HbA1c levels in the 3-monthly HbA1c testing group. There was an inverse relationship between self-monitoring of blood glucose and HbA1c with lower HbA1c associated with highest frequency of testing (>6 daily measurements). Quarterly HbA1c testing and frequent self-monitoring of blood glucose were associated with best metabolic control. The adjusted Vuong Z statistic suggests that metabolic control might be better explained by HbA1c testing compared to self-monitoring of blood glucose (P monitoring together with frequent self-monitoring of blood glucose in diabetes management to reach and maintain target HbA1c . Copyright © 2017 John Wiley & Sons, Ltd.

  3. Assessment of average of normals (AON) procedure for outlier-free datasets including qualitative values below limit of detection (LoD): an application within tumor markers such as CA 15-3, CA 125, and CA 19-9.

    Science.gov (United States)

    Usta, Murat; Aral, Hale; Mete Çilingirtürk, Ahmet; Kural, Alev; Topaç, Ibrahim; Semerci, Tuna; Hicri Köseoğlu, Mehmet

    2016-11-01

    Average of normals (AON) is a quality control procedure that is sensitive only to systematic errors that can occur in an analytical process in which patient test results are used. The aim of this study was to develop an alternative model in order to apply the AON quality control procedure to datasets that include qualitative values below limit of detection (LoD). The reported patient test results for tumor markers, such as CA 15-3, CA 125, and CA 19-9, analyzed by two instruments, were retrieved from the information system over a period of 5 months, using the calibrator and control materials with the same lot numbers. The median as a measure of central tendency and the median absolute deviation (MAD) as a measure of dispersion were used for the complementary model of AON quality control procedure. The ubias values, which were determined for the bias component of the measurement uncertainty, were partially linked to the percentages of the daily median values of the test results that fall within the control limits. The results for these tumor markers, in which lower limits of reference intervals are not medically important for clinical diagnosis and management, showed that the AON quality control procedure, using the MAD around the median, can be applied for datasets including qualitative values below LoD.

  4. Measurements of the Total Cross-Section Difference \\Delta\\sigma_{L}(np) at 1.39, 1.69, 1.89 and 1.99 GeV

    CERN Document Server

    Sharov V I

    2004-01-01

    New accurate results of the neutronvproton spin-dependent total cross-section difference \\Delta\\signa_{L}(np) at the neutron beam kinetic energies of 1.39, 1.69, 1.89 and 1.99 GeV are presented. In general these data complete the measurements of energy dependence of \\Delta\\signa_{L}(np) over the Dubna Synchrophasotron energy region. The quasi-monochromatic neutron beam was produced by break-up of extracted polarized deuterons. The deuteron (and hence neutron) polarization direction was flipped every accelerator burst. The neutron vertical direction of polarization was rotated onto the neutron beam direction and longitudinally (L) polarized neutrons were transmitted through the large proton L-polarized target. The longitudinal target polarization direction was inverted after 1-2 days of measurements. Four different combinations of the beam and target parallel and antiparallel polarization directions, both oriented along the neutron beam momentum, were used at each energy. A fast decrease of -\\Delta\\signa_{L}(n...

  5. Production and testing of the ENEA-Bologna VITJEFF32.BOLIB (JEFF-3.2) multi-group (199 n + 42 γ) cross section library in AMPX format for nuclear fission applications

    Science.gov (United States)

    Pescarini, Massimo; Orsi, Roberto; Frisoni, Manuela

    2017-09-01

    The ENEA-Bologna Nuclear Data Group produced the VITJEFF32.BOLIB multi-group coupled neutron/photon (199 n + 42 γ) cross section library in AMPX format, based on the OECD-NEA Data Bank JEFF-3.2 evaluated nuclear data library. VITJEFF32.BOLIB was conceived for nuclear fission applications as European counterpart of the ORNL VITAMIN-B7 similar library (ENDF/B-VII.0 data). VITJEFF32.BOLIB has the same neutron and photon energy group structure as the former ORNL VITAMIN-B6 reference library (ENDF/B-VI.3 data) and was produced using similar data processing methodologies, based on the LANL NJOY-2012.53 nuclear data processing system for the generation of the nuclide cross section data files in GENDF format. Then the ENEA-Bologna 2007 Revision of the ORNL SCAMPI nuclear data processing system was used for the conversion into the AMPX format. VITJEFF32.BOLIB contains processed cross section data files for 190 nuclides, obtained through the Bondarenko (f-factor) method for the treatment of neutron resonance self-shielding and temperature effects. Collapsed working libraries of self-shielded cross sections in FIDO-ANISN format, used by the deterministic transport codes of the ORNL DOORS system, can be generated from VITJEFF32.BOLIB through the cited SCAMPI version. This paper describes the methodology and specifications of the data processing performed and presents some results of the VITJEFF32.BOLIB validation.

  6. Production and testing of the ENEA-Bologna VITJEFF32.BOLIB (JEFF-3.2 multi-group (199 n + 42 γ cross section library in AMPX format for nuclear fission applications

    Directory of Open Access Journals (Sweden)

    Pescarini Massimo

    2017-01-01

    Full Text Available The ENEA-Bologna Nuclear Data Group produced the VITJEFF32.BOLIB multi-group coupled neutron/photon (199 n + 42 γ cross section library in AMPX format, based on the OECD-NEA Data Bank JEFF-3.2 evaluated nuclear data library. VITJEFF32.BOLIB was conceived for nuclear fission applications as European counterpart of the ORNL VITAMIN-B7 similar library (ENDF/B-VII.0 data. VITJEFF32.BOLIB has the same neutron and photon energy group structure as the former ORNL VITAMIN-B6 reference library (ENDF/B-VI.3 data and was produced using similar data processing methodologies, based on the LANL NJOY-2012.53 nuclear data processing system for the generation of the nuclide cross section data files in GENDF format. Then the ENEA-Bologna 2007 Revision of the ORNL SCAMPI nuclear data processing system was used for the conversion into the AMPX format. VITJEFF32.BOLIB contains processed cross section data files for 190 nuclides, obtained through the Bondarenko (f-factor method for the treatment of neutron resonance self-shielding and temperature effects. Collapsed working libraries of self-shielded cross sections in FIDO-ANISN format, used by the deterministic transport codes of the ORNL DOORS system, can be generated from VITJEFF32.BOLIB through the cited SCAMPI version. This paper describes the methodology and specifications of the data processing performed and presents some results of the VITJEFF32.BOLIB validation.

  7. 32 CFR 199.3 - Eligibility.

    Science.gov (United States)

    2010-07-01

    ... divorce, dissolution or annulment. To be eligible for CHAMPUS benefits, a former spouse must meet the... the final decree of divorce, dissolution, or annulment was before February 1, 1983, the former spouse... date of the final decree of the divorce, dissolution, or annulment was on or after February 1, 1983...

  8. 46 CFR 199.30 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... rooms, lounges, corridors, lavatories, cabins, offices, hospitals, cinemas, game and hobby rooms, and... last port of call in the country in which the voyage begins and the final port of destination, nor the return voyage, may exceed 600 miles. The final port of destination is the last port of call in the...

  9. 32 CFR 199.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... Osteopathy (D.O.). A practitioner of osteopathy, that is, a system of therapy based on the theory that the... Administration medical care facilities; or (v) Part C of the Individuals with Disabilities Education Act for.... For the purposes of this part, the term “handicap” is synonymous with the term “disability.” High-risk...

  10. 46 CFR 199.01 - Purpose.

    Science.gov (United States)

    2010-10-01

    ... that are subject to the International Convention for the Safety of Life at Sea, 1974, and its Protocol of 1978, as amended (SOLAS). (c) Subparts E and F of this part set out additional requirements, alternatives, and exemptions for vessels that are not subject to SOLAS. ...

  11. Publications | Page 199 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ASSIST Pakistan : Action to Stop Smoking In Suspected Tuberculosis in Pakistan; an intervention to stop tobacco use among patients suspected of TB - evaluation of an integrated approach (final technical report) (open access). There is a strong causal link between tobacco use and tuberculosis incidence. Almost 20% of ...

  12. 32 CFR 199.11 - Overpayments recovery.

    Science.gov (United States)

    2010-07-01

    ... administrative costs should be based upon cost analysis establishing an average of actual additional costs... TMA collection authority will consider the following factors: (i) Age and health of the debtor... federal law; (iii) Uncertainty as to the price which collateral or other property may bring at a forced...

  13. 32 CFR 199.8 - Double coverage.

    Science.gov (United States)

    2010-07-01

    ... from the operation of a motor vehicle. (4) Exceptions. Double coverage plans do not include: (i) Plans... (for example, the Indian Health Service); or (v) State Victims of Crime Compensation Programs. (c...

  14. 46 CFR 199.10 - Applicability.

    Science.gov (United States)

    2010-10-01

    ... GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) LIFESAVING APPLIANCES AND ARRANGEMENTS LIFESAVING... required by this chapter, it does not apply to offshore supply vessels; mobile offshore drilling units.... For purposes of the application of this part, a cargo vessel, whenever constructed, which is converted...

  15. 32 CFR 199.1 - General provisions.

    Science.gov (United States)

    2010-07-01

    ... information to providers of care, practitioners, professional societies, health industry organizations, fiscal... analyze program cost and utilization data appropriate for preparation of budgets, fiscal planning, and as...) Recommendations for change to part. The Director, OCHAMPUS, or a designee, shall establish procedures for...

  16. Publications | Page 199 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books ... Multi-faceted approach to promote knowledge translation platforms in eastern Mediterranean countries: climate for evidence-informed policy (open access). Objectives: ...

  17. 25 CFR 700.199 - Incidental expenses.

    Science.gov (United States)

    2010-04-01

    ... advertising charges, incurred incident to the purchase of the improvements owned by the head of household. (11... determined to be part of the debt service or finance charge under 15 U.S.C. 131-1641 and Regulation Z (12 CFR...

  18. 49 CFR 572.199 - Pelvis iliac.

    Science.gov (United States)

    2010-10-01

    ... specified in 49 CFR 572.200(d), and iliac wing load cell SA572-S66, mounted as shown in sheet 2 of 5 of... midsagittal plane, the thighs touch the seated surface, the inner part of the right and left legs at the knees... is parallel to the inferior-superior orientation of the spine box. (5) The midsagittal plane of the...

  19. 32 CFR 199.17 - TRICARE program.

    Science.gov (United States)

    2010-07-01

    ... skills sustainment activities, to the extent approved by the ASD(HA). (2) Non-MTF care for active duty... administrator of a program, or to provide administrative services in support of a program of instruction for the... promote the most cost-effective provision of services under the TRICARE program. (i) Health care finder...

  20. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  1. Yeast Interacting Proteins Database: YJL199C, YJL199C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available d in closely related Saccharomyces species; protein detected in large-scale protein-protein interaction studies...cies; protein detected in large-scale protein-protein interaction studies Rows with this prey as prey (4) Ro...n; not conserved in closely related Saccharomyces species; protein detected in large-scale protein-protein interaction studies... species; protein detected in large-scale protein-protein interaction studies Rows with this prey as prey Ro

  2. An immunohistochemical study of primary signet-ring cell carcinoma of the stomach and colorectum: III. Expressions of EMA, CEA, CA19-9, CDX-2, p53, Ki-67 antigen, TTF-1, vimentin, and p63 in normal mucosa and in 42 cases.

    Science.gov (United States)

    Terada, Tadashi

    2013-01-01

    There have no comprehensive immunohistochemical studies of primary signet ring cell carcinoma (SRCC) in the stomach and colorectum. The author examined the expression of nine common antigens (EMA, CEA, CA19-9, CDX-2, p53, Ki-67 antigen, TTF-1, vimentin, and p63) in the non-tumorous normal epithelium of the stomach and colorectum and in 42 cases of primary SRCC of the stomach (30 cases) and colorectum (12 cases). The normal epithelium of the stomach and colon consistently (100%) expressed EMA, CEA, CA19-9, CDX-2, and Ki-67 (labeling stomach and colorectum. The data indicated primary gastric SRCC frequently express EMA but not CDX-2 whereas primary colorectal SRCC frequently express CDX-2 but not EMA. These findings also suggest that EMA and CDX-2 are down-regulated during the gastric SRCC carcinogenesis. This down regulations may be associated with the malignant transformation of gastric SRCC. The data of colorectal SRCC suggest EMA is markedly down-regulated and also suggest that this EMA down-regulation may be associated with the carcinogenesis of colorectal SRCC. The expression pattern of EMA and CDX-2 may be useful in differential diagnosis between primary gastric SRCC and primary colorectal SRCC in the metastatic sites of SRCC.

  3. 32 CFR 199.14 - Provider reimbursement methods.

    Science.gov (United States)

    2010-07-01

    ... pediatric bone marrow transplants (patient under 18 at admission). (8) All services related to discharges... services related to discharges involving pediatric cystic fibrosis (patient under 18 at admission). (10... use in FY 2003. (C) Cost outliers for burn cases. All cost outliers for DRGs related to burn cases...

  4. 199__Galadanci_THE EFFECT OF RELATIVE HUMIDITY

    African Journals Online (AJOL)

    User

    seen that the data fitted the model very well. It can also be observe that the Kelvin radiiand Bulk hygroscopicity factors decrease with the increase in the water soluble concentrations. This is because by looking at equation (3), it can be observe that the. Kelvin radii is proportional to the surface tension and this implies ...

  5. Comprehensive multiplatform biomarker analysis of 199 anal squamous cell carcinomas.

    Science.gov (United States)

    Smaglo, Brandon G; Tesfaye, Anteneh; Halfdanarson, Thorvardur R; Meyer, Joshua E; Wang, Jue; Gatalica, Zoran; Reddy, Sandeep; Arguello, David; Boland, Patrick M

    2015-12-22

    Anal squamous cell carcinoma (ASCC) is a rare, HPV-associated malignancy typically diagnosed in early stages and definitively treated with chemoradiation. In situations where patients exhibit metastatic or recurrent disease, treatment options are severely limited. In this study, molecular alterations were identified that could be used to aid in therapeutic decisions for patients with metastatic or recurrent anal squamous cell carcinoma. Specimens from patients with this cancer were tested via a multiplatform profiling service (Caris Life Sciences, Phoenix, AZ) consisting of gene sequencing, protein expression by immunohistochemistry, and gene amplification with in situ hybridization. Utilizing these techniques, novel treatment strategies that could be explored were identified, including potential benefit with anti-EGFR therapies, immune checkpoint inhibitors, topoisomerase inhibitors, and taxanes. The frequency of overexpression of proteins that mark resistance to chemotherapeutic drugs, such as MRP1 (chemotherapy efflux pump), ERCC1 (resistance to platinum-based chemotherapy), and thymidylate synthase (resistance to fluoropyrimidines) were also identified, suggesting a lack of benefit. This multiplatform strategy could be explored for its potential to generate a personalized treatment selection for patients with advanced ASCC, provide a guide for future therapeutic development for this cancer, and be extended to other rare cancer types as well.

  6. 199.pdf | pjubileebook | splpubs | pubs | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Good Governance: Contribution of Vigilance · Vigilance Awareness Talk by K Jairaj, Former Additional Chief Secretary, Government of Karnataka. 17 November, 2017, 3:30 PM Auditorium, Raman Research Institute ...

  7. 199-IJBCS-Article-Prof A K Srivastav

    African Journals Online (AJOL)

    RHUMSIKI

    Stetson MH, Grau EG. 1999. Pesticide effects on prolactin release from the rostral pars distalis and their effects on growth in the tilapia. In Environmental. Toxicology and Risk Assessment: Standardization of Biomarkers for. Endocrine Disruption and Environmental. Assessment, 8th Volume, Henshel DS,. Black MC, Harrass ...

  8. 32 CFR 199.18 - Uniform HMO Benefit.

    Science.gov (United States)

    2010-07-01

    ... lead, rubella, cholesterol, fecal occult blood testing, and mammography; (ii) Pap smears; (iii) Eye... applies to family health services, home health care visits, eye examinations, and immunizations. It does... is a cost share of durable medical equipment, prosthetic devices, and other authorized supplies for...

  9. 46 CFR 199.70 - Personal lifesaving appliances.

    Science.gov (United States)

    2010-10-01

    ... that is— (A) At least as long as twice the height where it is stowed above the waterline with the... person smaller than the lower size limit of the adult-size lifejacket; and (ii) A sufficient number of..., alternative provisions must be made to the satisfaction of the OCMI that may include an increase in the number...

  10. 32 CFR 199.23 - Special Supplemental Food Program.

    Science.gov (United States)

    2010-07-01

    ... eligibility guidelines contained in USDA regulations, the Director, TRICARE Management Activity (TMA) may... WIC Overseas Program when local conditions preclude strict compliance or when such compliance is... scheduled nutrition education sessions. (e) Financial management. The Department shall establish procedures...

  11. 46 CFR 199.176 - Markings on lifesaving appliances.

    Science.gov (United States)

    2010-10-01

    ... plainly marked as follows: (1) Each side of each lifeboat and rescue boat bow must be marked in block... marked on the stern of the vessel to meet the requirements of subpart 67.123 of this chapter. (2) The number of persons for which the boast is equipped must be clearly marked, preferably on the bow, in...

  12. 32 CFR 199.24 - TRICARE Reserve Select.

    Science.gov (United States)

    2010-07-01

    ... annual changes in premiums for the Blue Cross and Blue Shield Standard Service Benefit Plan under the... 2005) were based on the Federal Blue Cross and Blue Shield annual premiums, with adjustments based on... has determined that in the administration of chapter 55 of title 10, U.S. Code, preemption of State...

  13. 32 CFR 199.10 - Appeal and hearing procedures.

    Science.gov (United States)

    2010-07-01

    ... methodology for determining allowable costs or charges is established by this part. (iii) The establishment of diagnosis-related groups (DRGs), or the methodology for the classification of inpatient discharges within... which evidence will be received. (iv) Questioning and admission of evidence. A hearing officer may...

  14. 32 CFR Appendix A to Part 199 - Acronyms

    Science.gov (United States)

    2010-07-01

    ... Renal Disease CT—Computerized Tomography DASD (A)—Deputy Assistant Secretary of Defense (Administration) D.D.S.—Doctor of Dental Surgery DEERS—Defense Enrollment Eligibility Reporting System DHHS—Department of Health and Human Services D.M.D.—Doctor of Dental Medicine DME—Durable Medical Equipment D.O...

  15. 26 CFR 1.199-3 - Domestic production gross receipts.

    Science.gov (United States)

    2010-04-01

    ... out of scrap, salvage, or junk material as well as from new or raw material by processing... United States or the airspace or space over the United States and these areas. (i) Derived from the lease...

  16. All projects related to | Page 199 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Project. Water scarcity and water-related vulnerability are widespread in the Indian sub-continent. Topic: WATER SHORTAGE, WATER QUALITY, MARGINALITY, POLICY MAKING, INDIA, PARTICIPATORY RESEARCH, INTERDISCIPLINARY RESEARCH, URBANIZATION. Region: India, Canada. Program: Climate Change.

  17. 46 CFR 199.180 - Training and drills.

    Science.gov (United States)

    2010-10-01

    .... Information cards or posters, or video programs displayed on the vessel video displays, may be used to... arrangements for those classes of vessels for which compliance with this paragraph is impracticable. (d...

  18. 199-IJBCS-Article-Prof A K Srivastav

    African Journals Online (AJOL)

    RHUMSIKI

    Srivastav et al.,. 1997, 2008; Singh ... fish were fed daily with wheat flour pellets and ground dried shrimps, 2-3 times per day. Water was renewed ... gland along with the brain was fixed in aqueous Bouin's fluid and Bouin's-Hollande fixatives. Tissues ...

  19. 49 CFR 199.227 - Retention of records.

    Science.gov (United States)

    2010-10-01

    ... to education and training: (i) Materials on alcohol misuse awareness, including a copy of the... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY DRUG AND ALCOHOL TESTING Alcohol Misuse... records of its alcohol misuse prevention program as provided in this section. The records shall be...

  20. A Case of State Survival: Macedonia in the 199Os

    National Research Council Canada - National Science Library

    Jones, Paul

    2000-01-01

    Macedonia confronted severe domestic and external threats during the 1990's. It survived largely due to a coherent national strategy and politicians and followed by the nationalist opposition after elections in 1998...

  1. 49 CFR 199.109 - Review of drug testing results.

    Science.gov (United States)

    2010-10-01

    ... affiliated with the operator. The choice of substance abuse professional and assignment of costs shall be... professional's private practice or to a person or organization from which the substance abuse professional... provided through: (1) A public agency, such as a State, county, or municipality; (2) The operator or a...

  2. 49 CFR 199.243 - Referral, evaluation, and treatment.

    Science.gov (United States)

    2010-10-01

    ... affiliated with the operator. The choice of substance abuse professional and assignment of costs shall be... professional's private practice or to a person or organization from which the substance abuse professional... through— (1) A public agency, such as a State, county, or municipality; (2) The operator or a person under...

  3. 15-199-tab3-et.xlsx

    Indian Academy of Sciences (India)

    Apache POI

    8, ACVR1, NM_001111067, 11. 9, DAG1, NM_001165928, 6. 10, CAV3, NM_001234, 3. 11, POMGNT1, NM_001243766, 23. 12, CNTN1, NM_001843, 24. 13, CRYAB, NM_001885, 4. 14, LAMP2, NM_002294, 9. 15, TCAP, NM_003673, 2. 16, DMD, NM_004006, 79. 17, LARGE, NM_004737, 16. 18, MSTN, NM_005259, 3.

  4. 32 CFR 199.4 - Basic program benefits.

    Science.gov (United States)

    2010-07-01

    ... Statements within a 40-mile catchment area. In some geographic locations, it is necessary for CHAMPUS... information whether or not he or she resides in a geographic area that requires obtaining a Nonavailability... thinking. (ii) Emergency admissions. Admission to an acute inpatient hospital setting may be on an...

  5. 26 CFR 1.199-0 - Table of contents.

    Science.gov (United States)

    2010-04-01

    ... reported on return filed with the Social Security Administration. (i) In general. (ii) Corrected return... or bona fide selling prices. (5) Rules applicable to inventories accounted for under the last-in... production activities income and taxable income. (d) Special rule for marketing cooperatives. (e) Qualified...

  6. 26 CFR 1.199-2 - Wage limitation.

    Science.gov (United States)

    2010-04-01

    ... that W-2 wages must have been included in a return filed with the Social Security Administration (SSA... wages must be reported on return filed with the Social Security Administration—(i) In general. The term... selling expenses that are not includible in CGS and are definitely related to all of X's gross income. For...

  7. 32 CFR 199.21 - Pharmacy benefits program.

    Science.gov (United States)

    2010-07-01

    ... of Columbia, Guam, Puerto Rico, and the Virgin Islands. In addition, if authorized by the Assistant... and the District of Columbia, Guam, Puerto Rico, and the Virgin Islands. In such case, the Assistant... vaccines/immunizations. This paragraph (h)(4) applies to the following three immunizations: H1N1 vaccine...

  8. People’s Republic of China Scientific Abstracts, Number 199.

    Science.gov (United States)

    1978-09-06

    lithotomy, nephrectomy, etc. to treat ure- teral lithiasis , renal lithiasis , chyluria, etc. was adopted in 31 sargical cases. This paper introduces...abdominal pain and nausea and vomiting; at night she gave birth to her first baby. Abdominal pain , vomiting, and shortness of breath continued, however. On

  9. Catalog of 199 register-based definitions of chronic conditions

    DEFF Research Database (Denmark)

    Hvidberg, Michael F; Johnsen, Søren P; Glümer, Charlotte

    2016-01-01

    INTRODUCTION: The aim of the current study was to present and discuss a broad range of register-based definitions of chronic conditions for use in register research, as well as the challenges and pitfalls when defining chronic conditions by the use of registers. MATERIALS AND METHODS: The definit......INTRODUCTION: The aim of the current study was to present and discuss a broad range of register-based definitions of chronic conditions for use in register research, as well as the challenges and pitfalls when defining chronic conditions by the use of registers. MATERIALS AND METHODS......: The definitions were defined based on information from nationwide Danish public healthcare registers. Medical and epidemiological specialists identified and grouped relevant diagnosis codes that covered chronic conditions, using the International Classification System version 10 (ICD-10). Where relevant...... definitions were proposed based on record linkage between multiple registers, including registers of prescribed drugs and use of general practitioners' services. CONCLUSIONS THIS STUDY PROVIDED A CATALOG OF REGISTER-BASED DEFINITIONS FOR CHRONIC CONDITIONS FOR USE IN HEALTHCARE PLANNING AND RESEARCH, WHICH IS...

  10. Southern Forests: a Journal of Forest Science - Vol 199 (2003)

    African Journals Online (AJOL)

    Killing Eucalyptus grandis cut stumps after multiple coppice rotations in the KwaZulu-Natal midlands, South Africa: scientific paper · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Keith M Little, 7-14. Effects of site management operations on the nutrient capital of a eucalypt ...

  11. 32 CFR 199.13 - TRICARE Dental Program.

    Science.gov (United States)

    2010-07-01

    ... includes a standard and acceptable business practice commonly used among dental insurers which is... of Dental Surgery (D.D.S.) who is licensed to practice dentistry by an appropriate authority. (11... authorized to furnish care under laws of that particular country. (23) Restorative services. Restoration of...

  12. 1935 15' Quad #199 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  13. 32 CFR 199.7 - Claims submission, review, and payment.

    Science.gov (United States)

    2010-07-01

    ... determinations. (B) Administrative error. Administrative error (that is, misrepresentation, mistake, or other... sponsor for any difference between the CHAMPUS-determined charge or cost and the amount billed is acting... of certain cost-shares and other portions of a provider's billed charges. Other differences may occur...

  14. Printed in Ethiopia © 199': Chemical Society of Ethiopia

    African Journals Online (AJOL)

    Vicete and Bruckenstein [9] found in their investigations that Cl“ ion enhances the adsorption of Pb on Au. In the absence of Cl' the monolayer cathodic peak is sharper, although it was slightly shifted to more negative potentials, as expected for competitive adsorption by an anion. Studies of adsorption of Cl', Br", and I ions at ...

  15. 15-199-tab4-et.xlsx

    Indian Academy of Sciences (India)

    Apache POI

    53. 54. 55, Genes with bad coverage : 90%, Exon(s) with coverage < 90%, Exon(s) no covered (0%). 57, KCNQ1, NM_000218, 16, 82.96, 1 5 16. 58, KCNH2, NM_000238, 15, 59.6, 2, 1 4 5 7 8 9 11 12 13 15 ...

  16. 32 CFR 199.22 - TRICARE Retiree Dental Program (TRDP).

    Science.gov (United States)

    2010-07-01

    ...) Pulp capping. (B) Pulpotomy and pulpectomy. (C) Root canal therapy. (D) Apexification and... services. (A) Palliative (emergenery) treatment of dental pain. (B) Therapeutic drug injection. (C) Other...

  17. 32 CFR 199.6 - TRICARE-authorized providers.

    Science.gov (United States)

    2010-07-01

    ... in which a potential for personal gain exists or in which there is an appearance of impropriety or..., public health, hospital administration, nursing, social work, or psychology, or meeting similar..., safety, confidentiality, informed consent, grievances, and personal dignity. (ii) The facility has a...

  18. Publications | Page 199 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  19. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  20. Sucrose-aided combustion synthesis of nanosized LiMn{sub 1.99-y}Li{sub y}M{sub 0.01}O{sub 4} (M = Al{sup 3+}, Ni{sup 2+}, Cr{sup 3+}, Co{sup 3+}, y = 0.01 and 0.06) spinels. Characterization and electrochemical behavior at 25 and at 55 C in rechargeable lithium cells

    Energy Technology Data Exchange (ETDEWEB)

    Amarilla, J.M.; Pico, F.; Rojo, J.M.; Rojas, R.M. [Instituto de Ciencia de Materiales de Madrid, Consejo Superior de Investigaciones Cientificas (CSIC), Sor Juana Ines de la Cruz no. 3, Cantoblanco, 28049 Madrid (Spain); Petrov, K.; Avdeev, G. [Institute of General and Inorganic Chemistry, Bulgarian Academy of Sciences, 1113 Sofia (Bulgaria)

    2009-06-15

    Doubly doped LiMn{sub 1.99-y}Li{sub y}M{sub 0.01}O{sub 4} (M = Al{sup 3+}, Ni{sup 2+}, Cr{sup 3+}, Co{sup 3+}; y = 0.01 and 0.06) spinels have been synthesized by the sucrose-aided combustion method. Combined TG/DTA and XRD studies have shown that stoichiometric single-phase spinels are formed after annealing of the samples at 700 C for 1 h. The samples obtained are nanocrystalline materials having a narrow size-distribution and a coherent domain size between 40 and 60 nm, depending on the amount of fuel (sucrose) used in the synthesis. The influence of the Li-excess, the type of M{sup n+}-dopant cation and the amount of fuel used in the synthesis on the electrochemical behavior of the spinels in a Li-cell at room and at elevated temperature (55 C) has been studied. At 25 C all the spinels synthesized have a good capacity retention after 100 cycles, QRt-100 > 92%. At 55 C the increase of the Li-excess improves the cycling performances. Rate capability studies show that the spinels retain >90% of their capacity even at 5C rate. The synergic effect of the Li-excess and the particle size on the electrochemical properties of the spinels as cathode material has been settled. The LiMn{sub 1.93}Li{sub 0.06}M{sub 0.01}O{sub 4}, (M = Al{sup 3+}, Ni{sup 2+}) spinels, with cyclabilities >99.9% by cycle at both 25 and 55 C, and high rate capabilities, are the ones that show the best electrochemical properties. (author)

  1. The application of 199Hg NMR and 199mHg perturbed angular correlation (PAC) spectroscopy to define the biological chemistry of HgII

    DEFF Research Database (Denmark)

    Iranzo, Olga; Thulstrup, Peter Waaben; Ryu, Seung-baek

    2007-01-01

    The use of de novo designed peptides is a powerful strategy to elucidate HgII-protein interactions and to gain insight into the chemistry of HgII in biological systems. Cysteine derivatives of the designed -helical peptides of the TRI family [Ac-G-(LaKbAcLdEeEfKg)4-G-NH2] bind HgII at high p...

  2. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  3. 74-----------------------------~-------------RE-SONANCEIJan-ua-rY-1-99-S

    Indian Academy of Sciences (India)

    1997-05-08

    May 8, 1997 ... Less Brain, Less Brawn: A. New Evolutionary View of. Man. JA Santosh. 6ne familiar and common depiction of man's evolution can be found in abundance and in a variety of places from textbooks to popular media. This is an illustration portraying the profiles of a group of hominids moving along.

  4. Bifunctional chelates of RH-105 and AU199 as potential radiotherapeutic agents

    Energy Technology Data Exchange (ETDEWEB)

    Droege, P.

    1997-03-01

    Research is presented on new bifunctional chelating ligand systems with stability on the macroscopic and radiochemical levels. The synthesis of the following complexes are described: rhodium 105, palladium 109, and gold 198.

  5. http://www.economistascoruna.org/eawp/eawp.asp?qsa=ES&qsb=1&qsc=191&qsd=199

    Directory of Open Access Journals (Sweden)

    Martín Montalva Paredes

    2007-04-01

    Full Text Available Las Tecnologías de Información y Comunicaciones (TIC´s están redefiniendo parte de los patrones conductuales que regulan la interacción social. El tiempo y el espacio han dejado de ser un límite en el accionar tanto de las personas, empresas y gobiernos. A nivel mundial la brecha entre los países desarrollados y en vías de desarrollo se ha ampliado en los últimos años, debido en gran parte a la masificación del uso de tecnologías. En empresas TIC´s, específicamente empresas desarrolladoras de software, tanto chilenas como canadienses, se verificó el uso que hacen éstas del Marketing Estratégico como una herramienta competitiva, a la hora de planificar la operación y continuidad.

  6. Statistical Abstract of Higher Education in North Carolina, 1998-99. Research Report 1-99.

    Science.gov (United States)

    Balfour, Linda F.

    This report presents comprehensive data on higher education activities in North Carolina in 84 tables and 17 graphs. Data were compiled from forms completed by the individual institutions in the summer and fall of 1998. Data are usually presented separately for individual institutions by institution type public institutions, private institutions,…

  7. 26 CFR 1.199-1 - Income attributable to domestic production activities.

    Science.gov (United States)

    2010-04-01

    ... management or other business purposes; whether the method is used for other Federal or state income tax... manufactures automobiles within the United States and sells 5-year extended warranties to customers. The sales price of the warranty is based on historical data that determines what repairs and services are...

  8. Reversible high blood CEA and CA19-9 concentrations in a diabetic ...

    African Journals Online (AJOL)

    screening (1). Pancreatic cancer may cause diabetes by destroying islet cells, inducing pancreas inflammation, or causing peripheral resistance to insulin. ... with diabetes. The histology of pancreatic islets from type 2 diabetic patients was known to be associated with an inflammatory process, which also involved the ...

  9. 46 CFR 199.175 - Survival craft and rescue boat equipment.

    Science.gov (United States)

    2010-10-01

    ... must be capable of being used at each entrance on either side or at the stern of the boat to enable... the bow of the lifeboat, ready for use. On lifeboats to be launched by free-fall launching, both painters must be stowed near the bow ready for use. (A) If the painter is of synthetic material, the...

  10. 96------------------------------~~------------R-ES-ONANCE--IMa-rc-h--19-9-S

    Indian Academy of Sciences (India)

    Conserving Biodiversity for. Sustainable Development. P S Ramakrishnan, A K Das and. KG Saxena. INSA, New Delhi. 1996. Microprocessor and its Applications. R Thiagarajan, S Dhanasekaran and S Dhanapal. New Age International. 1997, Rs.175. Statement about ownership and other particulars of. Resonance ...

  11. 199 An X-Ray of the Level of Electronic Purse Usage in Nigeria (Pp ...

    African Journals Online (AJOL)

    User

    2010-06-10

    Jun 10, 2010 ... An International Multidisciplinary Journal, Ethiopia. Vol. 5 (6), Serial No. 23, November .... this customer inertia towards e-purse acceptance and usage cannot be without reasons. This paper therefore .... also transaction related benefits like speed, efficiency, accessibility, etc. Wu et al., (2006) argues that to ...

  12. miR-199a-3p displays tumor suppressor functions in papillary thyroid carcinoma

    National Research Council Canada - National Science Library

    Minna, Emanuela; Romeo, Paola; De Cecco, Loris; Dugo, Matteo; Cassinelli, Giuliana; Pilotti, Silvana; Degl'Innocenti, Debora; Lanzi, Cinzia; Casalini, Patrizia; Pierotti, Marco A; Greco, Angela; Borrello, Maria Grazia

    2014-01-01

    Thyroid cancer incidence is rapidly increasing. Papillary Thyroid Carcinoma (PTC), the most frequent hystotype, usually displays good prognosis, but no effective therapeutic options are available for the fraction of progressive PTC patients...

  13. NATO Strategy in the 199Os: Reaping the Peace Dividend or the Whirlwind?

    Science.gov (United States)

    1995-05-25

    difference is that the collapse of communism and the Warsaw Pact now makes it possible for NATO to exercise its security functions outside NATO territory...NATO headquarters. Such activities include but are not limited to peacekeeping exercises , increased transparency of defense budgets, democratic...34Pressure on NATO to Expand," The New York Times, February 8, 1995, p. A11; and Congressman Robert G. Torricelli , "A Promise Best Not Kept," Los Angeles

  14. 26 CFR 1.199-4 - Costs allocable to domestic production gross receipts.

    Science.gov (United States)

    2010-04-01

    .... Use of standard cost method. X, a calendar year taxpayer, manufactures item A in a factory located in the United States and item B in a factory located in Country Y. Item A is produced by X within the... engaged in the trade or business of farming that is not required to use the accrual method of accounting...

  15. Proposal of a community oral health indicator - doi:10.5020/18061230.2007.p199

    Directory of Open Access Journals (Sweden)

    Maria Vieira de Lima Saintrain

    2012-01-01

    Full Text Available The execution of public policies, which attain the reduction of the iniquities in oral health, requires, from managers of Brazil’s Health Unified System (SUS, a planning of simplified actions with universal reach, as well as the participation of social actors who are involved in this process. The Community Oral Health Indicator – ICSB aims at consisting in “new technology” in order to obtain data in an easy and simple way that can be able to provide agility to planning organization towards the equity, as well as improving the population’s oral health condition. As a strategy, involving the community health agent (ACS from the Family Health Program (PSF, the tool (ICSB was developed to survey the data on oral health epidemiological status of the population. The methodological design consists, initially, in a training workshop with the ACS and a posterior data survey along the population. The dentists involved in the project will be the preceptors of the training workshop for the ACS, in what concerns the identification of oral health problems and their degree of severity. According to the need of treatment, the dentist will develop oral health actions based on the principle of equity.

  16. 47 CFR 87.199 - Special requirements for 406.0-406.1 MHz ELTs.

    Science.gov (United States)

    2010-10-01

    ... Emergency Locator Transmitters (ELT)” Document No. RTCA/DO-204 dated September 29, 1989. This RTCA document...-406.1 MHz ELT must contain as an integral part a homing beacon operating only on 121.500 MHz that...-406.1 MHz ELT, the ELT must be certified by a test facility recognized by one of the COSPAS/SARSAT...

  17. 32 CFR 199.15 - Quality and utilization review peer review organization program.

    Science.gov (United States)

    2010-07-01

    ... Peer Review Organization program is distinguishable in purpose and impact from other activities... method, nature of care, or other potential utilization or quality issue. (3) Peer review activities by... an MTF reserves authority to separate an MTF determination on medical necessity from a CHAMPUS PRO...

  18. Nosotros y otros en manuales escolares de geografía de Colombia (1970-199

    Directory of Open Access Journals (Sweden)

    Patricia Cerón Rengifo

    2012-08-01

    Full Text Available Con el propósito de examinar la identificación de la población hecha en los manuales escolares de las ciencias sociales, se realizó un estudio sobre las construcciones del nosotros y los otros, en una muestra de manuales escolares de geografía de Colombia, destinados a la educación secundaria y publicados entre 1970-1990. Se trabajó con herramientas metodológicas propuestas por Van Dijk (2008 y Wodak (2003, para estudiar el discurso ideológico de identidad de los grupos sociales, a partir del seguimiento a la representación positiva del nosotros y negativa de los otros. Se encontró el fomento de una identidad nacional homogénea culturalmente, y una clasificación jerarquizada de la población mediante categorías basadas en la idea de raza, la posición social y el territorio. El gobierno y las élites, conformadas por blancos, urbanos y ricos que habitan el altiplano cundi-boyacense, son denominados como el nosotros y representados en forma positiva, mientras la población categorizada como campesino, pueblo, indio, negro, mulato, zambo, es delimitada como los otros y se representa negativamente.

  19. 32 CFR 199.16 - Supplemental Health Care Program for active duty members.

    Science.gov (United States)

    2010-07-01

    ... manager. In the absence of a TRICARE primary care manager in the remote location and if the active duty member is not assigned to a military primary care manager based on fitness for duty requirements, the... 32 National Defense 2 2010-07-01 2010-07-01 false Supplemental Health Care Program for active duty...

  20. Page 1 The New Physiology of Vision-XV 199 reason of light in the ...

    Indian Academy of Sciences (India)

    dent on the retina. On the other hand, the orange and the red sectors of the spectrum are responsible for the luminosity appearing in the outer parts of the field. Filters of Disulphine Blue P.S.-Five filters were prepared with this commercially available dye-stuff. The first two gave a complete extinction of the yellow region of the ...

  1. http://www.economistascoruna.org/eawp/eawp.asp?qsa=ES&qsb=1&qsc=191&qsd=199

    OpenAIRE

    Martín Montalva Paredes

    2007-01-01

    Las Tecnologías de Información y Comunicaciones (TIC´s) están redefiniendo parte de los patrones conductuales que regulan la interacción social. El tiempo y el espacio han dejado de ser un límite en el accionar tanto de las personas, empresas y gobiernos. A nivel mundial la brecha entre los países desarrollados y en vías de desarrollo se ha ampliado en los últimos años, debido en gran parte a la masificación del uso de tecnologías. En empresas TIC´s, específicamente empresas desarrolladoras d...

  2. : tous les projets | Page 199 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Projet. Chaque année, en Argentine, les maladies cardiovasculaires causent environ 100 000 décès et 250 000 accidents cardiovasculaires, qui coûtent au pays plus de 1 milliard CAD. Date de début : 21 février 2012. End Date: 14 mars 2015. Sujet: NUTRITION POLICY, SODIUM, Disease control, FATS, FOOD INDUSTRY ...

  3. Yeast Interacting Proteins Database: YML064C, YJL199C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available y related Saccharomyces species; protein detected in large-scale protein-protein interaction studies Rows wi...in-protein interaction studies Rows with this prey as prey (4) Rows with this prey as bait (1) 28 6 3 4 0 0 ...d in closely related Saccharomyces species; protein detected in large-scale prote

  4. Yeast Interacting Proteins Database: YNL189W, YJL199C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available tein; not conserved in closely related Saccharomyces species; protein detected in large-scale protein-protein interaction studies...myces species; protein detected in large-scale protein-protein interaction studies Rows with this prey as pr

  5. Yeast Interacting Proteins Database: YLR291C, YJL199C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ved in closely related Saccharomyces species; protein detected in large-scale protein-protein interaction studies...in large-scale protein-protein interaction studies Rows with this prey as prey Rows with this prey as prey (

  6. 46 CFR 199.280 - Survival craft embarkation and launching arrangements.

    Science.gov (United States)

    2010-10-01

    ... APPLIANCES AND ARRANGEMENTS LIFESAVING SYSTEMS FOR CERTAIN INSPECTED VESSELS Additional Requirements for... from Ships, 1973, as amended by the Protocol of 1978 (MARPOL 73/78), in the case of an oil tanker; (2... Bulk, in the case of a chemical tanker; or (3) The International Code for the Construction and...

  7. 32 CFR 199.20 - Continued Health Care Benefit Program (CHCBP).

    Science.gov (United States)

    2010-07-01

    ... Privilege Card”; (iii) A front and back copy of a DD Form 1173, “Uniformed Services Identification and... under 10 U.S.C. 1145(a)) ends. (e) CHCBP benefits—(1) In general. Except as provided in paragraph (e)(2... continuation health care benefit for the Department of Defense and the other Uniformed Services (e.g., NOAA...

  8. 46 CFR 199.190 - Operational readiness, maintenance, and inspection of lifesaving equipment.

    Science.gov (United States)

    2010-10-01

    ... motor fitted to a rescue boat would not allow the outboard motor to be run other than with its propeller...) Servicing of inflatable lifesaving appliances, inflated rescue boats, and marine evacuation systems. (1) Each inflatable lifesaving appliance and marine evacuation system must be serviced— (i) Within 12...

  9. 199 bacteriological quality of water used for ice making in some ...

    African Journals Online (AJOL)

    DR. AMINU

    2010-06-01

    Correspondence author. ABSTRACT. A study was carried out on the bacterial counts .... sterilization process rather a set of conditions that may stop the multiplication of microorganisms (Refai,. 1979). So, microbial load of water ...

  10. 46 CFR 199.630 - Alternatives for passenger vessels in a specified service.

    Science.gov (United States)

    2010-10-01

    ...; and (iv) Environmental factors. (2) A comprehensive shipboard safety management and contingency plan that is tailored to the particular vessel, is easy to use, is understood by vessel management personnel... communications on board the vessel and with shoreside contacts; and (vi) Guidance on theoretical, practical, and...

  11. 49 CFR 199.111 - Retention of samples and additional testing.

    Science.gov (United States)

    2010-10-01

    ... the employee according to DOT Procedures, the split specimen must be tested. The employee may specify... laboratory must follow approved chain-of-custody procedures in transferring a portion of the sample. (d...

  12. FCJ-199 Modelling Systemic Racism: Mobilising the Dynamics of Race and Games in Everyday Racism

    Directory of Open Access Journals (Sweden)

    Robbie Fordyce

    2016-03-01

    Full Text Available This article is concerned with attempts to pose videogames as solutions to systemic racism. The mobile app, Everyday Racism, is one such game. Its method is to directly address players as subjects of racism interpellating them as victims of racist language and behaviour within Australian society, implicating the impact of racism on mental health and wellbeing. While the game has politically laudable goals, its effectiveness is undermined by several issues themselves attributable to the dynamics of race and games. This paper will spell out those issues by addressing three separate facets of the game: the problematic relationship between the player and their elected avatar; the pedagogic compromises that are made in modelling racism as a game; finally, the superliminal narrative that attempts to transcend the limited diegetic world of the game.

  13. 9 CFR 381.199 - Inspection of poultry products offered for entry.

    Science.gov (United States)

    2010-01-01

    ..., DEPARTMENT OF AGRICULTURE AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION POULTRY PRODUCTS INSPECTION REGULATIONS Imported Poultry... poultry products offered for entry from any foreign country shall be reinspected by a Program import...

  14. 46 CFR 199.620 - Alternatives for all vessels in a specified service.

    Science.gov (United States)

    2010-10-01

    ... 2 2 21 Painter 2 1 1 1 1 1 1 1 1 23 Pump 6 1 1 1 26 Repair kit 6 1 1 1 27 Sea anchor 1 2 1 28...) Inflatable liferaft equipment. As an alternative to the SOLAS A Pack, vessels may have a SOLAS B Pack for...

  15. 199 An X-Ray of the Level of Electronic Purse Usage in Nigeria (Pp ...

    African Journals Online (AJOL)

    User

    2010-06-10

    Jun 10, 2010 ... Thornton, J. and White, L. (2001) Customer Orientation and Usage of Financial. Distribution Channels, Journal of Services Marketing, 15(3), pp. 168-185. Vanguard (2002) Nigeria: Banks Urged to Support E-Purse, July 12, 2002. Retrieved July. 10, 2011 from http://allafrica.com/stories/200207120219.html).

  16. 32 CFR 199.9 - Administrative remedies for fraud, abuse, and conflict of interest.

    Science.gov (United States)

    2010-07-01

    ..., other enterprises, or the personal expenses of principals, or (iv) billing or submitting claim on a fee-for-service basis when in fact a personal service to a specific patient was not performed and the... psychology when the degree is not from a regionally accredited university. (10) Reciprocal billing. Billing...

  17. 199 Multiple Concussions in Young Athletes: Identifying Patients at Risk for Repeat Injury.

    Science.gov (United States)

    Murphy, Meghan; McCutcheon, Brandon A; Kerezoudis, Panagiotis; Rinaldo, Lorenzo; Shepherd, Daniel Levi; Maloney, Patrick R; Gates, Marcus J; Bydon, Mohamad

    2016-08-01

    Concussion diagnosis and management is a topic of interest for health care, education, and government professionals. Given the evidence concerning the association of long-term effects and cumulative insult of multiple concussions, we sought to identify risk factors in young athletes for repeat injury. This study is a retrospective cohort analysis of our institution's series of pediatric sports related concussions. Patient demographics, characteristics, and clinical features of concussion were analyzed in an unadjusted fashion. Bivariate analysis examined these variables in relation to occurrence of subsequent concussion. Multivariable analysis was then used to evaluate for predictors of repeat injury. One hundred ninety-one patients with a mean age of 13.5 years were included for analysis. Relative to patients whose injury was associated with football, patients playing soccer (odds ratio [OR], 5.36; 95% confidence interval [CI], 1.18-24.5), ice hockey/skating (OR, 6.97; 95% CI, 1.60-30.37), and basketball (OR, 5.99; 95% CI, 1.23-29.07) were associated with a significant increased odds of having a subsequent concussion. History of prior concussion was also significantly associated with an increased odds of repeat injury following the index concussion, defined as the first concussion evaluated at our institution (OR, 12.54; 95% CI, 3.78-41.62). Relative to a concussion resulting from a mechanism involving blunt force to the head, patients with a concussion in the setting of a fall were significantly less likely to experience a subsequent concussion (OR, 0.19; 95% CI, 0.05-0.71). Efforts to protect young athletes are of immeasurable value given the potential life years at risk for productivity and quality of life. With the identification of specific sports, prior injury, and mechanism influencing risk of repeat injury, clinicians are more informed to assess and discuss both risk and potential consequences of concussions with young athletes and their families.

  18. 32 CFR 199.5 - TRICARE Extended Care Health Option (ECHO).

    Science.gov (United States)

    2010-07-01

    ... skills that are necessary for the management of the qualifying condition. Such training is also... following the death of a beneficiary or as of the effective date of a beneficiary's loss of ECHO eligibility..., transportation to and from such institutions and facilities. (1) An administrator or designee of a public...

  19. Tank 241-BY-101, cores 189 and 199 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Nuzum, J.L.

    1997-09-25

    This document is the final laboratory report for Tank 241-BY-101. Push mode core segments were removed from Pisers 10B and 10D between May 27, 1997, and June 1, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-.BY-101 Push Core Sampling and analysis Plan (TSAP) and Tank Safety Screening Data Quality Objective (DQO). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DSC) analysis exceeded the notification limits as stated in TSAP and DQO, The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems (TWRS) Technical Basis Group, and are not considered in this report. Near Infrared Spectroscopy (NIR) analysis was requested in order to compare NIR results with those obtained from percent water gravimetry analysis (%H20) and thermal gravimetric analysis (TGA). The TWRS Technical Basis Group rescinded the request for this analysis, and neither NIR nor %H20 analyses were performed.

  20. 199 Caractérisation physico-chimique des eaux usées d'abattoir en ...

    African Journals Online (AJOL)

    AKA BOKO

    [39] Metcalf et Eddy, INC. “Wastewater engineering: Traetment, Disposal and Reuse”. 3ème Edition Library of Congress Cataloging in publication data. (1991) D. 645. T34. [40] R. Hamdaoui. « Caractérisation physico-chimique et traitment des eaux usées résiduaires de la socièté SETEXAME. Kénitra ». Mémoire DESA.

  1. 199. Lesión de conducto torácico en drenaje venoso anómalo

    Directory of Open Access Journals (Sweden)

    F.J. Carrero Gómez

    2010-01-01

    Full Text Available Paciente de 16 años con el diagnóstico de comunicación interauricular (CIA tipo seno venoso con drenaje venoso anómalo es intervenida en nuestro centro, interponiendo parche de pericardio autólogo sobre el orificio de la CIA de 3 x 2 mm, excluyendo la aurícula derecha (AD y recanalizando el drenaje de la vena pulmonar superior derecha hacia la aurícula izquierda. Para cerrar la auriculotomía derecha se interpone un neotecho con pericardio autólogo. La paciente presentó quilotórax en el postoperatorio, por lo que hubo que reintervenirla para subsanar el problema. La dificultad de esta cirugía radica en diagnosticar mediante pruebas de imagen la localización del conducto torácico, siendo el conocimiento anatómico de su recorrido fundamental para el abordaje quirúrgico.

  2. Fully relativistic coupled cluster and DFT study of electric field gradients at Hg in 199Hg compounds

    DEFF Research Database (Denmark)

    Arcisauskaité, Vaida; Knecht, Stefan; Sauer, Stephan P. A.

    2012-01-01

    We investigate the magnitude and interplay of relativistic and electron correlation effects on the electric field gradient (EFG) at the position of Hg in linear and bent HgL2 (L=CH3, Cl, Br, I) and trigonal planar [HgCl3]- complexes using four-component relativistic Dirac-Coulomb (DC) and non...

  3. 1,3-Propanediol production by Klebsiella oxytoca NRRL-B199 from glycerol. Medium composition and operational conditions

    Directory of Open Access Journals (Sweden)

    Mateusz Wojtusik

    2015-06-01

    Under the best operating conditions, i.e., a programmed variable stirring rate ranging from 50 to 100 rpm and a temperature of 37 °C, a final concentration of 13.5 g/L of 1,3-propanediol with a selectivity of 86% with respect to the glycerol consumed was obtained.

  4. SU-E-J-199: Evaluation of Motion Tracking Effects On Stereotactic Body Radiotherapy of Abdominal Targets

    Energy Technology Data Exchange (ETDEWEB)

    Monterroso, M; Dogan, N; Yang, Y [University Miami, Miami, FL (United States)

    2014-06-01

    Purpose: To evaluate the effects of respiratory motion on the delivered dose distribution of CyberKnife motion tracking-based stereotactic body radiotherapy (SBRT) of abdominal targets. Methods: Four patients (two pancreas and two liver, and all with 4DCT scans) were retrospectively evaluated. A plan (3D plan) using CyberKnife Synchrony was optimized on the end-exhale phase in the CyberKnife's MultiPlan treatment planning system (TPS), with 40Gy prescribed in 5 fractions. A 4D plan was then created following the 4D planning utility in the MultiPlan TPS, by recalculating dose from the 3D plan beams on all 4DCT phases, with the same prescribed isodose line. The other seven phases of the 4DCT were then deformably registered to the end-exhale phase for 4D dose summation. Doses to the target and organs at risk (OAR) were compared between 3D and 4D plans for each patient. The mean and maximum doses to duodenum, liver, spinal cord and kidneys, and doses to 5cc of duodenum, 700cc of liver, 0.25cc of spinal cord and 200cc of kidneys were used. Results: Target coverage in the 4D plans was about 1% higher for two patients and about 9% lower in the other two. OAR dose differences between 3D and 4D varied among structures, with doses as much as 8.26Gy lower or as much as 5.41Gy higher observed in the 4D plans. Conclusion: The delivered dose can be significantly different from the planned dose for both the target and OAR close to the target, which is caused by the relative geometry change while the beams chase the moving target. Studies will be performed on more patients in the future. The differences of motion tracking versus passive motion management with the use of internal target volumes will also be investigated.

  5. 15 CFR 19.9 - When will Commerce entities transfer a Commerce debt to the Treasury Department's Financial...

    Science.gov (United States)

    2010-01-01

    ... administrative and tax refund offset. See 31 CFR 285.12(g). The Treasury Offset Program is a centralized offset... services, a process known as “cross-servicing.” See 31 U.S.C. 3711(g) and 31 CFR 285.12. Commerce entities... of the Commerce debt to credit bureaus, and administrative wage garnishment. (b) At least sixty (60...

  6. 76 FR 199 - Self-Regulatory Organizations; NYSE Arca, Inc.; Order Granting Approval of Proposed Rule Change...

    Science.gov (United States)

    2011-01-03

    ... Relating to the Listing and Trading of the ProShares VIX Short-Term Futures ETF and the ProShares VIX Mid-Term Futures ETF December 27, 2010. I. Introduction On November 5, 2010, NYSE Arca, Inc. (``Exchange... and trade shares (``Shares'') of the ProShares VIX Short-Term Futures ETF and the ProShares VIX Mid...

  7. Assessment of quality of life related to health in patients with fibromyalgia - doi:10.5020/18061230.2010.p199

    Directory of Open Access Journals (Sweden)

    Ana Maria Martín Nogueras

    2012-01-01

    Full Text Available Objectives: To determine the impact that fibromyalgia (FM has on quality of life; to compare the quality of life of patients with fibromyalgia with the healthy Spanish population and to know the correlation and sensibility of two instruments of quality of life in FM. Method: A cross-sectional and observational study. Twenty-seven subjects joined in (25 women and 2 men with a mean age of 50.5 years (SD 7.9, belonging to the Salmantina Association of Fibromyalgia and Chronic Fatigue. The Spanish versions of the Nottingham Health Profile (NHP and the the Short-Form 36 (SF36 were used to study quality of life. Results: High scores were obtained in the “Energy”, “Pain”, “Sleep” and “Physical mobility” dimensions of the NHP and low scores in the “Physical problems”, “Pain”, “Vitality” and “General health perception” dimensions of the SF-36. Statistical significant differences were found in all dimensions comparing to the healthy Spanish population. The following dimensions were negatively statistically correlated: “Energy”(NHP-“Vitality” (SF-36; “Pain”(NHP- “Physical function”, “Pain and Vitality” (SF-36; “Physical mobility” (NHP-“Physical function and Physical problems” (SF-36; “Emotional reactions” (NHP- “Mental health”, “Emotional problems” and “General health” (SF-36. The SF-36 is more sensitive than the NHP to evaluate the deterioration of the fibromyalgia. Conclusions: The fibromyalgia produces a significant deterioration in quality of life that can be assessed by the dimensions of the NHP and the SF-36.

  8. Oral Ezatiostat HCl (TLK199) and Myelodysplastic syndrome: a case report of sustained hematologic response following an abbreviated exposure.

    Science.gov (United States)

    Quddus, Fahd; Clima, Jessica; Seedham, Helen; Sajjad, Ghulam; Galili, Naomi; Raza, Azra

    2010-04-23

    Treatment options for patients with lower risk non-del(5q) myelodysplastic syndromes (MDS) who fail erythroid stimulating agents are restricted to one of the hypomethylating drugs with an expected response rate of approximately 50%. Ezatiostat HCl, an agent with the potential for producing multi-lineage responses in this population is currently in clinical investigation phase. This case report describes a 77 year old male who received less than two cycles of therapy with ezatiostat HCl which had to be aborted due to intolerable side effects, but which produced a sustained normalization of all three blood counts. This trilineage response has now lasted for more than a year. Interestingly, the patient began with a del(5q) abnormality and responded briefly to lenalidomide. Upon relapse of the anemia, a bone marrow showed the disappearance of the del(5q) but the appearance of a new clonal abnormality t(2;3). Given that the patient had a complete cytogenetic response to a truncated exposure to lenalidomide followed by a trilineage response to an even briefer course of ezatiostat HCl suggests a potential role for ezatiostat HCl in del(5q) patients who relapse following lenalidomide.

  9. Decoding the complete arsenal for cellulose and hemicellulose deconstruction in the highly efficient cellulose decomposer Paenibacillus O199

    Czech Academy of Sciences Publication Activity Database

    López-Mondejár, Rubén; Zühlke, D.; Větrovský, Tomáš; Becher, D.; Riedel, K.; Baldrian, Petr

    2016-01-01

    Roč. 9, MAY 14 (2016), s. 104 ISSN 1754-6834 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109; GA MŠk(CZ) EE2.3.30.0003; GA MŠk(CZ) LM2015055; GA MŠk(CZ) LD15086 Institutional support: RVO:61388971 Keywords : Cellulose * Hemicellulose * Paenibacillus Subject RIV: EE - Microbiology, Virology Impact factor: 5.203, year: 2016

  10. Speciation of Aquatic Heavy Metals in Humic Substances by$^{111m}$Cd/$^{199m}$Hg-TDPAC

    CERN Multimedia

    2002-01-01

    Humic substances are ubiquitous in waters and soils and act as complexing agents for different heavy metals, e.g. Cd, Hg. Toxicity, reactivity, fixation and migration are therefore strongly influenced by the interactions between heavy metals and humic substances. Humic substances derive from postmortal materials such as rotten plants, have dark colours and usually a molecular weight between 500 and 10~000 Dalton. Complex formation studies with different heavy metal ions indicate at least two different kinds of metal sites. Usually, these studies are restricted to heavy metal concentrations 2 to 3 orders of magnitude higher than the natural heavy metal abundance (i.e. 10$^{-10}$ molar). This serious limitation can be overcome by the use of suitable radiosotope techniques capable of metal speciation at extreme sensitivity levels such as TDPAC (Time Differential Perturbed Angular Correlation of~$\\gamma$-rays). Thus, we studied the interaction of heavy metals with humic substances by monitoring the nuclear quadru...

  11. Diagnostic and Prognostic Impact of Circulating YKL-40, IL-6, and CA 19.9 in Patients with Pancreatic Cancer

    DEFF Research Database (Denmark)

    Schultz, Nicolai A; Christensen, Ib J; Werner, Jens

    2013-01-01

    We tested the hypothesis that high plasma YKL-40 and IL-6 associate with pancreatic cancer and short overall survival.......We tested the hypothesis that high plasma YKL-40 and IL-6 associate with pancreatic cancer and short overall survival....

  12. Decoding the complete arsenal for cellulose and hemicellulose deconstruction in the highly efficient cellulose decomposer Paenibacillus O199

    National Research Council Canada - National Science Library

    López-Mondéjar, Rubén; Zühlke, Daniela; Větrovský, Tomáš; Becher, Dörte; Riedel, Katharina; Baldrian, Petr

    2016-01-01

    The search for new enzymes and microbial strains to degrade plant biomass is one of the most important strategies for improving the conversion processes in the production of environment-friendly chemicals and biofuel...

  13. 199 Caractérisation physico-chimique des eaux usées d'abattoir en ...

    African Journals Online (AJOL)

    AKA BOKO

    Laboratoire de Biologie & Santé. / Projet SVS. 18/99. UFR Doctorale : Parasitologie Comparée : Applications Médicales et. Vétérinaires. ... Sciences de la. Terre et de l'Environnement (D.A.S.T.E). Centre National d'Energie, des Sciences et des. Techniques Nucléaires (CNESTEN) B.P. 1382 R.P. 10001 - Rabat – Maroc.

  14. arXiv Study of the long-lived excited state in the neutron deficient nuclides $^{195,197,199}$Po by precision mass measurement

    CERN Document Server

    Althubiti, N.A.; Blaum, K.; Cocolios, T.E.; Day Goodacre, T.; Farooq-Smith, G.J.; Fedorov, D.V.; Fedosseev, V.N.; George, S.; Herfurth, F.; Heyde, K.; Kreim, S.; Lunney, D.; Lynch, K.M.; Manea, V.; Marsh, B.A.; Neidherr, D.; Rosenbusch, M.; Rossel, R.E.; Rothe, S.; Schweikhard, L.; Seliverstov, M.D.; Welker, A.; Wienholtz, F.; Wolf, R.N.; Zuber, K.

    2017-10-27

    Direct mass measurements of the low-spin 3/2− and high-spin 13/2+ states in the neutron-deficient isotopes Po195 and Po197 were performed with the Penning-trap mass spectrometer ISOLTRAP at ISOLDE-CERN. These measurements allow the determination of the excitation energy of the isomeric state arising from the νi13/2 orbital in Po195,197. Additionally, the excitation energy of isomeric states of lead, radon, and radium isotopes in this region were obtained from α-decay chains. These excitation energies complete the knowledge of the energy systematics in the region and confirm that the 13/2+ states remain isomeric, independent of the number of valence neutrons.

  15. 1.99 Ga mafic dykes of the Lewisian Gneiss Complex of Scotland: An upper age limit for the Palaeoproterozoic Loch Maree Group

    Science.gov (United States)

    Baker, Thomas; Prave, Tony; Spencer, Christopher

    2015-04-01

    Mafic dyke swarms are often used as geochronological markers, as they are widespread and emplaced over short timespans. The ca. 2.4 Ga Scourie dyke swarm is one such example that has played a key role in understanding the complex tectonic and metamorphic history of the Lewisian Gneiss Complex of Scotland (LGC), part of the North Atlantic Craton (NAC). The LGC consists of Archean and Palaeoproterozoic terranes that experienced polyphase deformation prior to their assembly at ca. 1.8 Ga. Zircons separated from a doleritic dyke from the Gairloch terrane have yielded a concordant U-Th-Pb age (1,989 +4.3 / -0.99 Ma) using the ID-TIMS method. The doleritic dyke is emplaced in Lewisian gneiss that experienced both granulite and amphibolite-facies metamorphism. Partial recrystallisation and amphibolitisation of the dyke demonstrate that it pre-dates the most recent (Laxfordian) amphibolite-facies metamorphic event. The age obtained from the dyke overlaps the U-Pb age of a previously dated olivine gabbro dyke from the Assynt terrane (1,992 Ma). These combined ages provide strong corroborating evidence for a ca. 2.0 Ga mafic dyke swarm event, distinct from the older ca. 2.4 Ga Scourie dyke event known from elsewhere in the LGC. The existence of a ca. 2.0 Ga mafic dyke swarm provides an upper age limit for the Loch Maree Group (LMG), a Palaeoproterozoic succession of metasediment and metavolcanic rocks that overlie the LGC and which are not cross-cut by the Scourie dykes. This study proposes that a period of crustal extension took place in the region at ca. 2.0 Ga. Later, subduction may have resulted in the accretion of the LMG and the adjacent Ard Gneiss, which has previously been regarded as a magmatic arc. The ca. 1.9 Ga age of the earliest stage of the Laxfordian metamorphic event, which affected the LMG, could therefore mark the onset of collision. This sequence of events can be correlated with other coeval areas of the NAC, including the Nagssugtoqidian mobile belt of Greenland. Future trace element modelling will aim to establish the magma source(s) of this younger mafic dyke swarm.

  16. Allelic imbalance and cytogenetic deletion of 1p in colorectal adenomas: a target region identified between DIS199 and DIS234

    DEFF Research Database (Denmark)

    Bomme, L; Heim, S; Bardi, G

    1998-01-01

    Both cytogenetic and molecular genetic analyses have shown that many colorectal adenomas carry an acquired deletion distally in the short arm of one chromosome 1, but the two methods have never been brought to bear on the same tumors. The major part of this study was the analysis of 53 previously...... region. This genomic area contains the human homologue of the tumor modifier gene Mom1 (1p35-36.1), which, in mice, modifies the number of intestinal tumors in multiple intestinal neoplasia (Min)-mutated animals. To evaluate whether the imbalances corresponded to interstitial deletions of 1p material, we...... at five of eight microsatellite loci. A comparison of the genetic findings with clinicopathologic data indicated that adenomas in the rectum have 1p abnormalities more often than do adenomas of the sigmoid colon, and that adenomas with 1p changes are larger than adenomas without abnormalities...

  17. A randomised study in all cervical hip fractures osteosynthesis with Hansson hook-pins versus AO-screws in 199 consecutive patients followed for two years.

    Science.gov (United States)

    Mjørud, Jan; Skaro, Olav; Solhaug, Jan Helge; Thorngren, Karl-Göran

    2006-08-01

    A consecutive series of patients with all types of cervical hip fracture (both undisplaced and displaced) were randomised to osteosynthesis with Hansson hook-pins (n = 98) or AO-screws (n = 101). Background parameters, fracture type and reduction of the fracture did not differ significantly between the groups. Fifty-seven percent of the patients were operated on within 6 h of admission to hospital, 74% within 12 h and 92% within 24 h. The mean (median) time for operation was 36 (30) min for the hook-pins and 40 (35) min for the AO-screws. The devices were significantly better positioned in the hook-pin group (81% of cases good) compared to the AO-screws (66% good) (p = 0.04). In all, 72% of the patients had no deficiency either in reduction of the fracture, positioning of the implants or had drill penetration of the femoral head. Direct unrestricted weight bearing was encouraged in 92% of the hook-pin and 90% of the AO-screws group. The mean (median) hospital time was 13 (10) days with no significant difference between the groups. Following treatment, 5% walked without aids, 76% of the patients walked with some aids, and 16% could not walk. The walking ability was not known for 4%. At four months, 59% of the patients were living in their own home (64% before fracture), 18% (25% before) in a nursing home, 5% (11% before) in other accommodation and 18% were dead. After two years, 77% of the hook-pin patients had not needed any re-operation compared to 73% in the AO-screw group. In total a secondary hemi-arthroplasty had been performed in 7% and total hip arthroplasty in 12% of the patients. Extraction only of osteosynthesis material had been performed in 5%. The difference in the reoperation rates between the two methods was not significant. In the undisplaced fractures, 84% of the patients had not needed any reoperation after two years compared to 70% among the displaced fractures. Major reoperation had been performed in 10% (1% hemi and 9% total hip arthroplasty) in the patients with undisplaced fractures compared to 26% in those with displaced fractures (10% hemi, 16% total hip arthroplasty and 1% Girdlestone operation). The remaining patients had only undergone removal of metalwork. Osteosynthesis thus proved to be a successful operation in many of the patients with displaced fractures. A preoperative, prognostic-based selection between osteosynthesis and arthroplasty is the future goal for optimised femoral neck fracture treatment.

  18. Surgical pathology-based outcomes assessment of breast cancer early diagnosis: a College of American Pathologists Q-Probes study in 199 institutions.

    Science.gov (United States)

    Nakhleh, R E; Zarbo, R J

    2001-03-01

    To develop breast cancer outcomes data relating pathologic tumor variables at diagnosis with clinical method of detection. Anatomic pathologists assessed 30 consecutive breast cancers at each institution, resulting in an aggregate database of 4232 breast cancers. Hospital-based laboratories from the United States (98%), Canada, Australia, and Belgium. One hundred ninety-nine laboratories in the 1999 College of American Pathologists Q-Probes voluntary quality improvement program. Pathologic variables indicative of favorable outcomes included percentage of carcinomas detected at the in situ stage, tumors vs 13.8%), tumor size vs 36.5%), and lymph node-negative status (77.8% vs 64%), were more favorable when tumors were detected by screening mammography (P organizations, providers, patients, and payers by integrating routine oncologic surgical pathology and clinical breast cancer detection data. Such readily obtained interim outcomes data trended and benchmarked over time can demonstrate the relative clinical efficacy of preventive breast care provided by health care systems long before mortality data are available.

  19. Cambios en las actitudes y conocimientos de los adolescentes sobre la infección por VIH tras la intervención escolar Aulasida, 1996-199

    Directory of Open Access Journals (Sweden)

    Carmen Fernández García

    2000-01-01

    Full Text Available actividades de Educa& para la Salud se pretende detectar y cuantificar los cambios en actitudes v conocimientos de los adolescentes escolarizados en Algemesf (Valéncia, tras una intervención educativa sobre la infección por VIH. Método: Se invitó a participar a once centros docentes con 2.599 adolescentes (12-19 años. matriculados en oI1ce niveles educativos (Educación ‘Secundaria.‘Bachillerato Unificado Polivalente. Curso & Orientación Universitaria intervención Aulasida. desarrollada y Formación profesional. 6 durante el curso escolar 1996- 1997, consisti0 en una charla-coloouio informativa v actividades participativas en grupos reducidos, con material didác&o. El instrumento de medida fue un cuestionario. Se disefió un estudio transversal antes-despds. Se realizó un análisis estratificado según edad y nivel educativo. Las medias se compararon con la prueba t de Student y los porcentajes de cambio con x2. Resultados: Aceptaron participar 9 centros. 1575 alumnos respondieron al pre-test (47,4% hombres; 52,1% mujeres, la edad media fue de 15,2 (l,% años. El promedio de respuestas correctas en el pre-test fue 13,5 (2,8. En el post-test, hubo un aumento global hasta 14,7 (3,0 aciertos (pcO,Ol. Por niveles educativos, este incremento fue llamativo en el grupo de menor edad. Las fuentes de información sobre la infección nor VIH más habituales fueron: televisión (80,8%, Aul&rln (76,8%, profesores (60,9%, folletos (58,4% y pelfculas (53.7%. Couclusiones: Las intervenciones educativas son herramientas útiles para incrementar conocimientos y mejorar actitudes sobre la infección por VII-i; la escuela secundaria es un buen medio para ello, debiendose realizar las intervenciones en los gmpos más jóvenes, por ser mayor el impacto que se obtiene en ellos.

  20. Field Studies in Plant Ecology I, II: A Short Course in Biology. BIO 286, 287, Fall Quarter 1989 and Fall Quarter 199O.

    Science.gov (United States)

    Williams, George

    Each fall, the Department of Natural Sciences at Calhoun Community College (CCC) integrates a field trip to the Great Smoky Mountains into two of its biology courses. Two preliminary class meetings culminate in a 4-day visit to the park. A fee is charged to cover accommodations, breakfast each day, two picnic lunches, and transportation. Course…

  1. Publisher’s Note to Modeling the influence of potassium content and heating rate on biomass pyrolysis [Appl. Energy J. 194 (2017) 199–211

    DEFF Research Database (Denmark)

    Trubetskaya, Anna; Surup, Gerrit; Shapiro, Alexander

    2017-01-01

    The authors and the editors regret to report that the following errors were found in the article after its availability online.......The authors and the editors regret to report that the following errors were found in the article after its availability online....

  2. Acontece que chove ... em vista de um fim. Aristóteles, Phys. II 8, 198b16-199a8

    Directory of Open Access Journals (Sweden)

    Barbara Botter

    2010-06-01

    Full Text Available Aristotle’s defense of natural teleology in Physica II 8, and in particular the aporia he raises in this context with regard to the proper explanation of rainfall and the coming to be of animal parts are among the most disputed passages in the whole Aristotelian Corpus. In my account , I will first offer a general outline of the passage and indicate the problems involved. Then, I will offer my solutions to them.

  3. « Un écho aux pratiques cultuelles zoroastriennes en Dt 4-5 ». Trans., 29, 2005, pp. 189-199.

    OpenAIRE

    Nunn, Astrid

    2007-01-01

    Les Juifs se sont-ils intéressés à la religion des Perses ? Les apparences suggèrent une réponse négative. Mais est-ce bien vrai ? Une relecture du texte tardif Dt 4, où le thème du feu est présenté de manière unique dans la Bible, amène l’A. à penser que le « feu » évoqué est celui de la religion mazdéenne.

  4. Evidence for pre-Cretaceous history and partial Neogene (19-9 Ma) reequilibration in the Karakorum (NW Himalayan Syntaxis) from 40Ar- 39Ar amphibole dating

    Science.gov (United States)

    Rolland, Yann; Villa, Igor M.; Guillot, Stéphane; Mahéo, Gweltaz; Pêcher, Arnaud

    2006-09-01

    Amphiboles and a biotite from amphibolites and amphibolitic gneisses of the Karakorum Metamorphic Complex (KMC, NW Himalaya), were dated using the 40Ar/ 39Ar method. Isotope correlations were compared to electron-microprobe analyses. Both Al IV and Al VI contents of amphibole increase from the south near the Shyok Suture Zone to the Dassu-Askole Area in the north, with an increase in metamorphic grade (from anchizone to upper amphibolite facies). In the lower metamorphic zone, discordant age spectra were obtained. They are related to epidote-amphibolite overgrowth of amphibole rims on older (Precambrian to Mesozoic) magmatic cores. In the Shyok Suture Zone Ar/Ar ages of 38-62 Ma are contemporaneous with the emplacement of the Ladakh Batholith granodiorites, while middle Cretaceous magmatic Ar/Ar ages (˜ 120 Ma) are locally preserved in tschermakite relics. In the Southern Karakorum basement, a minimum Ar/Ar age of 651 Ma was preserved, while an age of 208.5±2 Ma was preserved in Panjal Trap-like diorites. At the margin of the domes zone, more recent metamorphism resulted in mineral growth at 20-5 Ma. In the domes zone, amphibole Ar/Ar ages of 17 Ma (Askole) and bimodal age spectra of 15-17 and 9-13 Ma (Dassu) extend towards the east the zone of Neogene amphibolite to granulite facies metamorphism known in the Nanga Parbat Syntaxis.

  5. 199 Étude de la qualité des eaux d'une retenue située sous climat ...

    African Journals Online (AJOL)

    Afrique Sciences

    Au Maroc, pays à climat semi-aride, le développement des agglomérations urbaines, la pression démographique et la limitation des ressources en eau souterraine font que le pays a de plus en plus recours aux eaux superficielles pour satisfaire en quantité suffisante, les besoins des populations en eau potable et.

  6. The Low Cost Airline Consumer Price Sensitivity. An Investigation on The Mediating Role of Promotion and Trust in Brand (P.199-211)

    OpenAIRE

    Janfry Sihite; Tabby Wihasari Harun; Arissetyanto Nugroho

    2016-01-01

    The ASEAN Open Sky Policy is one of ASEAN policy to open the airs-pace between the ASEAN member countries. Aviation services based companies including the Low Cost airlines will experience tight com-petition among ASEAN airline companies. This research aim to explore the effect of price on customer loyalty through the mediating role of promotion and trust in brand. The original sample collected from 100 Indonesian low-cost airline Citilink consumer that just arrived in Soekarno-Hatta Internat...

  7. Antitumor agents. 199. Three-dimensional quantitative structure-activity relationship study of the colchicine binding site ligands using comparative molecular field analysis.

    Science.gov (United States)

    Zhang, S X; Feng, J; Kuo, S C; Brossi, A; Hamel, E; Tropsha, A; Lee, K H

    2000-01-27

    Inhibitors of tubulin polymerization interacting at the colchicine binding site are potential anticancer agents. We have been involved in the synthesis of a number of colchicine site agents, such as thiocolchicinoids and allocolchicinoids, which are colchicine analogues, and 2-phenyl-quinolones and 2-aryl-naphthyridinones, which are the amino analogues of cytotoxic antimitotic flavonoids. The most cytotoxic of the latter compounds strongly inhibit binding of radiolabeled colchicine to tubulin, and these agents therefore probably bind in the colchicine site of tubulin. We have applied conventional CoMFA and q(2)-GRS CoMFA to identify the essential structural requirements for increasing the ability of these compounds to form tubulin complexes. The CoMFA model for the training set of 51 compounds yielded cross-validated R(2) (q(2)) values of 0.637 for conventional CoMFA and 0.692 for q(2)-GRS CoMFA. The predictive power of this model was confirmed by successful activity prediction for a test set of 53 compounds with known potencies as inhibitors of tubulin polymerization. The activities of 88% of the compounds were predicted with absolute value of residuals of less than 0.5. The predictive q(2) values were 0.546 for conventional CoMFA and 0.426 for q(2)-GRS CoMFA. The conventional CoMFA model with the highest predictive q(2) (0.546) was analyzed in detail in terms of underlying structure-activity relationships.

  8. The Low Cost Airline Consumer Price Sensitivity. An Investigation on The Mediating Role of Promotion and Trust in Brand (P.199-211

    Directory of Open Access Journals (Sweden)

    Janfry Sihite

    2016-03-01

    Full Text Available The ASEAN Open Sky Policy is one of ASEAN policy to open the airs-pace between the ASEAN member countries. Aviation services based companies including the Low Cost airlines will experience tight com-petition among ASEAN airline companies. This research aim to explore the effect of price on customer loyalty through the mediating role of promotion and trust in brand. The original sample collected from 100 Indonesian low-cost airline Citilink consumer that just arrived in Soekarno-Hatta International Airport, the bootstrapped techniques conducted for 500 sub-samples and further analyzed with structural equation modelling partial least square. The research findings support the low cost airline consumer price sensitivity, furthermore price affect the trust in brand more severe compared with the promotion. Price effect fully mediated through the trust in brand and promotion toward the consumer loyalty. Further research should consider the sensitivity of price to elaborate the decision making process for the low cost air-line consumer.Keywords: Price Sensitivity, Promotion, Trust in Brand, Low Cost Airline, Loyalty

  9. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  10. δ37Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.

  11. δ³⁷Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine

  12. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  13. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  14. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  15. Production cross section of At radionuclides from 7Li+natPb and 9Be+natTl reactions

    Science.gov (United States)

    Maiti, Moumita; Lahiri, Susanta

    2011-12-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from 6,7Li- and 9Be-induced reactions on natural lead and thallium targets, respectively. The production of astatine radionuclides were investigated experimentally with two heavy-ion-induced reactions: 9Be + natTl and 7Li + natPb. Formation cross sections of the evaporation residues, 207,208,209,210At, produced in the (HI,xn) channel, were measured by the stacked-foil technique followed by off-line γ spectrometry at low incident energies (<50 MeV). Measured excitation functions were interpreted in terms of a compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach models. Measured cross-section values are lower than the respective theoretical predictions.

  16. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Koziorowski, J

    1998-10-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on {sup 211}At and {sup 124}I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[{sup 211}At]astato-2`-deoxyuridine (AUdR) and N-succinimidyl-4-[{sup 211}At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [{sup 124}I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[{sup 124}I]iodo-2`-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for

  17. Multibeam collection for KN199-03: Multibeam data collected aboard Knorr from 2010-10-01 to 2010-10-10, departing from Nuuk (Godthab), Greenland and returning to Lisboa, Portugal

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  18. Temperature profile data from XBT casts from the SEA-LAND ENTERPRISE and other vessels in the North/South Atlantic Oceans from 01 January 199 to 31 December 1999 (NODC Accession 0000684)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Temperature profiles were collected from XBT casts in the North/South Atlantic Oceans from the SEA-LAND ENTERPRISE and other vessels. Data were collected in support...

  19. Estudo comparativo da eficácia da drenagem linfática manual e mecânica no pós –operatório de dermolipectomia - doi:10.5020/18061230.2005.p199

    Directory of Open Access Journals (Sweden)

    Lúcia Maria Alves Soares

    2012-01-01

    Full Text Available A abdominoplastia ou dermolipectomia é uma cirurgia que retira o excesso de pele e tecido adiposo do abdome de pacientes com ptose de pele ou flacidez em mulheres após múltiplas gestações. A drenagem linfática é uma técnica de massagem realizada com pressões suaves seguindo o trajeto do sistema linfático e atualmente é um dos recursos mais indicados no pós-operatório de cirurgias plásticas. O objetivo desse estudo foi comparar os efeitos da drenagem linfática manual (DLM e da mecânica (DLME no pós-operatório da dermolipectomia. Foi realizado um ensaio clínico randomizado com 14 mulheres de 35 a 45 anos, entre o oitavo e vigésimo dia de pós-operatório, avaliadas após um período de dez atendimentos por meio de medidas de perimetria, e melhoria dos sintomas. Também houve uma abordagem qualitativa, realizada mediante de um questionário, para analisar o grau de satisfação do paciente e do pesquisador em relação aos tratamentos empregados. Observou-se melhora quanto aos sintomas do pós-operatório e sua intensidade, nos dois grupos de tratamento. A DLM mostrou-se mais eficaz que a DLME na redução do edema especialmente na perimetria abdominal (p=0,01. A análise subjetiva do investigador e dos pacientes também revelou um maior índice de aceitação para a DLM, 57,1% e 85,7%, respectivamente. Conclui-se, portanto, que as duas técnicas foram eficazes e que a DLM mostrou-se mais eficiente do que a DLME no pós-operatório das pacientes submetidas a abdominoplastia-dermolipectomia

  20. Oana Salişteanu Cristea, Prestito latino - Elemento ereditario nel lessico della lingua italiana - Doppioni e varianti, Istituto di Studi Romanzi, Facoltà di Lettere, Università Carolina Praga; Praga 2000, pp. 199

    Directory of Open Access Journals (Sweden)

    Pavao Tekavčić

    2000-12-01

    Full Text Available La ricchezza del lessico italiano dall'antichità ad oggi e la sua complicata stratificazione sono oggetto dell'interesse dei linguisti da più di un secolo e mezzo; eppure, c'è una serie di problemi non studiati a fondo, tuttora aperti e promettenti. Uno di tali temi è la coesistenza di due (o più riflessi di una sola base latina, cioè gli allotropi e doppioni (franc. doublets. Dai tempi di Ugo Angelo Canello (anni 70 dell'Ottocento questo settore del vocabolario non cessa di preoccupare gli studiosi ed il più recente contributo -- importantissimo, diciamolo subito-- che riassume, discute, sistematizza e in gran parte completa quanto fatto finora, è il recentissimo volume della professoressa Oana Sălişteanu Cristea, docente di linguistica italiana (storia della lingua, filologia e dialettologia all'Università di Bucarest. Questo libro è l'oggetto della presente recensione.

  1. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT199-206 during 2008 (NCEI Accession 0059943)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  2. Niskin bottle data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT199-206 during 2008 (NODC Accession 0059936)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  3. Multibeam collection for KN199-02: Multibeam data collected aboard Knorr from 2010-09-07 to 2010-09-29, Nuuk (Godthab), Greenland to Nuuk (Godthab), Greenland

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  4. Water Column Chemical Data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT199-227 during 2008-2010 (NODC Accession 0088839)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  5. Estudo comparativo da eficácia da drenagem linfática manual e mecânica no pós –operatório de dermolipectomia - doi:10.5020/18061230.2005.p199

    OpenAIRE

    Lúcia Maria Alves Soares; Sandra Mara Brasil Soares; Aline Kercia Alves Soares

    2012-01-01

    A abdominoplastia ou dermolipectomia é uma cirurgia que retira o excesso de pele e tecido adiposo do abdome de pacientes com ptose de pele ou flacidez em mulheres após múltiplas gestações. A drenagem linfática é uma técnica de massagem realizada com pressões suaves seguindo o trajeto do sistema linfático e atualmente é um dos recursos mais indicados no pós-operatório de cirurgias plásticas. O objetivo desse estudo foi comparar os efeitos da drenagem linfática manual (DLM) e da mecânica (DLME)...

  6. Multibeam collection for KN199-05: Multibeam data collected aboard Knorr from 2010-11-08 to 2010-11-26, departing from Porto Grande, Cape Verde and returning to Charleston, SC

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  7. Multibeam collection for KN199-04: Multibeam data collected aboard Knorr from 2010-10-15 to 2010-11-04, departing from Lisbon, Portugal and returning to Porto Grande, Cape Verde

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  8. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT199-206 during 2008 (NODC Accession 0059842)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  9. « Präteritum und Perfekt im Soghdischen ». Indogermanische Forschungen 102, (1997), pp. 199-205. [The preterite and perfect in Sogdian

    OpenAIRE

    Sims-Williams, Nicholas

    2010-01-01

    The author shows how the distribution of forms of the preterite (traditionally « imperfect ») and perfect (in my terminology « preterite » !) varies from one Sogdian text to another, the difference being attributed to a gradual replacement of the preterite by the perfect, first in the spoken and later in the written language.  On the form [Lʾ] nʾyrt « he did not plan » in the parable of the two snakes (p. 204 fn.) see Sims-Williams, MSS 56, 1996, p. 176 (probably a historic present)....

  10. A seismic-reflection investigation of gas hydrates and sea-floor features of the upper continental slope of the Garden Banks and Green Canyon regions, northern Gulf of Mexico: report for cruise G1-99-GM (99002)

    Science.gov (United States)

    Cooper, Alan; Twichell, David; Hart, Patrick

    1999-01-01

    During April 1999, the U.S. Geological Survey (USGS) conducted a 13-day cruise in the Garden Banks and Green Canyon regions of the Gulf of Mexico. The R/V Gyre, owned by Texas A&M University, was chartered for the cruise. The general objectives were (1) to acquire very high resolution seismic-reflection data and side-scan sonar images of the upper and middle continental slope (200-1200-m water depths), (2) to study the acoustic character and features of the sea floor for evidence of sea-floor hazards, and (3) to look for evidence of subsurface gas hydrates and their effects. The Gulf of Mexico is well known for hydrocarbon resources, with emphasis now on frontier deep-water areas. For water depths greater than about 250 m, the pressure-termperature conditions are correct for the development of shallow-subsurface gas hydrate formation (Anderson et al., 1992). Gas hydrates are ice-like mixtures of gas and water (Kvenvolden, 1993). They are known to be present from extensive previous sampling in sea-floor cores and from mound-like features observed on the sea floor in many parts of the northern Gulf, including the Green Canyon and Garden Banks areas (e.g., Roberts, 1995). Seismic-reflection data are extensive in the Gulf of Mexico, but few very-high-resolution data like those needed for gas-hydrate studies exist in the public domain. The occurrence and mechanisms of gas hydrate formation and dissociation are important to understand, because of their perceived economic potential for methane gas, their potential controls on local and regional sea-floor stability, and their possible effects on earth climates due to massive release of methane greenhouse gas into the atmosphere. Three high-resolution seismic-reflection systems and one side-scan sonar system were used on the cruise to map the surface reflectance and features of the sea floor and the acoustic geometries and character of the shallow sub-surface. The cruise was designed to acquire regional and detailed local information. The regional survey covered an area about 3400 km2 in the Green Canyon and Garden Banks regions. Data recorded included 15 cu. in. water gun multichannel seismic-reflection and Huntec boomer information. Detailed surveys were planned in two parts of the study area, but due to a winch failure only one detailed survey was done in the Green Canyon area. The detailed survey included collection of 15 cu. in. water gun multichannel seismic-reflection, chirp seismic-reflection, and side-scan data.

  11. Report by the parliamentary mission on nuclear safety, the role and future of the nuclear sector - Final report: the future of the nuclear sector in France - National Assembly report nr 4097, Senate report nr 199; Rapport de la mission parlementaire sur la securite nucleaire, la place de la filiere et son avenir - Rapport final: l'avenir de la filiere nucleaire en France - Assemblee nationale no. 4097, Senat no. 199

    Energy Technology Data Exchange (ETDEWEB)

    Birraux, Claude; Bataille, Christian [Assemblee nationale, 126 rue de l' Universite, 75355 Paris 07 SP (France); Sido, Bruno [Senat, 15 Rue de Vaugirard, 75006 Paris (France)

    2011-12-15

    This large report first outlines the fact that the French nuclear sector is adapted to the national context while discussing the difference with other countries and the French strategic priorities. It describes the constraints another approach would have regarding the objective of a controlled consumption, the exploitation of renewable energies, and the remanence of the burden related to nuclear energy (culture of safety, the waste management issue). It proposes a prospective vision for the nuclear sector with respect with technological perspectives, and analyses three scenarios. The document also contains reports of visits in Germany and in Fukushima. A second part proposes the contents of hearings and meetings, as well as reports of other visits on French nuclear sites

  12. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...

  13. Väheväärtusliku vallasasja süstemaatiline vargus KarS § 199 lõike 2 punkti 9 tähenduses. Tartu Ringkonnakohtu kriminaalkolleegiumi määrus kriminaalasjas 1-11-11324 (Riigikohtu kriminaalkolleegiumi otsuses asjas 3-1-1-87-07 väljendatud seisu

    Index Scriptorium Estoniae

    Randma, Paavo, 1977-

    2013-01-01

    Riigikohus leidis lahendis 3-1-1-87-07, et süstemaatilisuse jaatamiseks on vaja isiku poolt vähemalt kolme varguse toimepanemist. Ringkonnakohus asus lahendis 1-11-11324 seisukohale, et varguste toimepanemisest kui inimese elustiilist saab väheväärtuslike vallasasjade varastamise korral rääkida vaid juhul, kui need pannakse toime teatud kindla ajavahemiku vältel

  14. What is the empirical evidence of the Fisher Effect upon colombian economy during the period 199O-2000? ¿Cuál es la evidencia empírica del efecto Fisher en la economía colombiana, 1980-2000?

    Directory of Open Access Journals (Sweden)

    Sáenz Castro Jorge Enrique

    2001-12-01

    Full Text Available In this essay an analysis is carried out on the Fisher Effect
    upon the colombian economy during 1980-2000 taking the quarterly data of nominal interest rate and the inflation rateo Our results show that the nominal interest rate and the inflation rate have a unitary root, that they have a cointegral relation, this is a
    long-run relationship and that the variations in inflation upon
    the nominal interest rate are in the form of one to one. Thus,
    our results suggest that during the period analysed (1980-2000
    increments in inflation, on the long-run (20 years are entirely
    transmited to the nominal interest rate.
    En este trabajo se hace un análisis sobre el Efecto Fisher para
    el caso colombiano durante el periodo 1980-2000 a partir de la
    información trimestral de la tasa de interés nominal y de la tasa de inflación. Los resultados muestran que la tasa de interés nominal y la inflación poseen una raiz unitaria, guardan una relación de cointegración o relación de largo plazo y los cambios en la inflación sobre la tasa de interés nominal se presentan de forma uno a uno. De esta manera, los resultados sugieren que para el periodo 1980-2000 los incrementos en la inflación en el largo plazo (20 años se transmiten en forma completa sobre la tasa de interés nominal.

  15. RESEÑA DE: VALERO, Sergio: Ni contigo ni sin ti: socialismo y republicanismo histórico en la Valencia de los años treinta, Valencia, Institució Alfons el Magnànim, 2015. 199 pp. ISBN: 978-84-7822-683-2.

    Directory of Open Access Journals (Sweden)

    Santiago Jaén Milla

    2016-05-01

    Full Text Available El estudio del republicanismo y el socialismo español cuenta con innumerables trabajos de investigación, pero han sido muy pocos los historiadores que han abordado la relación entre ambos movimientos, de ahí que la obra de Sergio Valero sea del máximo interés historiográfico. Además, Valero se aproxima a esa relación desde el ámbito nacional para descender al ámbito provincial, en concreto, al caso de Valencia,  que fue uno de los espacios geográficos más dinámicos desde el punto de vista político de todo el país, gracias a movimientos como el generado por el escritor Vicente Blasco Ibáñez.El trabajo de Valero tiene como objetivo aproximarse -desde un punto de vista cronológico- a las relaciones entre el socialismo valenciano, representado por la Federación Socialista Valenciana (FSV, y el republicanismo histórico, representado por el blasquismo, que adoptó la denominación de Partido de Unión  Republicana Autonomista (PURA, abordando esas relaciones desde la perspectiva de la capital del Estado y su reflejo en la provincia de Valencia.

  16. Le partage du champ scolaire au Quebec: Reconversion et invention de domaines de pratique au sein de l'organisation scolaire, 1930-1990 (The Division of the School System in Quebec: Reconversion and Invention of the Spheres of Practice within School Organization, 1930-199O).

    Science.gov (United States)

    Mellouki, M'hammed; Lemieux, Nicole

    1995-01-01

    Offers a historical analysis of the system of educational and professional counseling in Quebec (1930-90) and the separate role of the school inspection system (1851-1964) as they relate to important changes going on currently in Quebec society. Considers the role of both counselors and school inspectors--as intellectuals--in cultural mediation…

  17. Secondary School Teachers Don’t Have Time to Engage in the Most Important Aspects of Information Literacy Due to Curricular Pressures. A Review of: Williams, D. and C. Wavell. “Secondary School Teachers’ Conceptions of Student Information Literacy.” Journal of Librarianship and Information Science 39.4 (2007: 199-212.

    Directory of Open Access Journals (Sweden)

    Lotta Haglund

    2009-03-01

    Full Text Available Objective – To examine school teachers’ understanding of student information literacy and to look at the implications of the findings for developing information literacy in students.Design – Qualitative research design (group discussions; verbal and written reflections.Setting – Secondary schools in the United Kingdom.Subjects – Secondary school teachers with various subject specializations.Methods – The study initially involved 31 secondary school teachers; 24 from seven schools in Scotland and seven from two schools in England. Participant teachers were self-selecting. The study took a phenomenographic approach. Teachers’ perceptions of their students’ abilities and their experiences and perceptions of their role in developing these abilities were examined through data collection in three stages. During the first stage, group discussions established the teacher’s initial conceptions of information literacy. Participants also filled out an information task grid which, together with focus questions, ensured that discussions were kept in the realm of practice. During the second stage of data collection, teachers observed and reflected on their students’ use of information in classroom activities. This was accompanied by informal site visits during which 26 of the participants were introduced to information literacy frameworks and definitions in order to contextualize reflections and discussions. Field notes were used to record these informal meetings. Six participants provided written feedback on reflections. In the third and final stage, a summary of themes from the first two stages was sent to 23 of the participants prior to a second group discussion in order to try to stimulate further reflection. Discussions were audio recorded and transcribed. The transcribed data were analyzed for the dimensions of variation of teachers’ conceptions of student information literacy and key elements associated with each category of description were determined.Main Results – The data revealed six main conceptions of student information literacy among the teachers: “finding information,” “linguistic understanding,” “makingmeaning,” “skills,” “critical awareness ofsources,” and “independent learning.” There was no particular hierarchy in their conceptualization, although independent learning seemed to be the ultimate goal. Teachers’ conceptions in the beginning ofthe study focused on the ability to find information, whereas after a period of reflection and further discussions, a broader and more complex understanding of information literacy appeared. Table 1 simplifies some of the data from the table in the article and shows conceptualizations as well as some of the contextual elements. Teachers felt that they had at least some control over the development of student ability to find information, develop skills, and critically appraise sources, even though these were not the highest learning priority outcomes. However, in the three areas of ability which the teachers regarded as of high learning priority (linguistic understanding, making meaning and independent learning, they felt that they had little control over the development of these abilities in the students.Conclusion – The teachers’ conceptions of student information literacy overlapped with the ideas in existing models and frameworks for information literacy. However, some areas of information literacy were not addressed by the teachers, i.e., ethical issues in the use of information. In the categories of description of high learning priority, the main reason for the low sense of control by the teachers seemed to be curricular pressures – “our content is prescribed and time allocated doing each of these things is prescribed so we have got limited room for maneuvering” (206. The teachers tended to regard information literacy as process and skills-orientated, with little connection to learning. The authors note that other research also suggests that school librarians also have difficulty relating information finding to learning in specific subject disciplines. There is a clear gap here as the authors point out that “there is a danger that students will not understand the significance of learning with information for academic achievement or for independent learning” (209.The authors suggest that the way forward for further development of information literacy in the classroom and library is through dialogue and that “librarian-teacher collaborations needs to be founded on shared understanding of the complex inter-relationship between information and learning” (209.

  18. Grids of Agricultural Pesticide Use in the Conterminous United States, 1992

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This spatial dataset consists of 199 1-kilometer (km) resolution grids depicting estimated agricultural use of 199 pesticides in 1992 for the conterminous United...

  19. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NLMGETVMESRQRMLLHRAAGELGR Sbjct: 1 ... RALDYLWRHLDEPLLLDRLAEEACFSRFHFHRLYRNLMGETVMESRQRMLLHRAAGELGR 60 ... Query: 140 VKVLMRHHRGPYME...IGKAFDALRAVQGPQQGVGAPSRSFGLYLDDQAQTPAADCRSIACA 199 ... VKVLMRHHRGPYME...IGKAFDALRAVQGPQQGVGAPSRSFGLYLDDQAQTPAADCRSIACA Sbjct: 121 VKVLMRHHRGPYMEIGKAFDALRAVQGPQQGVGAPS

  20. ORF Alignment: NC_002942 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... pneumophila] ... Length = 67 ... Query: 140 DNKNIYGLTDREHECVFLLIRGKSAKEIGALLSLSKRTIESYIENIKNKM...DCRNKAEILV 199 ... DNKNIYGLTDREHECVFLLIRGKSAKEIGALLSLSKRTIESYIENIKNKMDCRNKAEILV Sbjct: 1 ... DNKNIYGLTDREHECVFLLIRGKSAKEIGALLSLSKRTIESYIENIKNKMDCRNKAEILV 60 ...

  1. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 31; Issue 3. Issue front cover thumbnail. Volume 31, Issue 3. June 2008, pages 199-584. Proceedings of the 'National Review and Coordination Meeting on Nanoscience and Nanotechnology', Hyderabad, 2007. pp 199-199. Foreword · S B Krupanidhi G Sundararajan ...

  2. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  3. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  4. Nuclear and in-source laser spectroscopy with the ISAC yield station

    Energy Technology Data Exchange (ETDEWEB)

    Kunz, Peter, E-mail: pkunz@triumf.ca; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning [TRIUMF, 4004 Wesbrook Mall, Vancouver, British Columbia V6T 2A3 (Canada); Andreoiu, Corina; Wong, Fiona [Department of Chemistry, Simon Fraser University, Burnaby, British Columbia V5A 1S6 (Canada)

    2014-05-15

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10{sup 11} ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of {sup 46}K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  5. Nuclear and in-source laser spectroscopy with the ISAC yield station.

    Science.gov (United States)

    Kunz, Peter; Andreoiu, Corina; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning; Wong, Fiona

    2014-05-01

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10(11) ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of (46)K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  6. Radiopharmaceutical chemistry of targeted radiotherapeutics, part 4: Strategies for211At labeling at high activities and radiation doses of211At α-particles.

    Science.gov (United States)

    Pozzi, Oscar R; Zalutsky, Michael R

    2017-03-01

    Alpha particles are radiation of high energy and short range, properties that can lead to radiolysis-mediated complications in labeling chemistry at the high radioactivity levels required for clinical application. In previous papers in this series, we have shown that radiation dose has a profound effect on the astatine species that are present in the labeling reaction and their suitability for the synthesis of N-succinimidyl 3-[ 211 At]astatobenzoate. The purpose of this study was to evaluate the effects of adding N-chlorosuccinimide (NCS) to the methanol solution used for initial isolation of 211 At after distillation, a process referred to as 211 At stabilization, on 211 At chemistry after exposure to high radiation doses. High performance liquid chromatography was used to evaluate the distribution of 211 At species present in methanol in the 500-65,000Gy radiation dose range and the synthesis of SAB from N-succinimidyl 3-(tri-n-butylstannyl)benzoate in the 500-120,000Gy radiation dose range using different 211 At timeactivity combinations under conditions with/without 211 At stabilization. In the absence of NCS stabilization, a reduced form of astatine, At(2), increased with increasing radiation dose, accounting for about half the total activity by about 15,000Gy, while with stabilization, At(2) accounted for 60,000Gy. SAB yields without stabilization rapidly declined with increasing dose, falling to ~20% at about 5000Gy while with stabilization, yields >80% were obtained with 211 At solutions stored for more than 23h and receiving radiation doses >100,000Gy. Adding NCS to the methanol solution used for initial isolation of 211 At is a promising strategy for countering the deleterious effects of radiolysis on 211 At chemistry. This strategy could facilitate the ability to perform 211 At labeling at sites remote from its production and at the high activity levels required for clinical applications. Copyright © 2016 Elsevier Inc. All rights reserved.

  7. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VAEAVSANRI Sbjct: 20 ... ALLMGARGAKVVVNDIGASVSGEGADVGPAQSVATEIRAAGGEAVANTDSVAEAVSANRI 79 ... Query: 146 GGAFVHMTSTSGLI...GNYGQSNYAAAKMGIVGLSKIIALDMHKFNVRSNCISPFAWSRMVG 205 ... GGAFVHMTSTSGLIGNYGQSNYAAAKMGIVGLSKIIALDMHK...FNVRSNCISPFAWSRMVG Sbjct: 140 GGAFVHMTSTSGLIGNYGQSNYAAAKMGIVGLSKIIALDMHKFNVRSNCISPFAWSRMVG 199 ...

  8. ORF Alignment: NC_006368 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... pneumophila str. Paris] ... Length = 67 ... Query: 140 DNKNIYGLTEREHECVFLLIRGKSAKGIGALLSLSKR...TVESYIENIKNKMDCRNKAEILV 199 ... DNKNIYGLTEREHECVFLLIRGKSAKGIGALLSLSKRTVESY...IENIKNKMDCRNKAEILV Sbjct: 1 ... DNKNIYGLTEREHECVFLLIRGKSAKGIGALLSLSKRTVESYIENIKNKMDCRNKAEILV 60 ...

  9. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available .t00010 [Entamoeba histolytica HM-1:IMSS] ... Length = 50 ... Query: 199 AKEEHECVICRDVLTEAAHLRCGHDFHVSCL...KGWLARASDCPICRNPINL 248 ... AKEEHECVICRDVLTEAAHLRCGHDFHVSCLKGWLARASDCPICRNPINL Sbjct: 1 ... AKEEHECVICRDVLTEAAHLRCGHDFHVSCLKGWLARASDCPICRNPINL 50

  10. SPECIAL COLLECTIONS, PRIMARY RESOURCES, AND INFORMATION LITERACY PEDAGOGY

    National Research Council Canada - National Science Library

    Melissa A Hubbard; Megan Lotts

    2013-01-01

    ... an 8-week, credit- bearing information literacy course (CI 199) at Southern Illinois University Carbondale (SIUC). She structured the course to cover a wide selection of topics and to offer a range of activities to provide the best learning outcomes. She wanted her students to walk away from CI 199 knowing the library's resources as well how to use them for...

  11. Geochemical constraints on the hydrothermal origin of ferromanganese encrustations from the Rodriguez Triple Junction, Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Nath, B.N.; Pluger, W.L.; Roelandts, I.

    stream_size 13 stream_content_type text/plain stream_name Geol_Soc_Spl_Pub_(London)_1997_119_199.pdf.txt stream_source_info Geol_Soc_Spl_Pub_(London)_1997_119_199.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

  12. Tumor markers in pancreatic cancer: a European Group on Tumor Markers (EGTM) status report.

    LENUS (Irish Health Repository)

    Duffy, M J

    2012-02-01

    Pancreatic ductal adenocarcinoma is one of the most difficult malignancies to diagnose and treat. The aim of this article is to review how tumor markers can aid the diagnosis and management of patients with this malignancy. The most widely used and best validated marker for pancreatic cancer is CA 19-9. Inadequate sensitivity and specificity limit the use of CA 19-9 in the early diagnosis of pancreatic cancer. In non-jaundiced patients, however, CA 19-9 may complement other diagnostic procedures. In patients with resectable pancreatic cancer, presurgical and postresection CA 19-9 levels correlate with overall survival. In advanced disease, elevated pretreatment levels of CA 19-9 are associated with adverse patient outcome and thus may be combined with other factors for risk stratification. Most, but not all, reports indicate that serial levels of CA 19-9 correlate with response to systemic therapy. Use of CA 19-9 kinetics in conjunction with imaging is therefore recommended in monitoring therapy. Although several potential serum and tissue markers for pancreatic cancer are currently undergoing evaluation, none are sufficiently validated for routine clinical use. CA 19-9 thus remains the serum pancreatic cancer marker against which new markers for this malignancy should be judged.

  13. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 199 of 199 ... Vol 3, No 2 (2000), Research note on eradication of tsetse flies using the sterile insect technique: The case of Zanzibar and Mafia Island Tanzania, Abstract PDF. A Msanga .... Vol 5, No 1 (2002), The estimate of genetic correlation and heritability of various traits in small East African goats, Abstract PDF.

  14. Development of Antibodies Against Novel Cell Surface Proteins In Hormone Refractory Prostate Cancer. Addendum

    Science.gov (United States)

    2011-07-01

    et al. N-cadherin switching occurs in high Gleason grade prostate cancer. Prostate 66, 193-199 (2006). 5. Gravdal, K., Halvorsen , O.J., Haukaas, S.A...high Gleason grade prostate cancer. Prostate 66, 193–199 (2006). 20. Gravdal, K., Halvorsen , O.J., Haukaas, S.A. & Akslen, L.A. A switch from E-cadherin

  15. 75 FR 17402 - South Carolina Public Service Authority; Notice of Applications for Amendment of License and...

    Science.gov (United States)

    2010-04-06

    ... Energy Regulatory Commission South Carolina Public Service Authority; Notice of Applications for..., 199-221, and 199-222. c. Date Filed: March 26, 2010. d. Applicant: South Carolina Public Service... particular application. k. Description of Request: South Carolina Public Service Authority requests the...

  16. 26 CFR 15a.453-1 - Installment method reporting for sales of real property and casual sales of personal property.

    Science.gov (United States)

    2010-04-01

    ... and the $6 million 1982 payment ($47,822,020-$9 million) and gross profit is reduced to $22,199,115 by... a gross profit percentage of 57.18176% ($22,199,115/$38,822,020). Accordingly, of the $10 million... one year after the (July 1, 1981) date of sale shall be composed of an interest element and a...

  17. Vaccinia virus Vaccinia complement control protein: Multi-functional ...

    Indian Academy of Sciences (India)

    Unknown

    tissue of diabetic and fat fed animals: Effects of insulin and manganese. 215 .... Bioluminometric assay of ATP in mouse brain: Determinant factors for ... in wheat. 199. Kumar R see Kumar M. 199. Kumar R Sampath see Balasubramanyam M. 715. Kumar Vikrant. Status of Austro-Asiatic groups in the peopling of India: An.

  18. AcEST: DK955581 [AcEST

    Lifescience Database Archive (English)

    Full Text Available A 199 >sp|Q99P77|NOG1_RAT Nucleolar GTP-binding protein 1 OS=Rattus norvegicus GN=Gtpbp4 PE=2 SV=3 Length = ...ADVDVQPYA Sbjct: 181 KSSFINKVTRADVDVQPYA 199 >sp|Q99ME9|NOG1_MOUSE Nucleolar GTP-binding protein 1 OS=Mus musculus GN=Gtpb

  19. Drug: D10101 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D10101 Drug Crenezumab (USAN) C6348H9796N1688O2010S44 143242.3924 143330.6674 (Heav...-H'313, H'359-H'417, L23-L93, L139-L199, L'23-L'199) Peptide Treatment of Alzheimer's disease beta-amyloid CAS: 1095207-05-8 PubChem: 135626819 ...

  20. Unges Sverige

    DEFF Research Database (Denmark)

    Haarder, Jon Helt

    2007-01-01

    Mirja Unge: MOD URET (Motsols) Oversat fra svensk af Pia Juul 199 sider, 192 kr. Athene. Er udkommet. Fem stjerner Udgivelsesdato: 17.02......Mirja Unge: MOD URET (Motsols) Oversat fra svensk af Pia Juul 199 sider, 192 kr. Athene. Er udkommet. Fem stjerner Udgivelsesdato: 17.02...

  1. 76 FR 58202 - TRICARE; TRICARE Sanction Authority for Third-Party Billing Agents

    Science.gov (United States)

    2011-09-20

    ... authority under 32 CFR 199.9 to invoke sanctions in situations involving fraud or abuse on the part of... of the Secretary 32 CFR Part 199 RIN 0720-AB49 TRICARE; TRICARE Sanction Authority for Third-Party... authority to sanction third-party billing agents by invoking the administrative remedy of exclusion or...

  2. The Toxicity of Inhaled Sulphur Mustard

    Science.gov (United States)

    2012-03-01

    isodesmosine in biological fluids. J Chromatog B 1995; 668: 199-207. Reagents; 1. Desmosine– egg albumin (DEA) conjugate (EPC # DA855) 2. Desmosine...isodesmosine in biological fluids. J Chromatog B 1995; 668: 199-207. Reagents 1. Desmosine- egg albumin (DEA) conjugate. 2. Desmosine standard. 3

  3. Effects of various concentrations of gonadotropins and 17β estradiol ...

    African Journals Online (AJOL)

    The objective of this study was to determine the in vitro maturation rate of cattle oocytes selected with brilliant cresyl blue (BCB) stain, in tissue culture medium 199 (TCM 199) supplemented with various concentrations of hormones. Oocytes were retrieved from abattoir-derived ovaries by aspiration. Oocytes were then ...

  4. Radiopharmaceuticals for SPECT cancer detection

    Science.gov (United States)

    Chernov, V. I.; Medvedeva, A. A.; Zelchan, R. V.; Sinilkin, I. G.; Stasyuk, E. S.; Larionova, L. A.; Slonimskaya, E. M.; Choynzonov, E. L.

    2016-08-01

    The purpose of the study was to assess the efficacy of single photon emission computed tomography (SPECT) with 199Tl and 99mTc-MIBI in the detection of breast, laryngeal and hypopharyngeal cancers. A total of 220 patients were included into the study: 120 patients with breast lesions (100 patients with breast cancer and 20 patients with benign breast tumors) and 100 patients with laryngeal/hypopharyngeal diseases (80 patients with laryngeal/hypopharyngeal cancer and 20 patients with benign laryngeal/hypopharyngeal lesions). No abnormal 199Tl uptake was seen in all patients with benign breast and laryngeal lesions, indicating a 100% specificity of 199Tl SPECT. In the breast cancer patients, the increased 199Tl uptake in the breast was visualized in 94.8% patients, 99mTc-MIBI—in 93.4% patients. The increased 199Tl uptake in axillary lymph nodes was detected in 60% patients, and 99mTc-MIBI—in 93.1% patients. In patients with laryngeal/hypopharyngeal cancer, the sensitivity of SPECT with 199Tl and 99mTc-MIBI was 95%. The 199Tl SPECT sensitivity in identification of regional lymph node metastases in the patients with laryngeal/hypopharyngeal cancer was 75% and the 99mTc-MIBI SPECT sensitivity was 17%. The data obtained showed that SPECT with 199Tl and 99mTc-MIBI can be used as one of the additional imaging methods in detection of tumors.

  5. High neonatal blood iron content is associated with the risk of childhood type 1 diabetes mellitus

    DEFF Research Database (Denmark)

    Kyvsgaard, Julie Nyholm; Overgaard, Anne Julie; Thorsen, Steffen Ullitz

    2017-01-01

    with the risk of developing type 1 diabetes mellitus (T1D) in childhood; (2) Methods: A case-control study was conducted, including 199 children diagnosed with T1D before the age of 16 years from 1991 to 2005 and 199 controls matched on date of birth. Information on confounders was available in 181 cases...

  6. Alpha particle emitters in medicine

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, D.R.

    1989-09-01

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ({sup 211}At) and natural bismuth-212 ({sup 212}Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ({sup 223}Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs.

  7. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Directory of Open Access Journals (Sweden)

    Sherif S Nafee

    Full Text Available Thallium (81(217Tl, Bismuth (83(217Bi, Astatine (85(217At, Francium (87(217Fr, Actinium (89(217Ac and Protactinium (91(217Pa are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221Fr-, (221Ac- and (221Pa-α-decays.

  8. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Science.gov (United States)

    Nafee, Sherif S; Shaheen, Salem A; Al-Ramady, Amir M

    2016-01-01

    Thallium (81(217)Tl, Bismuth (83(217)Bi), Astatine (85(217)At), Francium (87(217)Fr), Actinium (89(217)Ac) and Protactinium (91(217)Pa) are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α) has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF) calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221)Fr-, (221)Ac- and (221)Pa-α-decays.

  9. On the theory of time dilation in chemical kinetics

    Science.gov (United States)

    Baig, Mirza Wasif

    2017-10-01

    The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

  10. SPECT assay of radiolabeled monoclonal antibodies. Progress report, September 1, 1992--August 24, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1993-08-20

    The overall goal of this project is to improve the effectiveness of single photon emission computed tomography (SPECT) to image and quantify radiolabeled monoclonal antibodies. During the past year, we have made significant progress toward this goal, and this report summarizes that work. Our efforts have been mainly directed along three fronts. First, we have developed and tested new reconstruction methods including three-dimensional iterative algorithms that model non-uniform attenuation and distance-dependent detector response. Both fan beam and parallel beam collimator geometries have been modeled and novel ways of improving the efficiency of the computationally intensive methods have been introduced. Second, an ultra-high resolution, small field-of-view pinhole collimator has been constructed and evaluated. Reconstructed spatial resolution of 1 to 3 mm (FWHM) has been achieved in phantom scans with a useful field-of-view of 9 to 10 cm. Finally, we have investigated the ability of SPECT to image and quantify astatine-211 distributions. Reconstructed images of phantom data demonstrated quantitative accuracy to within 10% with proper attenuation and scatter compensation.

  11. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Science.gov (United States)

    Marsh, B. A.; Andel, B.; Andreyev, A. N.; Antalic, S.; Atanasov, D.; Barzakh, A. E.; Bastin, B.; Borgmann, Ch.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Dehairs, M.; Derkx, X.; De Witte, H.; Fedorov, D. V.; Fedosseev, V. N.; Focker, G. J.; Fink, D. A.; Flanagan, K. T.; Franchoo, S.; Ghys, L.; Huyse, M.; Imai, N.; Kalaninova, Z.; Köster, U.; Kreim, S.; Kesteloot, N.; Kudryavtsev, Yu.; Lane, J.; Lecesne, N.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Molkanov, P. L.; Nicol, T.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Schweikhard, L.; Seliverstov, M. D.; Sels, S.; Sjödin, A. M.; Truesdale, V.; Van Beveren, C.; Van Duppen, P.; Wendt, K.; Wienholtz, F.; Wolf, R. N.; Zemlyanoy, S. G.

    2013-12-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  12. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  13. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  14. Evaluating 99mTc Auger electrons for targeted tumor radiotherapy by computational methods.

    Science.gov (United States)

    Tavares, Adriana Alexandre S; Tavares, João Manuel R S

    2010-07-01

    Technetium-99m (99mTc) has been widely used as an imaging agent but only recently has been considered for therapeutic applications. This study aims to analyze the potential use of 99mTc Auger electrons for targeted tumor radiotherapy by evaluating the DNA damage and its probability of correct repair and by studying the cellular kinetics, following 99mTc Auger electron irradiation in comparison to iodine-131 (131I) beta minus particles and astatine-211 (211At) alpha particle irradiation. Computational models were used to estimate the yield of DNA damage (fast Monte Carlo damage algorithm), the probability of correct repair (Monte Carlo excision repair algorithm), and cell kinetic effects (virtual cell radiobiology algorithm) after irradiation with the selected particles. The results obtained with the algorithms used suggested that 99mTc CKMMX (all M-shell Coster-Kroning--CK--and super-CK transitions) electrons and Auger MXY (all M-shell Auger transitions) have a therapeutic potential comparable to high linear energy transfer 211At alpha particles and higher than 131I beta minus particles. All the other 99mTc electrons had a therapeutic potential similar to 131I beta minus particles. 99mTc CKMMX electrons and Auger MXY presented a higher probability to induce apoptosis than 131I beta minus particles and a probability similar to 211At alpha particles. Based on the results here, 99mTc CKMMX electrons and Auger MXY are useful electrons for targeted tumor radiotherapy.

  15. Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

    Energy Technology Data Exchange (ETDEWEB)

    Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se

    2005-08-01

    Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

  16. Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

  17. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  18. Groundwater monitoring plan for the 183-H Solar Evaporation Basins

    Energy Technology Data Exchange (ETDEWEB)

    Hartman, M.J.

    1997-05-01

    Groundwater monitoring at the 183-H Solar Evaporation Basins is regulated under Washington Administrative Code 173-303-645. Proposed in this plan is the first phase of a final-status, corrective action monitoring program for the site. The monitoring network consists of four existing wells: 199-H4-3, 199-H4-7, 199-H4-12A, and 199-H4-12C. Well 199-H4-12C is completed at the base of the unconfined aquifer; the other wells are screened at the water table. Wells 199-H4-7 and 199-H4-12A are groundwater extraction wells used in a pump-and-treat system. Groundwater samples will be collected from each well annually. Samples will be analyzed for the following: (1) constituents of concern (i.e., chromium, nitrate, technetium-99, and uranium) and fluoride; (2) additional constituents to aid data interpretation (e.g., alkalinity, anions, and metals); and (3) field parameters routinely acquired at the wellhead (e.g., pH, specific conductance, temperature, and turbidity). The objective of monitoring during operation of the pump-and-treat system is to determine whether concentrations of the contaminants of concern are decreasing.

  19. Anaerobic in situ biodegradation of TNT using whey as an electron donor: a case study

    Czech Academy of Sciences Publication Activity Database

    Innemanová, P.; Velebová, R.; Filipová, Alena; Čvančarová, Monika; Pokorný, P.; Němeček, J.; Cajthaml, Tomáš

    2015-01-01

    Roč. 32, č. 6 (2015), s. 701-709 ISSN 1871-6784 Institutional support: RVO:61388971 Keywords : CONTAMINATED SOIL * BIOTRANSFORMATION * BIOREMEDIATION Subject RIV: EE - Microbiology, Virology Impact factor: 3.199, year: 2015

  20. Maxillary palp glomeruli and ipsilateral projections in the antennal ...

    Indian Academy of Sciences (India)

    Author Affiliations. K P Rajashekhar1 V R Shamprasad1 2. Department of Applied Zoology, Mangalore University, Mangalore 574 199, India; Max-Planck Institute for Neurobiology, Am Klopferspitz 18a, D-82152, Martinsreid, Germany ...

  1. Golgi analysis of tangential neurons in the lobula plate of Drosophila ...

    Indian Academy of Sciences (India)

    Author Affiliations. K P Rajashekhar1 V R Shamprasad1 2. Department of Applied Zoology, Mangalore University, Mangalore 574 199, India; Max-Planck Institute for Neurobiology, Am Klopferspitz 18A, D-82152, Planegg-Martinsried, Germany ...

  2. Anthelmintics as a risk factor in intestinal obstruction by Ascaris lumbricoides in children

    National Research Council Canada - National Science Library

    Vásquez Tsuji, O; Gutiérrez Castrellón, P; Yamazaki Nakashimada, M A; Arredondo Suárez, J C; Campos Riveral, T; Martínez Barbosa, I

    2000-01-01

    In a retrospective study the authors analyzed the clinical records of 199 children ages one month to 16 years hospitalized, with the diagnosis of intestinal ascariasis, in the Instituto Nacional de...

  3. Overexpression of hypoxia-inducible factor prolyl- hydoxylase ...

    African Journals Online (AJOL)

    Jane

    2011-08-08

    Aug 8, 2011 ... Tissue was digested in medium 199 (GIBCO, Grand Island,. NY, US ... sodium bicarbonate.) containing 1% ..... Control of ascorbic acid efflux in rat luteal cells: role of intracellular calcium ... acid expression in the primate ovary.

  4. AcEST: DK947137 [AcEST

    Lifescience Database Archive (English)

    Full Text Available , Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (199... Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST:

  5. Drug: D09952 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ACE VTHQGLSSPV TKSFNRGEC (Disulfide bridge: 23-93; 139-199; H130-L219, Dimer) Peptide Treatment of Alzheim...er's disease monoclonal antibody beta-amyloid CAS: 1178862-65-1 PubChem: 124490631 ...

  6. Handbook of the Birds of the World. Volume 10: Cuckoo-Shrikes to ...

    African Journals Online (AJOL)

    hbw.com 896 pages, 80 colour plates, over 400 colour photographs, 737 distribution maps, 6 000 bibliographical references, hardcover. ISBN 84 87334 72 5, price 199 € Ostrich 2007, 78(1): 111–112 ...

  7. Kolmnurkkelmus, vahendlikult toimepandud vargus ja nõude omastamine. Riigikohtu kriminaalkolleegiumi otsus 3-1-1-85-11 / Kristina Domaškina

    Index Scriptorium Estoniae

    Domaškina, Kristina

    2012-01-01

    Riigikohtu lahendist 3-1-1-85-11, mis käsitleb varguse, kelmuse ja omastamise objektiivsete koosseisude temaatikat. Materiaalõiguslikest küsimustest karistusseadustiku paragrahvide 199, 209 ja 201 järgi

  8. 76 FR 51998 - Announcement of Funding Awards for the Service Coordinators in Multifamily Housing Fiscal Year 2009

    Science.gov (United States)

    2011-08-19

    ... Salisbury St City: Worcester Assisted Units: 72 Amount: $226,811 State: Maryland Recipient: Bon Secours... Name: Portage Trail Village Address: 45 Cathedral Lane City: Cuyahoga Falls Assisted Units: 199 Amount...

  9. Cyclic AMP-independent secretion of mucin by SW1116 human colon carcinoma cells. Differential control by Ca2+ ionophore A23187 and arachidonic acid

    National Research Council Canada - National Science Library

    Yedgar, S; Eidelman, O; Malden, E; Roberts, D; Etcheberrigaray, R; Goping, G; Fox, C; Pollard, H B

    1992-01-01

    The regulation of mucin secretion by SW1116 human colon carcinoma cells has been studied using monoclonal antibody 19-9, which has previously been used to detect mucin in the serum of cancer and cystic fibrosis patients...

  10. Onchocerciasis situation in the Tukuyu focus of southwest Tanzania ...

    African Journals Online (AJOL)

    like chain, from Northeast Tanzania to Northern Malawi, from Tanga region to Ruvuma and south-western Mbeya regions (Raybould & White,. 1979; Maegga, 199] ). In Morogoro and Ruvuma regions, all district have hyperendemic communities,.

  11. First detection of chlorfenapyr (Secure) resistance in two-spotted spider mite (Acari: Tetranychidae) from nectarines in an Australian orchard.

    Science.gov (United States)

    Herron, G A; Rophail, J

    2003-01-01

    Chlorfenapyr resistance (2.9- and 19.9-fold respectively at LC50 and LC99 level) was detected in Tetranychus urticae Koch causing control failure following a single application of product to nectarines.

  12. AcEST: BP920569 [AcEST

    Lifescience Database Archive (English)

    Full Text Available -2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web..., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (199

  13. AcEST: BP912908 [AcEST

    Lifescience Database Archive (English)

    Full Text Available -2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web..., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (199

  14. A Mercury Frequency Standard Engineering Prototype for the NASA Deep Space Network

    Science.gov (United States)

    Tjoelker, R. L.; Bricker, C.; Diener, W.; Hamell, R. L.; Kirk, A.; Kuhnle, P.; Maleki, L.; Prestage, J. D.; Santiago, D.; Seidel, D.; hide

    1996-01-01

    An engineering prototype linear ion trap frequency standar (LITS-4) using (sup 199)Hg+ is operational and currently under test for NASA's Deep Space Network (DSN). The DSN requires high stability and reliability with continuous operation.

  15. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... now. Please try again later. Published on Jan 8, 2014 This vignette shares the story of Rachel— ... of Living While Dying - Duration: 2:20. HPCancer 8,199 views 2:20 Grief and nurses working ...

  16. Anti-leishmanial and Anti-cancer Activities of a Pentacyclic ...

    African Journals Online (AJOL)

    Erah

    azar patient [7] and maintained in golden hamsters by serial passage. Two months later, the hamster was sacrificed and its spleen isolated and macronized. The spleenic culture was made in Medium-199 (L- glutamine with Hepes buffer without.

  17. Impact of Dual Alum and Polyaluminum Chloride Coagulation on Filtration

    National Research Council Canada - National Science Library

    Haines, Michael

    2003-01-01

    ...) has been performed by at least one utility along the Colorado Front Range since the early 199Os. Previous bench-scale research with water containing low concentration of natural organic matter (NOM...

  18. 78 FR 53138 - South Carolina Public Service Authority; Notice of Meeting to Discuss Santee-Cooper Biological...

    Science.gov (United States)

    2013-08-28

    ...-Cooper Biological Opinion On July 15, 2010, the National Marine Fisheries Service (NMFS) filed its Biological Opinion (BO) on the relicensing of the Santee- Cooper Hydroelectric Project No. 199. The document...

  19. Temperature, salinity, and nutrients data from CTD and bottle casts in the North Atlantic Ocean from 01 April 1969 to 31 August 1995 (NODC Accession 0000426)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — CTD, bottle, and other data were collected from the CHARLES DARWIN and other vessels in the Atlantic Ocean from 01 April 1969 to 31 August 199. CTD data include...

  20. Detection of EGFR mutations in plasma and biopsies from non-small cell lung cancer patients by allele-specific PCR assays

    DEFF Research Database (Denmark)

    Weber, Britta; Meldgaard, Peter; Hager, Henrik

    2014-01-01

    samples with allele-specific PCR assays. METHODS: Pairs of the diagnostic biopsy and plasma obtained just prior to start of erlotinib treatment were collected from 199 patients with adenocarcinoma of non-small-cell lung cancer. DNA from both sample types was isolated and examined for the presence...... of mutations in exons 18-21 of the EGFR gene, employing the cobas(®) EGFR Tissue Test and cobas(®) EGFR Blood Test (in development, Roche Molecular Systems, Inc., CA, USA). RESULTS: Test results were obtained in all 199 (100%) plasma samples and 196/199 (98%) of the biopsies. EGFR-activating mutations were...... identified in 24/199 (12%) plasma samples and 28/196 (14%) biopsy samples, and 17/196 (9%) matched pairs contained the same mutation. Six EGFR mutations were present only in plasma samples but not in the biopsy samples. The overall concordance of the EGFR gene mutations detected in plasma and biopsy tissue...

  1. Immunoscintigraphy of colon carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Chatal, J.F.; Saccavini, J.C.; Fumoleau, P.; Douillard, J.Y.; Curtet, C.; Kremer, M.; Le Mevel, B.; Koprowski, H.

    1984-03-01

    Two I-131 labeled monoclonal antibodies that react specifically with human gastrointestinal cancers in cell cultures were administered to 90 cancer patients for the scintigraphic detection of cancer sites. Antibody 17-1A, or its F(ab')/sub 2/ fragments, accumulated significantly in 27 of 46 (59%) colorectal cancer sites, but not in 21 nonepitheliomatous colon cancers and cancers at other sites. Antibody 19-9, or its F(ab')/sub 2/ fragments, showed significant accumulation in 19 out of 29 (66%) colorectal cancer sites. In 17 patients, immunoscintigraphy with antibody 19-9 correlated with an immunoperoxidase study with the same antibody on resected tissue speciments. In 12 patients injected with two antibodies (17-1A + 19-9, or anti-CEA + 19-9), ten of 13 colorectal cancer sites were positive.

  2. Gclust Server: 97814 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences Related Sequences(199) 303 probable dihydrodipicolinate synthetase protein 1 9.98e-01 0.0 0.0 0.0...303 Representative annotation probable dihydrodipicolinate synthetase protein Number of Sequences 1 Homologs

  3. Ilmus Rein Neggo "Vastutuuli. I" / Hannes Oja

    Index Scriptorium Estoniae

    Oja, Hannes

    1999-01-01

    rets. rmt.: Vastutuuli. I : valimik EELK Los Angelese koguduse ajakirjas "Vastutuuli" (1950-1965) avaldatud kirjasõna / koostanud ja toimetanud Rein Neggo. Los Angeles : Eesti Evangeelse Luterliku Kiriku Los Angelese kogudus, 1999. 199 lk. : ill.

  4. Clean Hands Count

    Medline Plus

    Full Text Available ... Prevention (CDC) 199,340 views 1:04 Preventing Cancer Infections: Hand Washing - Duration: 0:57. Preventing Infections in Cancer Patients 643 views 0:57 Dettol Global Handwashing ...

  5. Comparison of different fertilisation media for an in vitro maturation?fertilisation?culture system using flow-cytometrically sorted X chromosome-bearing spermatozoa for bovine embryo production.

    Science.gov (United States)

    Ferré, Luis B; Bogliotti, Yanina; Chitwood, James L; Fresno, Cristóbal; Ortega, Hugo H; Kjelland, Michael E; Ross, Pablo J

    2015-05-13

    High demand exists among commercial cattle producers for in vitro-derived bovine embryos fertilised with female sex-sorted spermatozoa from high-value breeding stock. The aim of this study was to evaluate three fertilisation media, namely M199, synthetic oviductal fluid (SOF) and Tyrode's albumin-lactate-pyruvate (TALP), on IVF performance using female sex-sorted spermatozoa. In all, 1143, 1220 and 1041 cumulus-oocyte complexes were fertilised in M199, SOF and TALP, respectively. There were significant differences among fertilisation media (P fertilisation medium. Embryos derived from SOF and TALP fertilisation media had higher numbers of ICM, TE and total cells than those fertilised in M199. In conclusion, fertilisation media affected cleavage rate, as well as subsequent embryo development, quality and hatching ability. SOF and TALP fertilisation media produced significantly more embryos of higher quality than M199.

  6. Colombia's War on Drugs: Can Peru Provide the Recipe for Success

    National Research Council Canada - National Science Library

    Hobaugh, Michael

    2000-01-01

    This thesis examines counternarcotics strategies of interdiction, eradication, and alternative development used in Peru during the 199Os to determine if Peru's success can provide the recipe for success in Colombia...

  7. InterProScan Result: FS785763 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS785763 FS785763_5_ORF1 A39B199CC65DBE57 PANTHER PTHR11405:SF3 CARBAMOYL-PHOSPHATE...ocess (GO:0006520)|Molecular Function: carboxyl- or carbamoyltransferase activity (GO:0016743) ...

  8. Himmel Heilige [Hyperlinks

    OpenAIRE

    Hafner, Johann E.

    2000-01-01

    Himmel Heilige [Hyperlinks] : das CD-ROM-Projekt "Virtuelle Streifzüge durch den katholischen Kosmos" / Johann Ev. Hafner ... - In: Die Anwesenheit des Abwesenden / Peter Roth ... (Hg.). - Augsburg : Wißner, 2000. - S. 199-220

  9. PROCESSING OF CONCENTRATED AQUEOUS ZIRCONIA-BIOGLASS SLIPS BY SLIP CASTING

    National Research Council Canada - National Science Library

    Leon, Beltina

    2017-01-01

    ...) bioglass, were used to produce Y-TZP- bioglass slip cast compacts. The rheological properties of concentrated aqueous Y-TZP- 64S suspensions prepared with two different glass contents: 10.5 vol% and 19.9 vol...

  10. A multi-trait test of the leaf-height-seed plant strategy scheme with 133 species from a pine forest flora

    National Research Council Canada - National Science Library

    Daniel C. Laughlin; Jessica J. Leppert; Margaret M. Moore; Carolyn Hull Sieg

    2010-01-01

    1. Westoby's [Plant and Soil (1998), 199, 213] Leaf-Height-Seed (LHS) plant strategy scheme quantifies the strategy of a plant based on its location in a three-dimensional space defined by three functional traits...

  11. Drug: D10058 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available mer's disease Monoclonal antibody beta-amyloid map07056 Agents for Alzheimer-type dementia CAS: 955085-14-0 PubChem: 135626778 ... ... H362-H420, H'22-H'96, H'139-H'195, H'215-L'219, H'256-H'316, H'362-H'420, L23-L93, L139-L199, L'23-L'93, L'139-L'199) Peptide Alzhei

  12. The Soviet Nordic Nuclear Weapon Free Zone Proposal

    Science.gov (United States)

    1990-06-01

    contends, 2 0 3Purver, p. 31. 2 0 4Malcolm Mackintosh , "The Security Context: A Soviet View" Britain and NATO’s Northern Flank, Geoffrey Till, Ed...weaponry but the politics 2 2 7 Fred Halliday, James Sherr, ed. Soviet Power: The Continuing Challenge, p. 199. 2 2 8 Shultz, p. 325. 104 surrounding the...Nuclear Weapons" The Washington Quarterly, Winter 1986. Fred Halliday, James Sherr, ed., Soviet Power: The Continuing Challenge, p. 199. Thomas T

  13. Radiopharmaceuticals for SPECT cancer detection

    Energy Technology Data Exchange (ETDEWEB)

    Chernov, V. I., E-mail: chernov@oncology.tomsk.ru; Medvedeva, A. A., E-mail: tickayaAA@oncology.tomsk.ru; Zelchan, R. V., E-mail: r.zelchan@yandex.ru; Sinilkin, I. G., E-mail: sinilkinig@oncology.tomsk.ru [Tomsk Cancer Research Institute, Kooperativny Street 5, Tomsk, 634050 (Russian Federation); Tomsk Polytechnic University, Lenin Avenue 30, Tomsk, 634050 (Russian Federation); Stasyuk, E. S.; Larionova, L. A. [Tomsk Polytechnic University, Lenin Avenue 30, Tomsk, 634050 (Russian Federation); Slonimskaya, E. M.; Choynzonov, E. L. [Tomsk Cancer Research Institute, Kooperativny Street 5, Tomsk, 634050 (Russian Federation)

    2016-08-02

    The purpose of the study was to assess the efficacy of single photon emission computed tomography (SPECT) with {sup 199}Tl and {sup 99}mTc-MIBI in the detection of breast, laryngeal and hypopharyngeal cancers. A total of 220 patients were included into the study: 120 patients with breast lesions (100 patients with breast cancer and 20 patients with benign breast tumors) and 100 patients with laryngeal/hypopharyngeal diseases (80 patients with laryngeal/hypopharyngeal cancer and 20 patients with benign laryngeal/hypopharyngeal lesions). No abnormal {sup 199}Tl uptake was seen in all patients with benign breast and laryngeal lesions, indicating a 100% specificity of {sup 199}Tl SPECT. In the breast cancer patients, the increased {sup 199}Tl uptake in the breast was visualized in 94.8% patients, {sup 99m}Tc-MIBI—in 93.4% patients. The increased {sup 199}Tl uptake in axillary lymph nodes was detected in 60% patients, and {sup 99m}Tc-MIBI—in 93.1% patients. In patients with laryngeal/hypopharyngeal cancer, the sensitivity of SPECT with {sup 199}Tl and {sup 99m}Tc-MIBI was 95%. The {sup 199}Tl SPECT sensitivity in identification of regional lymph node metastases in the patients with laryngeal/hypopharyngeal cancer was 75% and the {sup 99m}Tc-MIBI SPECT sensitivity was 17%. The data obtained showed that SPECT with {sup 199}Tl and {sup 99m}Tc-MIBI can be used as one of the additional imaging methods in detection of tumors.

  14. Anthropomorphic Interfaces on Automation Trust, Dependence, and Performance inYounger and Older Adults

    Science.gov (United States)

    2015-10-26

    witnesses and its relation to ageism . Behavioral Sciences and the Law, 25, 355-375. Nass, C., & Lee, K. M. (2001). Does computer-generated speech...23. Perdue, C. W., & Gurtman, M. B. (1990). Evidence for the automaticity of ageism . Journal of Experimental Social Psychology, 26(3), 199-216...B. Gurtman. 1990. “Evidence for the Automaticity of Ageism .” Journal of Experimental Social Psychology 26 (3): 199–216. Posthuma, R. A., and M. A

  15. Optimizing MIBG therapy of neuroendocrine tumors: preclinical evidence of dose maximization and synergy

    Energy Technology Data Exchange (ETDEWEB)

    Mairs, Rob J. [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)], E-mail: r.mairs@beatson.gla.ac.uk; Boyd, Marie [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)

    2008-08-15

    [{sup 131}I]meta-Iodobenzylguanidine ([{sup 131}I]MIBG) has been used for the therapy of tumors of neuroectodermal origin since the 1980s. Its role in the management of these malignancies remains controversial because of the large variation in response rates. Appreciation of the mode of conveyance of [{sup 131}I]MIBG via the noradrenaline transporter into malignant cells and of factors that influence the activity of the uptake mechanism has indicated various ways in which the effectiveness of this type of targeted radiotherapy may be improved. Experimental observations indicate that radiolabeling of MIBG to high specific activity reduced the amount of cold competitor, thereby increasing tumor dose and minimizing pressor effects. We observed supra-additive tumor cell kill and inhibition of tumor growth following combined topotecan and [{sup 131}I]MIBG treatment. The improved efficacy is related to topotecan's increased disruption of DNA repair. Radiation damage to targeted tumors may also be enhanced by the use of the {alpha}-particle emitter [{sup 211}At]astatine rather than {sup 131}I as radiolabel. Furthermore, recent experimental findings indicate that [{sup 123}I]MIBG may have therapeutic potential over and above its utility as an imaging agent. It has recently been demonstrated that potent cytotoxic bystander effects were induced by the intracellular concentration of [{sup 131}I]MIBG, [{sup 123}I]MIBG or meta-[{sup 211}At]astatobenzylguanidine. Identification of the nature of bystander factors could be exploited to maximize the specificity and potency of MIBG-targeted radiotherapy. By employing a range of strategies, there are good prospects for the improvement of the [{sup 131}I]MIBG therapy of neuroectodermal tumors.

  16. Immuno-vectorization of radioelements emitters of alpha particles: a new therapy in cancerology; Immunovectorisation de radioelements emetteurs de particules alpha: une nouvelle voie therapeutique en cancerologie

    Energy Technology Data Exchange (ETDEWEB)

    Bourgeois, M

    2007-05-15

    The radio-immunotherapy is an anti cancerous therapy which consists in vectorising with immuno-specific agents very radio toxic radioelements on tumors or in their environment to destroy them. The first part of this report presents the different characteristics of antibodies as well as their means of production under monoclonal shapes specifically steered against a tumoral antigen of interest. The second part of this report replaces the importance of the immunological vectors in the context of the nuclear medicine. It is notably described that the different methods which allow to radio-label the vector, as well as the different ways of optimization which were envisaged to improve the targeting of radioelements on a tumor. These different developments allow to define the potential place of the alpha radio-immunotherapy in treatments and so re-place the interest of the experimental part. If the radio-immunotherapy, using beta emitters isotopes as the {sup 131}iodine or the{sup 90}yttrium, is today current in anti cancerous therapy, it finds limits because of the disintegration characteristics of the isotopes it uses. Indeed, compared with alpha particles, the beta particles deposit less energy by unit of length in the crossed material.The experimental part of this report aims at studying the feasibility of the coupling between an immunological vector and an alpha emitter isotope.The different tests led on the bismuth 213, the bismuth 212, the lead 212 and the astatine 211 demonstrated that the fixation of these radionuclides was possible. This research theme is strengthened by the construction in Nantes of a cyclotron with high energy ( A.R.R.O.N.A.X.) and the optimization of the obtained promising results should allow a therapeutic use in oncology of the alpha radio-immunotherapy. (N.C.)

  17. Locoregional therapy with α-emitting trastuzumab against peritoneal metastasis of human epidermal growth factor receptor 2-positive gastric cancer in mice.

    Science.gov (United States)

    Li, Huizi Keiko; Morokoshi, Yukie; Nagatsu, Kotaro; Kamada, Tadashi; Hasegawa, Sumitaka

    2017-08-01

    Peritoneal metastasis of gastric cancer (PMGC) is incurable and thus has an extremely poor prognosis. We have found, however, that locoregionally administered trastuzumab armed with astatine-211 ((211) At-trastuzumab) is effective against human epidermal growth factor receptor 2 (HER2)-positive PMGC in a xenograft mouse model. We first observed that (211) At-trastuzumab can specifically bind and effectively kill NCI-N87 (N87) cells, which are HER2-positive human metastatic GC cells, both in vitro and in s.c. tumors. We established a PMGC mouse model using N87 xenografts stably expressing luciferase to test α-particle radioimmunotherapy with (211) At-trastuzumab against PMGC. Biodistribution analysis in this PMGC mouse model revealed that the i.p. administration of (211) At-trastuzumab (1 MBq) was a more efficient means of delivery of (211) At into metastatic tumors than i.v. injection; the maximum tumor uptake with i.p. administration was over 60% injected dose per gram of tissue (%ID/g) compared to approximately 18%ID/g with i.v. injection. Surprisingly, a single i.p. injection of (211) At-trastuzumab (1 MBq) was sufficient to completely eradicate intraperitoneally disseminated HER2-positive GC xenografts in two of six treated mice by inducing DNA double-strand breaks, and to drastically reduce the tumor burden in another three mice. No bodyweight loss, leukocytopenia, or significant biochemical changes in liver or kidney function were observed in the treatment group. Accordingly, locoregionally administered (211) At-trastuzumab significantly prolonged the survival time of HER2-positive PMGC mice compared with control treatments. Our results provide a proof-of-concept demonstration that locoregional therapy with (211) At-trastuzumab may offer a new treatment option for HER2-positive PMGC. © 2017 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.

  18. Effect of Fibroblast Growth Factor 2 (FGF2 and Insulin Transferrin Selenium (ITS on In Vitro Maturation, Fertilization and Embryo Development in Sheep

    Directory of Open Access Journals (Sweden)

    Sukanta Mondal

    2015-08-01

    Full Text Available The present study evaluated the effect of fibroblast growth factor 2 (FGF2 and insulin-transferrin-selenium (ITS to the in vitro maturation and embryo culture media on ovine oocyte maturation, cleavage and embryo development. Oocytes having more than five layers of unexpanded cumulus cells and granular homogenous ooplasm were cultured into 50 μL droplets of eight different culture systems: (i TCM-199 (Tissue Culture Medium-199; (ii TCM-199+10 ng/mL FGF2; (iii TCM-199+20 ng/mL FGF2; (iv TCM-199+30 ng/mL FGF2; (v TCM-199+10 ng/mL ITS; (vi TCM-199+20 ng/mL ITS; (vii TCM-199+30 ng/mL ITS and (viii TCM-199+20 ng/mL ITS+20 ng/mL FGF2 in a CO2 incubator at 38.50C for 24 h. All the oocyte culture media were supplemented with 10% FBS, FSH (10 μg/mL and gentamicin (50 µg/mL. The maturation rate was assessed based on the degree of expansion of cumulus cells and identifying first polar body extrusion into perivitelline space. The matured oocytes were inseminated with 1 to 2 million spermatozoa/mL in Brackett and Oliphant medium and the cleavage rate was checked after 42-48 h post insemination and further cultured for 6-7 days. Maturation and cleavage rates were significantly higher (P<0.05 in the oocytes cultured in TCM-199 +10% FBS+FSH (10 μg/mL supplemented with both 20 ng/mL ITS and 20 ng/mL FGF2 as compared to the control. It was concluded that the supplementation of ITS and FGF2 in maturation medium was beneficial for improving maturation and cleavage rates of sheep oocytes. The addition of ITS and FGF2 in embryo culture medium did not improve the development of sheep embryos.

  19. Renovação parcial do meio de cultura como perspectiva de aumentar a eficiência de um sistema de cocultoura de embriões sem fluxo contínuo de CO2 Partial replacement of the culture medium in order to enhance a embryos coculture system without continuous CO2 flow

    Directory of Open Access Journals (Sweden)

    Marcos Antônio Lemos Oliveira

    1996-12-01

    Full Text Available Substituindo-se parcialmente (30% os meios de cultura TC M 199/NaHCO3 (199/NaHCO3 e TC M 199/25mM HEPES (199/HEPES a intervalos de 24, 48 ou 72 horas, testou-se a possibilidade de incrementar a obtenção de blastocistos expandidos (BLE a partir de embriões Mus musculus no estádio de duas células incubados sem fluxo contínuo de CO2. Após distribuição aleatória dos embriões em tubos de ensaio contendo 2ml de meio de cultura e monocamada celular de oviduto bovino, os referidos tubos foram hermeticamente fechados e colocados em estufa bacteriológica a 37°C durante 96 horas. A renovação do meio de cultura em qualquer período não incrementou a porcentagem de embriões que alcançou o estádio de BLE, todavia, o número total de BLE obtido com o 199/HEPES (79,0% foi superior (P £ 0,01 ao verificado com o 199/NaHCO3 (65,0%.It has been evaluated, in a coculture system without continuous CO2 flow, the possibility to enhance the percentage of blastocists obtained from two cells mouse embryos by partial (30% replacement (each 24, 48 and 72 hours of intervals of two culture media (TCM 199/NaHCO3 and TCM 199/25 mM HEPES. The embryos, randomiy allocated in closed cultures tubes with 2 ml of medium and bovine oviduct monolayer, were maintained at 37°C during 96 hours. No diferences between spreaded blastocists were verifica when the media were replaced at ali intervals, however, the medium TCM 199/25mM HEPES was significantiy more effective (P £ 0.01 then TCM 199/NaHCO3.

  20. An ultrasensitive multi-walled carbon nanotube-platinum-luminol nanocomposite-based electrochemiluminescence immunosensor.

    Science.gov (United States)

    Zhang, Xin; Ke, Hong; Wang, Zhiming; Guo, Weiwei; Zhang, Amin; Huang, Chusen; Jia, Nengqin

    2017-06-12

    An ultrasensitive electrochemiluminescence (ECL) immunosensor for carbohydrate antigen 19-9 (CA19-9) detection using multi-walled carbon nanotube-platinum-luminol nanocomposites (MWCNT-Pt-luminol) as nanointerface and signal tags was designed. First, the MWCNT-Pt-luminol nanocomposite was decorated on the surface of a glassy carbon electrode (GCE) through the film-forming properties of chitosan (Chi). Then, the CA19-9 antibody (anti-CA19-9) was attached to the modified electrode surface via crosslinking with glutaraldehyde (GA). When CA19-9 was captured by its antibody immobilized on the immune platform via immunoreaction, the ECL signal intensity decreased. Under optimal conditions, the proposed ECL immunosensor showed excellent performance for CA19-9 ranging from 0.0001 U mL-1 to 10.0 U mL-1, with a detection limit of 0.000046 U mL-1 (S/N = 3) and a correlation coefficient of R = 0.9980. This is attributed to the fact that the MWCNTs-Pt nanomaterial has excellent conductivity and it could facilitate the decomposition of H2O2 to generate various reactive oxygen species (ROSs); thus, the ECL signals of luminol were effectively amplified and the sensitivity of the sensor was greatly increased. The prepared ECL immunosensor displayed simple, fast analysis, excellent stability, good reproducibility, and high specificity. Moreover, the developed ECL immunosensor provided satisfactory results in the determination of CA19-9 in real human serum samples.

  1. Cortisol influence on testicular testosterone secretion in domestic cat: An in vitro study Ação do cortisol sobre a secreção de testosterona em testículos de gato doméstico: um estudo in vitro

    Directory of Open Access Journals (Sweden)

    Gelson Genaro

    2010-10-01

    Full Text Available The aim of the present experiment was to investigate the effect of corticosteroids (exogen on in vitro testosterone secretion after stress by transportation (40 minutes. Feline testes (Felis silvestris catus were incubated in the following media: TCM 199; TCM 199 + hCG 10_7M; TCM 199 + hydrocortisone 10_7M, or TCM 199 + hCG + hydrocortisone. The animals (n=21 were allocated into three groups: (S that arrived at 3 h prior to surgery, (A that remained in the laboratory for 36 h before being submitted to surgical procedure, and (C that were also allowed to remain for 36 hours in the laboratory before the surgical procedure, but whose testes had been incubated with hydrocortisone prior to incubation in the referred media. The results showed that group S secreted higher levels of testosterone, regardless of the culture media. It is noteworthy that the suppressing action of hydrocortisone sodium succinate led to a reduction in the testosterone concentration, despite the presence of hCG.O objetivo deste trabalho foi investigar o efeito da hidrocortisona sobre a secreção de testosterona após cultivo in vitro dos testículos, em distintas situações de estresse (transporte de gatos domésticos (Felis silvestris catus. Testículos foram incubados nos seguintes meios de cultura: TCM 199; TCM 199 + hCG 10_7M; TCM 199 + hydrocortisona 10_7M e TCM 199 + hCG + hidrocortisona. Os animais (n=21 foram alocados em 3 sub-grupos: (S animal admitido 3 horas antes da orquiectomia, (A animais orquiectomizados após 36 horas de permanência no biotério e (C animais que permaneceram por 36 horas no biotério antes da cirurgia e que tiveram seus testículos pré-incubados em hidrocortisona. Os resultados demonstraram que o grupo S secretou maiores valores de testosterona em todas as condições estudadas. É válido mencionar que a supressão promovida pela hidrocortisona também promoveu redução na concentração de testosterona no meio TCM 199, a despeito da

  2. Preclinical characterization of recombinant human tissue kallikrein-1 as a novel treatment for type 2 diabetes mellitus.

    Directory of Open Access Journals (Sweden)

    Tadeusz Kolodka

    Full Text Available Modulation of the kallikrein-kinin system (KKS has been shown to have beneficial effects on glucose homeostasis and several other physiological responses relevant to the progression of type 2 diabetes mellitus (T2D. The importance of bradykinin and its receptors in mediating these responses is well documented, but the role of tissue kallikrein-1, the protease that generates bradykinin in situ, is much less understood. We developed and tested DM199, recombinant human tissue kallikrein-1 protein (rhKLK-1, as a potential novel therapeutic for T2D. Hyperinsulinemic-euglycemic clamp studies suggest that DM199 increases whole body glucose disposal in non-diabetic rats. Single-dose administration of DM199 in obese db/db mice and ZDF rats, showed an acute, dose-dependent improvement in whole-body glucose utilization. Sub-acute dosing for a week in ZDF rats improved glucose utilization, with a concomitant rise in fasting insulin levels and HOMA1-%B scores. After cessation of sub-acute dosing, fasting blood glucose levels were significantly lower in ZDF rats during a drug wash-out period. Our studies show for the first time that DM199 administration results in acute anti-hyperglycemic effects in several preclinical models, and demonstrate the potential for further development of DM199 as a novel therapeutic for T2D.

  3. Effects of the cofactor binding sites on the activities of secondary alcohol dehydrogenase (SADH).

    Science.gov (United States)

    Wang, Tao; Chen, Xiangjun; Han, Jun; Ma, Sichun; Wang, Jianmei; Li, Xufeng; Zhang, Hui; Liu, Zhibin; Yang, Yi

    2016-07-01

    SADHs from Thermoanaerobacter ethanolicus are enzymes that, together with various cofactors, catalyze the reversible reduction of carbonyl compounds to their corresponding alcohols. To explore how cofactors bind to SADH, TeSADH was cloned in this study, and Ser(199) and Arg(200) were replaced by Tyr and Asp, respectively. Both sites were expected to be inside or adjacent to the cofactor-binding domain according to computational a prediction. Analysis of TeSADH activities revealed that the enzymatic efficiency (kcat/Km) of the S199Y mutant was noticeably enhanced using by NADH, NADPH as cofactors, and similar with that of wild-type using by NADP(+), NAD(+). Conversely, the activity of the R200D mutant significantly decreased with all cofactors. Furthermore, in yeast, the S199Y mutant substantially elevated the ethanol concentration compared with the wild type. Molecular dynamics simulation results indicated the H-bonding network between TeSADH and the cofactors was stronger for the S199Y mutant and the binding energy was simultaneously increased. Moreover, the fluorescence results indicated the S199Y mutant exhibited an increased preference for NAD(P)H, binding with NAD(P)H more compactly compared with wild type. Copyright © 2016 Elsevier B.V. All rights reserved.

  4. μPAD Fluorescence Scattering Immunoagglutination Assay for Cancer Biomarkers from Blood and Serum.

    Science.gov (United States)

    Baynes, Cayla; Yoon, Jeong-Yeol

    2017-09-01

    A microfluidic paper analytical device (μPAD) was created for the sensitive quantification of cancer antigens, carcinoembryonic antigen (CEA) and carbohydrate antigen 19-9 (CA 19-9), from human whole blood and serum, toward diagnosis and prognosis of colorectal cancer. Anti-CEA and anti-CA 19-9 antibodies were covalently linked to submicron, fluorescent polystyrene particles, loaded, and then dried in the center of the μPAD channel. CEA- or CA 19-9-spiked blood or serum samples were loaded to the inlet of μPAD, and subsequent immunoagglutination changed the fluorescent scatter signals upon ultraviolet (UV) excitation. The total assay time was about 1 min. Detection limits were 1 pg/mL for CEA and 0.1 U/mL for CA 19-9 from both 10% diluted blood and undiluted serum. The use of UV excitation and subsequent fluorescence scattering enabled much higher double-normalized intensities (up to 1.28-3.51, compared with 1.067 with the elastic Mie scatter detection), successful detection in the presence of blood or serum, and distinct multiplex assays with minimum cross-reaction of antibodies. The results with undiluted serum showed the larger dynamic range and smaller standard errors, which can be attributed to the presence of serum proteins, functioning as a stabilizer or a passivating protein for the particles within paper fibers.

  5. EFFECT OF CYSTEAMINE ON THE RATE OF IN VITRO MATURATION OF OOCYTES IN TWO MEDIA

    Directory of Open Access Journals (Sweden)

    A. Mohammadi-Rousheh

    2006-07-01

    Full Text Available Rate of in vitro maturation of oocytes is one of the challenges of assisted reproductive techniques. In this study we investigated the effects of supplementation of cysteamine on the rate of in vitro maturation of oocytes in two different media. Germinal vesicle oocytes were collected from mouse ovary and cultured in two media (TCM199 and MEME with 0, 50, 100, 200, 500 µM/ml cysteamine. Number of germinal vesicle breakdowns and metaphase II oocytes were recorded. The results showed that the rate of in vitro maturation in 100 µM/ml cysteamine was significantly higher compared to control (P < 0.05. Evaluation of two media in this study showed that TCM199 improved the rate of in vitro maturation and oocyte maturation better than MEME; however, this difference was not statistically significant. These findings indicate that TCM199 as compared to MEME was better in rate of in vitro maturation of oocytes.

  6. Gene expression changes during Giardia-host cell interactions in serum-free medium.

    Science.gov (United States)

    Ferella, Marcela; Davids, Barbara J; Cipriano, Michael J; Birkeland, Shanda R; Palm, Daniel; Gillin, Frances D; McArthur, Andrew G; Svärd, Staffan

    2014-10-01

    Serial Analysis of Gene Expression (SAGE) was used to quantify transcriptional changes in Giardia intestinalis during its interaction with human intestinal epithelial cells (IECs, HT-29) in serum free M199 medium. Transcriptional changes were compared to those in trophozoites alone in M199 and in TYI-S-33 Giardia growth medium. In total, 90 genes were differentially expressed, mainly those involved in cellular redox homeostasis, metabolism and small molecule transport but also cysteine proteases and structural proteins of the giardin family. Only 29 genes changed their expression due to IEC interaction and the rest were due to M199 medium. Although our findings generated a small dataset, it was consistent with our earlier microarray studies performed under different interaction conditions. This study has confined the number of genes in Giardia to a small subset that specifically change their expression due to interaction with IECs. Copyright © 2014 Elsevier B.V. All rights reserved.

  7. An Unusual Presentation of Isolated Leptomeningeal Disease in Carcinoma of Unknown Primary With Pancreatic Features

    Directory of Open Access Journals (Sweden)

    Madhurima Anne MD

    2013-06-01

    Full Text Available Leptomeningeal disease (LMD can occur in a small percentage of patients with active metastatic cancer. However, we report a case of LMD occurring during disease remission in a patient with carcinoma of unknown primary with panreaticobiliary features. A 45-year-old woman was found with mediastinal and abdominal lymphadenopathy with lymph node biopsy consistent with adenocarcinoma, expressing immunomarkers CK7, CK20, and Ca19-9 along with markedly elevated serum Ca19-9 level. The patient was started on a pancreatic cancer directed chemotherapy regimen of Folfirinox (5-fluorouracil, leucovorin, oxaliplatin, irinotecan and achieved complete response. She was then noted to have slowly rising Ca19-9 level that did not correlate with her lack of evidence of systemic disease progression. Eventually, she presented with neurologic symptoms and was found on imaging to have isolated LMD.

  8. Effect of medium composition on the in vitro culture of bovine pre-antral follicles: morphology and viability do not guarantee functionality.

    Science.gov (United States)

    Rossetto, Rafael; Saraiva, Márcia Viviane Alves; dos Santos, Regiane Rodrigues; da Silva, Cleidson Manoel Gomes; Faustino, Luciana Rocha; Chaves, Roberta Nogueira; Brito, Ivina Rocha; Rodrigues, Giovanna Quintino; Lima, Isadora Machado Teixeira; Donato, Mariana Aragão Matos; Peixoto, Christina Alves; de Figueiredo, José Ricardo

    2013-05-01

    Summary This study investigated the effect of three different culture media (α minimum essential medium (α-MEM), McCoy or TCM199 during the in vitro culture (IVC) of bovine isolated pre-antral follicles. Pre-antral follicles greater than 150 μm in size were isolated and cultured for 0 (control), 8 or 16 days in one of the abovementioned culture media. Follicles were evaluated for survival, growth and antrum formation at days 8 and 16. The results showed that TCM199 was the most suitable medium to preserve follicular viability and ultrastructure, resulting in the highest rates of antrum formation. In conclusion, TCM199 promotes the in vitro development of isolated pre-antral follicles without hampering follicular functionality by sustaining in vitro growth and antrum formation.

  9. Sequential Validation of Blood-Based Protein Biomarker Candidates for Early-Stage Pancreatic Cancer.

    Science.gov (United States)

    Capello, Michela; Bantis, Leonidas E; Scelo, Ghislaine; Zhao, Yang; Li, Peng; Dhillon, Dilsher S; Patel, Nikul J; Kundnani, Deepali L; Wang, Hong; Abbruzzese, James L; Maitra, Anirban; Tempero, Margaret A; Brand, Randall; Firpo, Matthew A; Mulvihill, Sean J; Katz, Matthew H; Brennan, Paul; Feng, Ziding; Taguchi, Ayumu; Hanash, Samir M

    2017-04-01

    CA19-9, which is currently in clinical use as a pancreatic ductal adenocarcinoma (PDAC) biomarker, has limited performance in detecting early-stage disease. We and others have identified protein biomarker candidates that have the potential to complement CA19-9. We have carried out sequential validations starting with 17 protein biomarker candidates to determine which markers and marker combination would improve detection of early-stage disease compared with CA19-9 alone. Candidate biomarkers were subjected to enzyme-linked immunosorbent assay based sequential validation using independent multiple sample cohorts consisting of PDAC cases (n = 187), benign pancreatic disease (n = 93), and healthy controls (n = 169). A biomarker panel for early-stage PDAC was developed based on a logistic regression model. All statistical tests for the results presented below were one-sided. Six out of the 17 biomarker candidates and CA19-9 were validated in a sample set consisting of 75 PDAC patients, 27 healthy subjects, and 19 chronic pancreatitis patients. A second independent set of 73 early-stage PDAC patients, 60 healthy subjects, and 74 benign pancreatic disease patients (combined validation set) yielded a model that consisted of TIMP1, LRG1, and CA19-9. Additional blinded testing of the model was done using an independent set of plasma samples from 39 resectable PDAC patients and 82 matched healthy subjects (test set). The model yielded areas under the curve (AUCs) of 0.949 (95% confidence interval [CI] = 0.917 to 0.981) and 0.887 (95% CI = 0.817 to 0.957) with sensitivities of 0.849 and 0.667 at 95% specificity in discriminating early-stage PDAC vs healthy subjects in the combined validation and test sets, respectively. The performance of the biomarker panel was statistically significantly improved compared with CA19-9 alone (P early-stage PDAC.

  10. Epidermoid cyst in an intrapancreatic accessory spleen: three case reports and review of the literatures.

    Science.gov (United States)

    Kadota, Kyuichi; Kushida, Yoshio; Miyai, Yumi; Katsuki, Naomi; Hayashi, Toshitetsu; Bando, Kenji; Shibuya, Shinsuke; Haba, Reiji

    2010-09-01

    The development of an epidermoid cyst in an intrapancreatic accessory spleen is an extremely rare lesion, with only 17 cases being reported in the English literature. All such cases were located in the pancreatic tail, some of which showed carbohydrate antigen 19-9 (CA19-9) immunoreactivity in the lining of the epithelium. A few of them indicated an elevation of the serum CA19-9 level. Here we report three cases of an epidermoid cyst in an intrapancreatic accessory spleen. Cases 1 and 2 were 57-year-old and 70-year-old women, while case 3 was a 37-year-old man. All three cases were asymptomatic. Serum CA19-9 levels showed within normal limits (case 1), slightly elevated (case 2), and clearly elevated (case 3). They underwent a distal pancreatectomy with splenectomy (cases 1 and 2) and without splenectomy (case 3). Grossly, the surgical specimen was a well-demarcated, multiple (case 1) or solitary (cases 2 and 3) cystic mass in the pancreatic tail. A high level of fluid CA 19-9 was detected in case 1. Microscopically, the cystic walls were lined with squamous and cuboidal epithelium, which were surrounded by normal splenic tissue and hyalinized fibrous tissue. The lining squamous epithelium was revealed as nonkeratinizing (Cases 1 and 2) or keratinizing (Case 3). Immunohistochemically, CA19-9 was positive in the monolayer and surface layer of the cuboidal epithelium, but negative for the keratinizing squamous epithelium. As for the histogenesis, it is suggested that the cystic lining of the epithelium may derive from the pancreatic duct which protrudes into the accessory spleen.

  11. Nuclear medicine in breast cancer diagnostics: Primary tumor and lymphatic metastasis

    Science.gov (United States)

    Sinilkin, I.; Medvedeva, A.; Chernov, V.; Slonimskaya, E.; Zelchan, R.; Bragina, O.

    2017-09-01

    The purpose of the study: to assess the possibility of using nuclear medicine techniques at the stages of diagnosis and treatment of breast cancer. Materials and Methods: The study included 290 patients with breast cancer and 70 patients with benign breast tumors. The study was used as a radiopharmaceutical 99mTc-MIBI, 199Tl for imaging tumors and colloid 99mTc-Aloteh for visualization sentinel lymph nodes (SLN), colloid was injected peritumoral in four points to 80 MBq one day prior to the planned operation. Results: The sensitivity of SPECT using both 99mTc-MIBI and 199Tl for breast cancer detection was shown to be rather high, being 98.5% and 98%, respectively. It should be noted that the sensitivity of SPECT in detection of small tumors (less than 1 cm in diameter) and multicentric tumors was not high irrespective of the radioisotope used (60% and 65% with 99mTc-MIBI and 65% and 59% with 199Tl, respectively). The difference in the sensitivity was found between 99mTc-MIBI and 199T for the detection of regional lymph node metastasis (91% vs 70%). SLN were detected in 31 patients. The most commonly SLN were defined in the axillary region of 96.7%. In 22 (70.9%) patients there was no metastasis SLN. The sensitivity of the method was 91.2%, specificity of 100%. Conclusion: The specificity of SPECT with 199Tl was higher than that with 99mTc-MIBI. The data obtained show that SPECT with 199Tl can be recommended for its use as an additional breast cancer detection method in cases when other imaging techniques and histological findings are not accurate enough. The clinical study of 99mTc-Aloteh, a new radiopharmaceutical agent, has shown that the studied colloid has high uptake level in SLN and can be successfully used for visualization of SLN in patients with breast cancer.

  12. Effect of Somatic Cell Types and Culture Medium on in vitro Maturation, Fertilization and Early Development Capability of Buffalo Oocytes

    Directory of Open Access Journals (Sweden)

    H. Jamil*, H. A. Samad, N. Rehman, Z. I. Qureshi and L. A. Lodhi

    2011-04-01

    Full Text Available This study was designed to evaluate the efficacy of different somatic cell types and media in supporting in vitro maturation (IVM, in vitro fertilization (IVF and early embryonic development competence of buffalo follicular oocytes. Cumulus oocyte complexes were collected for maturation from follicles (>6mm of buffalo ovaries collected at the local abattoir. Oocytes were co-cultured in tissue culture medium (TCM-199 with either granulosa cells, cumulus cells, or buffalo oviductal epithelial cells (BOEC @ 3x106 cells/ml or in TCM-199 without helper cells (control at 39°C and 5%CO2 in humidified air. Fresh semen was prepared in modified Ca++ free Tyrode medium. Fertilization was carried out in four types of media: i Tyrode lactate albumin pyruvate (TALP, ii TALP+BOEC, iii modified Ca++ free Tyrode and iv modified Ca++ free Tyrode+BOEC. Fertilized oocytes were cultured for early embryonic development in TCM-199 with and without BOEC. Higher maturation rates were observed in the granulosa (84.24% and cumulus cells (83.44% than BOEC co culture system (73.37%. Highest fertilization rate was obtained in modified Ca++ free Tyrode with BOEC co culture (70.42%, followed by modified Ca++ free Tyrode alone (63.77%, TALP with BOEC (36.92% and TALP alone (10.94%. Development of early embryos (8-cell stage improved in TCM-199 with BOEC co culture than TCM-199 alone. From the results of this study, it can be concluded that addition of somatic cells (granulosa cells, cumulus cells results in higher maturation rates of buffalo follicular oocytes than BOEC co culture system, while fertilization rate improved in modified Ca++ free Tyrode with and without BOEC. Addition of BOEC to TCM-199 improved the developmental capacity of early embryo.

  13. Isotopic and chemical characteristics of mercury in organs and tissues of fish in a mercury-polluted lake: Evidence for fractionation of mercury isotopes by physiological processes.

    Science.gov (United States)

    Jackson, Togwell A

    2017-09-19

    Organs and tissues of whitefish and trout from mercury (Hg)-polluted Lake Ontario were analyzed for Hg isotopes, methylmercury (CH3 Hg+ ), and inorganic Hg to investigate possible mass-dependent fractionation (MDF) and mass-independent fractionation (MIF) of Hg isotopes by physiological processes of the fish. Isotope signatures of different body parts were defined by δ-values of 198 Hg/202 Hg, 199 Hg/202 Hg, 200 Hg/202 Hg, and 201 Hg/202 Hg ratios and by Δ-values representing effects of MIF on 199 Hg/202 Hg and 201 Hg/202 Hg ratios. The research yielded the following evidence for MDF and MIF, including MIF of isotopes with even as well as odd mass numbers, by metabolic activities: 1) anomalously low δ-values for whitefish kidneys but not for trout kidneys; 2) widely varying differences between the δ-values of different body parts of whitefish but practically uniform differences for those of trout; 3) different relationships between Δ199 Hg and Δ201 Hg for whitefish than for trout; 4) nonlinear correlation between δ198 Hg and δ200 Hg for whitefish but linear correlation for trout; 5) an inverse correlation between the δ199 Hg values and CH3 Hg+ concentrations of whitefish and trout; 6) an inverse correlation between the δ201 Hg/δ199 Hg and CH3 Hg+ /inorganic Hg ratios of trout kidneys and gills (and lipids of trout near the sources of pollution) but a positive correlation for muscle, liver, and gut; and 7) inverse correlations between Δ199 Hg and the CH3 Hg+ /inorganic Hg ratio for trout liver, kidneys, and gut. Environ Toxicol Chem 2017;9999:1-15. © 2017 SETAC. © 2017 SETAC.

  14. The Toxicity of Inhaled Sulphur Mustard

    Science.gov (United States)

    2012-10-01

    199-207. Reagents; 1. Desmosine– egg albumin (DEA) conjugate (EPC # DA855) 2. Desmosine standard (EPC # D866) 3. Isodesmosine standard (EPC...668: 199-207. Reagents 1. Desmosine- egg albumin (DEA) conjugate. 2. Desmosine standard. 3. Isodesmosine standard. 4. Rabbit anti-desmosine...serum albumin (or 0.1% V/V pig serum). B; 0.1M TRIS-HCl, 0.1% V/V Tween-20 and 0.1% W/V pig albumin (or 0.1% V/V pig serum). To 100 ml UHQ water add

  15. AcEST: BP913608 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000032_B08 199 Adiantum capillus-veneris mRNA. clone: YMU001_000032_B08. BP91360...8 CL2399Contig1 Show BP913608 Clone id YMU001_000032_B08 Library YMU01 Length 199 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000032_B08. Accession BP913608 Tissue type prothallium Developmental stag...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913608|Adiantu... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913608|Adiantum capillus-veneris mRNA, clone: YM

  16. Quentin Skinner, Staten og friheten. Oslo: Res Publica, 2011. José Luis Martí and Philip Pettit, A Political Philosophy in Public Life. Civic Republicanism in Zapatero's Spain. Princeton: Princeton University Press, 2010 (Simon Laumann Jørgensen)

    DEFF Research Database (Denmark)

    Jørgensen, Simon Laumann

    2012-01-01

    Anmeldelse af Quentin Skinner, Staten og friheten, Oslo: Res Publica 2011, 199 NOK & José Luis Martí & Philip Pettit, A Political Philosophy in Public Life. Civic Republicanism in Zapatero’s Spain, Princeton: Princeton University Press 2010, $ 24.95......Anmeldelse af Quentin Skinner, Staten og friheten, Oslo: Res Publica 2011, 199 NOK & José Luis Martí & Philip Pettit, A Political Philosophy in Public Life. Civic Republicanism in Zapatero’s Spain, Princeton: Princeton University Press 2010, $ 24.95...

  17. Demokrati - tidens mest fejrede hurraord

    DEFF Research Database (Denmark)

    Thyssen, Ole

    2017-01-01

    Dobbeltanmeldelse af: Carl Schmitt: Parlamentarismens krise. Oversat af Lars Christiansen, Informations Forlag, 125 s., 199,95 kr. og af Herman Hansen: En gentænkning af demokratiet. Gyldendal, i serien ' Til tiden', 176 s., 99,95 kr.......Dobbeltanmeldelse af: Carl Schmitt: Parlamentarismens krise. Oversat af Lars Christiansen, Informations Forlag, 125 s., 199,95 kr. og af Herman Hansen: En gentænkning af demokratiet. Gyldendal, i serien ' Til tiden', 176 s., 99,95 kr....

  18. Acute Myeloid Leukemia with IDH1 or IDH2 Mutations: Frequency and Clinicopathologic Features

    OpenAIRE

    Patel, Keyur P.; Ravandi, Farhad; Ma, Deqin; Paladugu, Abhaya; Barkoh, Bedia A.; Medeiros, L. Jeffrey; Luthra, Rajyalakshmi

    2011-01-01

    Mutations in the isocitrate dehydrogenase 1 (IDH1) and IDH2 genes are reported recently in AML. Here we investigate the frequency and the clinicopathologic features of IDH1 and IDH2 mutations in AML. Mutations in IDH1 (IDH1R132) and IDH2 (IDH2R172) were assessed by Sanger sequencing in 199 AML cases. Point mutations in IDH1R132 were detected in 12/199 (6%) cases, and in IDH2R172 in 4/196 (2%) cases. Fifteen out of the 16 (94%) mutated cases were cytogenetically normal, for an overall frequenc...

  19. Comprehensive proteomic analysis of human pancreatic juice

    DEFF Research Database (Denmark)

    Grønborg, Mads; Bunkenborg, Jakob; Kristiansen, Troels Zakarias

    2004-01-01

    Proteomic technologies provide an excellent means for analysis of body fluids for cataloging protein constituents and identifying biomarkers for early detection of cancers. The biomarkers currently available for pancreatic cancer, such as CA19-9, lack adequate sensitivity and specificity contribu......Proteomic technologies provide an excellent means for analysis of body fluids for cataloging protein constituents and identifying biomarkers for early detection of cancers. The biomarkers currently available for pancreatic cancer, such as CA19-9, lack adequate sensitivity and specificity...

  20. Role of cysteine amino acid residues on the RNA binding activity of human thymidylate synthase

    OpenAIRE

    Lin, Xiukun; Liu, Jun; Maley, Frank; Chu, Edward

    2003-01-01

    The role of cysteine sulfhydryl residues on the RNA binding activity of human thymidylate synthase (TS) was investigated by mutating each cysteine residue on human TS to a corresponding alanine residue. Enzymatic activities of TS:C43A and TS:C210A mutant proteins were nearly identical to wild-type TS, while TS:C180A and TS:C199A mutants expressed >80% of wild-type enzyme activity. In contrast, TS:C195A was completely inactive. Mutant proteins, TS:C195A, TS:C199A and TS:C210A, retained RNA bin...

  1. Reconciled Rat and Human Metabolic Networks for Comparative Toxicogenomics and Biomarker Predictions

    Science.gov (United States)

    2017-02-08

    Infectious Diseases and International Health...3,394 1,341 3,313 1,412 2,860 5,279 4,444 1,494 7,331 1,257 3,631 1,168 3,940 481 4,292 1,079 879 6,095 914 2,312 1,575 Vitamin A Vitamin D Fatty acid...ascorbate synthesis CA19-9 is used as a tumour biomarker Vitamin C deficiency results in scurvy Vitamin C O2 Gulo Glucose a b c d f g e LacCer FUT3 CA19-9

  2. MicroRNA Expression Profiling in Clear Cell Renal Cell Carcinoma: Identification and Functional Validation of Key miRNAs.

    Directory of Open Access Journals (Sweden)

    Haowei He

    Full Text Available This study aims to profile dysregulated microRNA (miRNA expression in clear cell renal cell carcinoma (ccRCC and to identify key regulatory miRNAs in ccRCC.miRNA expression profiles in nine pairs of ccRCC tumor samples at three different stages and the adjacent, non-tumorous tissues were investigated using miRNA arrays. Eleven miRNAs were identified to be commonly dysregulated, including three up-regulated (miR-487a, miR-491-3p and miR-452 and eight down-regulated (miR-125b, miR-142-3p, miR-199a-5p, miR-22, miR-299-3p, miR-29a, miR-429, and miR-532-5p in tumor tissues as compared with adjacent normal tissues. The 11 miRNAs and their predicted target genes were analyzed by Gene Ontology and Kyoto Encyclopedia of Genes and Genomes (KEGG pathway enrichment analysis, and three key miRNAs (miR-199a-5p, miR-22 and miR-429 were identified by microRNA-gene network analysis. Dysregulation of the three key miRNAs were further validated in another cohort of 15 ccRCC samples, and the human kidney carcinoma cell line 786-O, as compared with five normal kidney samples. Further investigation showed that over-expression of miR-199a-5p significantly inhibited the invasion ability of 786-O cells. Luciferase reporter assays indicated that miR-199a-5p regulated expression of TGFBR1 and JunB by directly interacting with their 3' untranslated regions. Transfection of miR-199a-5p successfully suppressed expression of TGFBR1 and JunB in the human embryonic kidney 293T cells, further confirming the direct regulation of miR-199a-5p on these two genes.This study identified 11 commonly dysregulated miRNAs in ccRCC, three of which (miR-199a-5p, miR-22 and miR-429 may represent key miRNAs involved in the pathogenesis of ccRCC. Further studies suggested that miR-199a-5p plays an important role in inhibition of cell invasion of ccRCC cells by suppressing expression of TGFBR1 and JunB.

  3. Beta-decay half-lives of new neutron-rich isotopes of Re, Os and Ir approaching the r-process path near N = 126

    Energy Technology Data Exchange (ETDEWEB)

    Kurtukian-Nieto, T.; Benlliure, J.; Casarejos, E.; Fernandez-Ordonez, M.; Pereira, J. [Universidade de Santiago de Compostela, Departamento de Fisica de Particulas, Santiago de Compostela (Spain); Schmidt, K.H.; Becker, F.; Borzov, I.N.; Henzlova, D.; Yordanov, O. [GSI-Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Audouin, L. [Institut de Physique Nucleaire, Orsay (France); Blank, B.; Giovinazzo, J.; Jurado, B. [CNRS/IN2P3-Universite de Bordeaux, Centre d' Etudes Nucleaires de Bordeaux-Gradignan, Gradignan (France); Farget, F. [GANIL, CAEN Cedex 5 (France); Langanke, K.; Martinez-Pinedo, G. [GSI-Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); TU Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany)

    2014-09-15

    Heavy neutron-rich nuclei close to N = 126 were produced by fragmentation of a 1A GeV {sup 208}Pb beam at the FRS at GSI. The β-decay half-lives of 7 nuclides have been determined using a novel numerical analysis method. The half-lives of {sup 202,199}Ir, {sup 200,199}Os and {sup 196}Re are reported for the first time. The comparison of the data with model calculations provides indications on the importance of first-forbidden transitions on the β-decay of nuclei around N = 126 and Z < 82. (orig.)

  4. Effect of insulin-like growth factor-1 during in vitro oocyte maturation and in vitro culture of bovine embryos

    Directory of Open Access Journals (Sweden)

    Quetglas M.D.

    2001-01-01

    Full Text Available The effects of insulin-like growth factor-I (IGF-I on in vitro maturation (IVM (experiment I and on in vitro embryo development (experiment II of bovine oocytes fertilized in vitro, were evaluated in terms of cleavage (CR, blastocyst (BR and hatching (HR rates. For IVM, immature cumulus-oocyte complexes were cultured in TCM-199 medium supplemented with Hepes, sodium bicarbonate, sodium pyruvate, additives, fetal calf serum (B-199 medium and gonadotropins (14 U/ml PMSG and 7 U/ml hCG. For embryo development, the oocytes/zygotes were cultured in B-199 medium with bovine oviduct epithelial cells in suspension under silicon oil. Treatments for in vitro culture conditions for both experiments were: 1- B-199 + 200 ng/ml IGF-I; 2- B-199 + 100 ng/ml IGF-I; 3- B-199 + 50 ng/ml IGF-I; 4- B-199 + 10 ng/ml IGF-I; 5- B-199 + 0 ng/ml IGF-I. All cultures were performed at 38.5ºC in 5% CO2 in air and the data were analyzed by chi-square test. In experiment I, there were no differences (P>0.05 among treatments for CR, BR or HR. In experiment II, the addition of IGF-I to the embryo culture medium (ECM resulted in a significant increase in CR while for BR and HR this effect was not observed. The addition of 200 ng/ml IGF-I to ECM increased CR (71.1% when compared to 100 ng/ml IGF-I (57.6% or control (56.7% groups, however, there were no differences when compared to 50 (69.4% or 10 ng/ml (73.1% groups. There was no beneficial effect of the addition of IGF-I in the IVM or ECM media on the in vitro development of embryos produced from oocytes matured and fertilized in vitro.

  5. Fleet Mooring Leg Design Program Documentation. Volume 4. Source Listings: Query, Preprocessor and Simple Leg.

    Science.gov (United States)

    1982-12-01

    blank) gala 29 gota 59 20 continue J-l SO contianue do 60 i-I1,4 f I(jj n) gala 199I Ie(j -ext (ii J-j+1 69 continue if (jgf n) gala 199 do 70 i-j~n...20)-tanfb*(v-vc3I/h gota 330 1360 continue tfivc3 ge vc4lgoto 1400 ner r-4 gala 6000 1400 continue ,f(v It VC4lgoto 14S0 ipt-4 go010 2000 1410 1-Ivc3

  6. R-parity violating supersymmetric contributions to the P, CP-odd electron-nucleon interaction at the one-loop level

    Science.gov (United States)

    Yamanaka, Nodoka

    2012-06-01

    The contribution of the R-parity violating minimal supersymmetric standard model at the one-loop level to the Hg199 atomic electric dipole moment through P, CP-odd electron-nucleon (e-N) interaction is calculated. We show that the current experimental data of the Hg199 electric dipole moment give tighter constraints on some of the imaginary parts of R-parity violating coupling than those currently known. We add also the analysis of the P, CP-odd 4-quark interaction generated by R-parity violating interactions at the one-loop level, and discuss the possibility to constrain them in future experiments.

  7. Quantitative Single-Particle Digital Autoradiography with α-Particle Emitters for Targeted Radionuclide Therapy using the iQID Camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W.; Frost, Sophia; Frayo, Shani; Kenoyer, Aimee L.; Santos, E. B.; Jones, Jon C.; Green, Damian J.; Hamlin, Donald K.; Wilbur, D. Scott; Fisher, Darrell R.; Orozco, Johnnie J.; Press, Oliver W.; Pagel, John M.; Sandmaier, B. M.

    2015-07-01

    Abstract Alpha emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm) causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with alpha emitters may inactivate targeted cells with minimal radiation damage to surrounding tissues. For accurate dosimetry in alpha-RIT, tools are needed to visualize and quantify the radioactivity distribution and absorbed dose to targeted and non-targeted cells, especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, iQID (ionizing-radiation Quantum Imaging Detector), for use in alpha-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection technology that images and identifies charged-particle and gamma-ray/X-ray emissions spatially and temporally on an event-by-event basis. It employs recent advances in CCD/CMOS cameras and computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, we evaluated this system’s characteristics for alpha particle imaging including measurements of spatial resolution and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 (211At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ~20 μm full width at half maximum (FWHM) and the alpha particle background was measured at a rate of (2.6 ± 0.5) × 10–4 cpm/cm2 (40 mm diameter detector area). Simultaneous imaging of multiple tissue sections was performed using a large-area iQID configuration (ø 11.5 cm

  8. Quantitative single-particle digital autoradiography with α-particle emitters for targeted radionuclide therapy using the iQID camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W., E-mail: brian.miller@pnnl.gov [Pacific Northwest National Laboratory, Richland, Washington 99354 and College of Optical Sciences, The University of Arizona, Tucson, Arizona 85719 (United States); Frost, Sofia H. L.; Frayo, Shani L.; Kenoyer, Aimee L.; Santos, Erlinda; Jones, Jon C.; Orozco, Johnnie J. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 (United States); Green, Damian J.; Press, Oliver W.; Pagel, John M.; Sandmaier, Brenda M. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 and Department of Medicine, University of Washington, Seattle, Washington 98195 (United States); Hamlin, Donald K.; Wilbur, D. Scott [Department of Radiation Oncology, University of Washington, Seattle, Washington 98195 (United States); Fisher, Darrell R. [Dade Moeller Health Group, Richland, Washington 99354 (United States)

    2015-07-15

    Purpose: Alpha-emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm), causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with α emitters may thus inactivate targeted cells with minimal radiation damage to surrounding tissues. Tools are needed to visualize and quantify the radioactivity distribution and absorbed doses to targeted and nontargeted cells for accurate dosimetry of all treatment regimens utilizing α particles, including RIT and others (e.g., Ra-223), especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, the ionizing-radiation quantum imaging detector (iQID) camera, for use in α-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection system that images and identifies charged-particle and gamma-ray/x-ray emissions spatially and temporally on an event-by-event basis. It employs CCD-CMOS cameras and high-performance computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, the authors evaluated its characteristics for α-particle imaging, including measurements of intrinsic detector spatial resolutions and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 ({sup 211}At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ∼20 μm full width at half maximum and the α-particle background was measured at a rate as low as (2.6 ± 0.5) × 10{sup −4} cpm/cm{sup 2} (40 mm diameter detector area

  9. α-Imaging Confirmed Efficient Targeting of CD₄₅-Positive Cells After ²¹¹At-Radioimmunotherapy for Hematopoietic Cell Transplantation

    Energy Technology Data Exchange (ETDEWEB)

    Frost, Sophia; Miller, Brian W.; Back, Tom; Santos, E. B.; Hamlin, Donald K.; Knoblaugh, E.; Frayo, Shani; Kenoyer, Aimee L.; Storb, Rainer; Press, O. W.; Wilbur, D. Scott; Pagel, John M.; Sandmaier, B. M.

    2015-09-03

    Alpha-radioimmunotherapy (α-RIT) targeting CD45 may substitute for total body irradiation in hematopoietic cell transplantation (HCT) preparative regimens for lymphoma. Our goal was to optimize the anti-CD45 monoclonal antibody (MAb; CA12.10C12) protein dose for astatine-²¹¹(²¹¹At)-RIT, extending the analysis to include intra-organ ²¹¹At activity distribution and α-imaging-based small-scale dosimetry, along with imunohistochemical staining. Methods: Eight normal dogs were injected with either 0.75 (n=5) or 1.00 mg/kg (n=3) of ²¹¹At-B10-CA12.10C12 (11.5–27.6 MBq/kg). Two were euthanized and necropsied 19–22 hours postinjection (p.i.), and six received autologous HCT three days after ²¹¹At-RIT, following lymph node and bone marrow biopsies at 2–4 and/or 19 hours p.i. Blood was sampled to study toxicity and clearance; CD45 targeting was evaluated by flow cytometry. ²¹¹At localization and small scale dosimetry were assessed using two α-imaging : α-camera and iQID. Results: Uptake of ²¹¹At was highest in spleen (0.31–0.61 %IA/g), lymph nodes (0.02–0.16 %IA/g), liver (0.11–0.12 %IA/g), and marrow (0.06–0.08 %IA/g). Lymphocytes in blood and marrow were efficiently targeted using either MAb dose. Lymph nodes remained unsaturated, but displayed targeted ²¹¹At localization in T lymphocyte-rich areas. Absorbed doses to blood, marrow, and lymph nodes were estimated at 3.9, 3.0, and 4.2 Gy/210 MBq, respectively. All transplanted dogs experienced transient hepatic toxicity. Liver enzyme levels were temporarily elevated in 5 of 6 dogs; 1 treated with 1.00 mg MAb/kg developed ascites and was euthanized 136 days after HCT. Conclusion: ²¹¹At-anti-CD45 RIT with 0.75 mg MAb/kg efficiently targeted blood and marrow without severe toxicity. Dosimetry calculations and observed radiation-induced effects indicated that sufficient ²¹¹At-B10-CA12.10C12 localization was achieved for efficient conditioning for HCT.

  10. The role of alpha therapy for local and systemic treatment of cancer

    Energy Technology Data Exchange (ETDEWEB)

    Allen, B.J. [St George Hospital, Kogarah, NSW (Australia)

    1998-03-01

    Major problems in the management of cancer relate to the inability to control some primary lesions, e.g. glioblastoma multiforme (GBM), and the inability to deal with metastatic cancer arising from malignant cancers such as melanoma, breast and other cancers. Binary alpha therapy using neutron capture in boron-10 offers the potential for improved prognosis for high grade brain tumours such as GBM and melanoma metastases to the brain. Metastatic cancer proceeds through a number of quite separate stages in the development of lethal disease, i e. cells in transit, preangiogenic lesions, subclinical and clinical lesions. Early stages offer the potential for control if targeted alpha therapy is applied. However, the dose must be localised to the cancer cell and this requirement rules out beta-emitting radionuclides, which are more suited for clinical lesions. Alpha-emitting radionuclides are the most appropriate toxins, as their efficacy depends on the linear energy transfer (LET) and range of the alpha particles. After matching the cancer stage, radiolabel and carrier, we find that {sup 149}Tb is the radionuclide of choice for systemic therapy in all aspects except production. The production of {sup 149}Tb in {mu}Ci (kBq) quantities has been achieved using the heavy ion reaction at the ANU tandem accelerator at Canberra and in multi-mCi (MBq) quantities using the spallation reaction in combination with on-line isotope separation technology of ISOLDE at CERN. Terbium is ideally suited for chelation to monoclonal antibodies to produce stable radio-immunoconjugates (RIC). Astatine-211 is a halide and has potential for the elimination of early stage melanoma metastases as At-MTB. However, the availability of the alpha generators {sup 228}Th-{sup 212}Bi and {sup 225}Ac-{sup 213}Bi facilitates the use of Bi-RIC in clinical trials for acute myeloid leukaemia and cystic glioma. Alpha therapy has the potential to control refractory cancers when treated at the minimum residual

  11. Systematics of Alpha-Radioactivity

    Energy Technology Data Exchange (ETDEWEB)

    Perlman, I.; Ghiorso, A.; Seaborg, G.T.

    1949-09-12

    Correlations of alpha-decay energies in terms of mass number and atomic number have been made for all of the alpha-emitting species now numbering over 100. For each element isotopes show increase in alpha-energy with decrease in mass number except in the region of 126 neutrons where there is an explainable reversal. This reversal has the effect of creating a region of relatively low alpha-energy and long half-life at low mass numbers for such elements as astatine, emanation, francium, and possibly higher elements as had been noted already for bismuth and polonium. Methods and examples of using alpha-decay data to define the energy surface in the heavy element region are discussed. The regularities in alpha-decay are used for predictions of nuclear properties including prediction of the beta-stable nuclides among the heavy elements. The half-life vs. energy correlations show that the even-even nuclides conform well with existing alpha-decay theory, but all nuclear types with odd nucleons show prohibited decay. The reason for this prohibition is not found in spin changes in the alpha-emission but in the assembly of the components of the alpha particle, and this theory is discussed further in terms of observations made on nuclides having two or more alpha-groups. Using most of the even-even nuclei to define 'normal nuclear radius' calculations are now able to show the shrinkage in the regions of lead and of 126 neutrons to amount to about 10%. The much greater change in 'effective radius' for bismuth isotopes can be dissociated into the effects of odd nucleons superimposed on the actual decrease in nuclear radius. The simple expression r = 1.48 A{sup 1/3} {center_dot} 10{sup -13} cm seems to fit the data for the even-even nuclei outside of the region of 126 neutrons better than more complex functions.

  12. Dual-Use Telemedicine Support System for Pathology.

    Science.gov (United States)

    1998-12-01

    51 CDRH Center for Devices and Radiological Health 52 CEA Carcino-Embroyonic Antigen 53 CEN European Standards Group 54 CEN/TC 251 Working on spec...Telemedicine and Hospital Information Related Systems Acronyms; 12/10/98 197 MDL MD Lookup 198 MDR MD Retrieval 199 MEDIX MEDical Data InterX (X stands for

  13. Role of plant growth regulators in preservation of Pyrus germplasm ...

    African Journals Online (AJOL)

    Administrator

    2011-10-19

    Oct 19, 2011 ... vitro plant germplasm. Proc. Intl. Plant Propag. Soc., pp. 199-205. Kovalchuk I, Lyudvikova Y, Volgina M, Reed BM (2009). Medium, container and genotype all influence in vitro apple germplasm. Plant. Cell Tiss. Org. Cult. 96: 127-136. Moriguchi T (1995). Cryopreservations and minimum growth storage of.

  14. Books/Boeke

    African Journals Online (AJOL)

    psychosocial life in their own preferred way. Experience, behaviour and interaction constitute the subjective .... the discussion on page 199 of the decline in intelligence during ageing due to general neuropsychological ... that control the expression of the inducible enzymes responsible for the influx of nitrate into the plant.

  15. Nový přírůstek ke tříkrálové ikonografii v Čechách. Gotická nástěnná malba v Sedlčanech

    Czech Academy of Sciences Publication Activity Database

    Faktor, Ondřej

    2017-01-01

    Roč. 24, - (2017), s. 199-225 ISSN 1211-5169 R&D Projects: GA ČR GA13-39192S Institutional support: RVO:68378033 Keywords : Gothic art * iconography * church * mural painting * Three Magi (Three Wise Men) * Rožmberk family * Sedlčany Subject RIV: AL - Art , Architecture, Cultural Heritage OBOR OECD: Art s, Art history

  16. Hydrologic and Water Quality Effects of Harvesting and Regeneration of a Drained Pine Forest

    Science.gov (United States)

    Devendra M. Amatya; R. W. Skaggs; C. D. Blanton; J. W. Gilliam

    2006-01-01

    Data on precipitation, weather, water tables, outflows, and nutrient concentrations from two paired watersheds (D1 - control and D2 - treatment) on a pine forest in Coastal North Carolina were measured during 1988-90 calibration period to characterize the pre-treatment hydrology and water quality. Similarly, measured data from 199 5 (D2 harvested) to 2004 (seven years...

  17. A new pathogenic keratin 5 mutation in a Hindoestan family with localized epidermolysis bullosa simplex

    NARCIS (Netherlands)

    Flohil, Sophie C.; Bolling, Maria C.; Kooi, Kristia A.; Lemmink, Henny H.; Jonkman, Marcel F.

    2010-01-01

    Epidermolysis bullosa simplex is an autosomal dominant inherited skin blistering disorder caused by mutations in the genes KRT5 or KRT14 coding for the basal epidermal keratins 5 and 14, respectively. We describe a novel heterozygous pathogenic missense mutation (KRT5:c.596A>T, p.Lys199Met) in a

  18. Disease: H01212 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ncephalopathy with neuroserpin inclusion bodies (FEBIB) is an autosomal dominant dementia that is characteri...usions. Kindreds with FENIB present with presenile dementia and cognitive deficit...Carrell RW, Lomas DA Familial dementia caused by polymerization of mutant neuroserpin. Nature 401:376-9 (199

  19. Job satisfaction and short sickness absence due to the common cold

    NARCIS (Netherlands)

    Roelen, Corne A. M.; Koopmans, Petra C.; Notenbomer, Annette; Groothoff, Johan W.

    2011-01-01

    Objective: This study investigated whether short episodes of sickness absence were associated with job satisfaction. Participants: 199 wage earners who reported sick due to the common cold between January 2003 and April 2003. Methods: Job satisfaction was assessed on the first day of sickness

  20. A simulation of allocation of doctors to shifts in an emergency ...

    African Journals Online (AJOL)

    A computer program is developed to solve a dynamic programming problem of allocating doctors, the optimal solution of which provides solution to another dynamic programming problem of allocating doctors to shifts. Global Journal of Pure and Applied Sciences Volume , No 1 January (2001) pp. 199-200. KEY WORDS: