WorldWideScience

Sample records for astatine 198

  1. Radiochemistry of astatine

    International Nuclear Information System (INIS)

    Ruth, T.J.; Dombsky, M.; D'Auria, J.M.; Ward, T.E.

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs

  2. Formation and decomposition of astatine molecules

    International Nuclear Information System (INIS)

    Takahashi, Naruto; Ishikuro, Mituhiro; Baba Hiroshi

    1989-01-01

    A method determining the boiling points of elementary astatine and astatine iodide has been developed (K. Otozai and N. Takahashi, Radio. Chim. Acta 31, (1982) 201). Further, it was concluded from the simple rule among the boiling point of elementary halogens and interhalogen compounds that elementary astatine might exist in diatomic molecules as the other halogens. In the present work the reaction mechanisms of elementary astatine with radioactive iodine and organic solvents were studied by means of radiogaschromatography in order to obtain further experimental evidences for diatomic astaine molecules. The following conclusions were obtained by the analysis of reaction kinetics. Two astatine atoms are lost from the elementary astatine fraction per each radioactive decay of astatine. The astatine radical or hot atom liberated by the decay of the complementary astatine atom immediately reacts with iodine or organic solvents. Thus formed astatine compounds decompose in turn due to the decay of astatine

  3. Organic astatine compounds, their preparation and properties

    Energy Technology Data Exchange (ETDEWEB)

    Vasaros, L; Berei, K

    1985-01-01

    Aromatic astatine compounds of possible medical application were prepared by high energy substitutions, by astatine-halogen, and by electrophil astatine-hydrogen substitutions at the Joint Institute of Nuclear Researches, Dubna. Physico-chemical properties of organic astatine compounds such as boiling point and evaporation heat, and the refraction and dissociation energy of carbon-astatine bonds were determined experimentally by gas chromatography. The results are compared with extrapolated data. (V.N.). 41 refs.; 7 figs.; 5 tables.

  4. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    Berei, K.; Vasaros, L.

    1992-02-01

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211 At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  5. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Berei, K.; Vasaros, L.

    1994-03-01

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211 At species, 211 At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  6. Experimental and computational evidence of halogen bonds involving astatine

    Science.gov (United States)

    Guo, Ning; Maurice, Rémi; Teze, David; Graton, Jérôme; Champion, Julie; Montavon, Gilles; Galland, Nicolas

    2018-03-01

    The importance of halogen bonds—highly directional interactions between an electron-deficient σ-hole moiety in a halogenated compound and an acceptor such as a Lewis base—is being increasingly recognized in a wide variety of fields from biomedicinal chemistry to materials science. The heaviest halogens are known to form stronger halogen bonds, implying that if this trend continues down the periodic table, astatine should exhibit the highest halogen-bond donating ability. This may be mitigated, however, by the relativistic effects undergone by heavy elements, as illustrated by the metallic character of astatine. Here, the occurrence of halogen-bonding interactions involving astatine is experimentally evidenced. The complexation constants of astatine monoiodide with a series of organic ligands in cyclohexane solution were derived from distribution coefficient measurements and supported by relativistic quantum mechanical calculations. Taken together, the results show that astatine indeed behaves as a halogen-bond donor—a stronger one than iodine—owing to its much more electrophilic σ-hole.

  7. The reaction of astatine with aromatic diazonium compounds

    International Nuclear Information System (INIS)

    Visser, G.W.M.; Diemer, E.L.

    1982-01-01

    Astatine reacts prefrentially with that type of aromatic diazonium salt that decomposes via a radical reaction channel (homolytic breakage of the C-N bond). The dediazonation with p-aminobenzoic acid and p-toluidine as model compounds was investigated through estatin produced in the 209 Bi(α,2n) 211 At reaction. (author)

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    Science.gov (United States)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Köster, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjödin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine. PMID:23673620

  9. Comment: 198 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available ゲノム比較解析のためにゲノム解読が行われた。 撮影:成瀬清(基礎生物学研究所) Photo: Kiyoshi Naruse (National Institute for Basic Biology) bando 2009/10/01 14:48:45 2010/01/14 20:09:26 ... ...nal Institute for Basic Biology) licensed under CC Attribution2.1 Japan メダカ近交系 HNI-Ⅱ系統 北日本集団由来の純系。 Hd-rR系統との...Japanese medaka Oryzias latipes Oryzias_latipes_L.png 198.png Kiyoshi Naruse (Natio

  10. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...... vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  11. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single...... to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3......-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison...

  12. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Visser, G.W.M.

    1982-01-01

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments ( 209 At, 210 At, 211 At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  13. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    Sjoestroem, A.; Carlsson, J.; Lundqvist, H.; Koziorowski, J.

    2003-01-01

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  14. 7 CFR 1.198 - Settlement.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Settlement. 1.198 Section 1.198 Agriculture Office of....198 Settlement. The applicant and agency counsel may agree on a proposed settlement of the award before final action on the application, either in connection with a settlement of the underlying...

  15. 10 CFR 205.198 - Discovery.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Discovery. 205.198 Section 205.198 Energy DEPARTMENT OF... of Proposed Disallowance, and Order of Disallowance § 205.198 Discovery. (a) If a person intends to file a Motion for Discovery, he must file it at the same time that he files his Statement of Objections...

  16. Estimation of the chemical form and the boiling point of elementary astatine by radiogas-chromatography

    International Nuclear Information System (INIS)

    Otozai, K.; Takahashi, N.

    1982-01-01

    After astatine (0) was mixed with 131 I 2 containing carrier I 2 , the sample was analyzed by means of radiogaschromatography and the peaks due to I 2 , AtI and At 2 were observed. Further, the boiling points were estimated from the retention volume in terms of the semi-empirical theory on gas chromatography. The boiling points of I 2 , AtI and At 2 were 457 +- 2,486 +- 2 and 503 +- 3K, respectively. The boiling point of At 2 obtained in the present work is far smaller than that expected by the extrapolation of lighter halogens. (orig.)

  17. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    Czech Academy of Sciences Publication Activity Database

    Sjostrom, A.; Tolmachev, V.; Lebeda, Ondřej; Koziorowski, J.; Carlsson, J.; Lundqvist, H.

    2003-01-01

    Roč. 256, č. 7 (2003), s. 191-197 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Keywords : neutron-capture therapy * astatine-211 Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.472, year: 2003

  18. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Pruszynski, M.; Bilewicz, A.

    2006-01-01

    211 At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211 At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At - to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh 3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At - anions, but first of all because of the kinetic inertness of low spin rhodium(III) d 6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh 3+ . The experiments related to optimization of the reaction conditions were performed with the 131 I, basing on a chemical similarity of I - to At - . The experiments with 211 At were then carried out under the conditions found optimal for I - . The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211 At-Rh(16-S4-diol) complex

  19. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  20. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  1. Thermogravimetric determination of the enthalpy of astatine and radon adsorption on palladium surfaces

    International Nuclear Information System (INIS)

    Eichler, B.; Son Chun, K.

    1985-01-01

    In order to investigate the adsorption of astatine and radon on a palladium surface some on- and off-line thermochromatographic experiments were carried out with 210 At and 220 Rn tracers. The partial molar adsorption enthalpy for zero covering was found to be ΔH/sub a//sup 0, loc./(At) = -(15S +- 10) kJ mole -1 and ΔH/sub a//sup 0, mob./(Rn) = -(37 +- 4) kJ mole -1 . The results are compared with theoretical and experimental values for other elements of the sixth period. The adsorption behaviour of At is in conformity with that of the p-metals on a palladium surface. (author)

  2. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  3. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    International Nuclear Information System (INIS)

    Lahiri, Susanta; Roy, Kamalika; Sen, Souvik

    2008-01-01

    No-carrier-added astatine radionuclides produced in the 7 Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about ∼12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h

  4. 21 CFR 211.198 - Complaint files.

    Science.gov (United States)

    2010-04-01

    ... CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Records and Reports § 211.198 Complaint... for exemption under § 211.137, such written records shall be maintained for 3 years after distribution...

  5. Oblate collectivity in 197,198Pb

    International Nuclear Information System (INIS)

    Kuhnert, A.; Wang, T.F.; Stoyer, M.A.; Becker, J.A.; Henry, E.A.; Brinkman, M.J.; Yates, S.W.; Draper, J.E.; Deleplanque, M.A.; Diamond, R.M.; Stephens, F.S.; Machiavelli, A.O.; Kelly, W.H.; Korten, W.; Azaiez, F.; Cizewski, J.A.

    1993-01-01

    Evidence for collective behavior in the high-spin region of neutron deficient lead nuclei is provided by the observation of four collective structures in 197,198 Pb. These bands consist of strong dipole (M1) transitions with a few E2 crossover transitions observed. The transition energies of three of these bands show a rather regular behavior while those of one of them show an irregular behavior. We interpret the regular bands as oblate collective bands built on oblate proton and neutron states, whereas the irregular band might either be built on a state with very small oblate deformation, or be a triaxial rotational band. A lifetime measurement (DSAM) has been done for the regular bands in 198 Pb. Neutron and proton configurations for the bands are suggested from the results of quasi particle Routhians and total Routhian surface (TRS) calculations. (orig.)

  6. Oblate collectivity in 197,198Pb

    International Nuclear Information System (INIS)

    Kuhnert, A.; Wang, T.F.; Stoyer, M.A.; Becker, J.A.; Henry, E.A.; Brinkman, M.J.; Yates, S.W.; Draper, J.E.; Deleplanque, M.A.; Diamond, R.M.; Stephens, F.S.; Machiavelli, A.O.; Kelly, W.H.; Korten, W.; Azaiez, F.

    1992-07-01

    Evidence for collective behavior in the high-spin region of neutron deficient lead nuclei is provided by the observation of four collective structures in 197,198 Pb. These bands consist of strong dipole (M1) transitions with a few E2 crossover transitions observed. The transition energies of three of these bands show a rather regular behavior while those of one of them show an irregular behavior. We interpret the regular bands as oblate collective bands built on oblate proton and neutron states, whereas the irregular band might either be built on a state with very small oblate deformation, or be a triaxial rotational band. A lifetime measurement (DSAM) has been done for the regular bands in 198 Pb. Neutron and proton configurations for the bands are suggested from the results of quasi particle Routhians and total Routhian surface (TRS) calculations

  7. Astatine-211 Radiochemistry: The Development Of Methodologies For High Activity Level Radiosynthesis

    International Nuclear Information System (INIS)

    Zalutsky, Michael R.

    2012-01-01

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for α-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the α-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At-labeled targeted

  8. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  9. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  10. In vitro evaluation of the astatinated chimeric monoclonal antibody U36, a potential candidate for treatment of head and neck squamous cell carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Nestor, M.; Anniko, M. [Uppsala University, Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala (Sweden); Persson, M. [Uppsala University, Unit of Urology, Department of Surgical Sciences, Uppsala (Sweden); Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden); Dongen, G.A.M.S. van [Vrije Universiteit Medical Center, Department of Otolaryngology/Head and Neck Surgery, Amsterdam (Netherlands); Jensen, H.J. [Righshospitalet, PET and Cyclotron Unit, Department of Clinical Physiology and Nuclear Medicine, Copenhagen (Denmark); Lundqvist, H.; Tolmachev, V. [Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden)

    2005-11-01

    The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with {sup 211}At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with {sup 125}I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with {sup 131}I-labelled cMAb U36 (directly labelled). Comparisons between {sup 211}At-cMAb U36 and {sup 125}I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31{+-}2% vs 42.6{+-}1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for {sup 211}At-cMAb U36, with about 10% cell survival at 50 decays per cell. The {sup 131}I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)

  11. In vitro evaluation of the astatinated chimeric monoclonal antibody U36, a potential candidate for treatment of head and neck squamous cell carcinoma

    International Nuclear Information System (INIS)

    Nestor, M.; Anniko, M.; Persson, M.; Dongen, G.A.M.S. van; Jensen, H.J.; Lundqvist, H.; Tolmachev, V.

    2005-01-01

    The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with 211 At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with 125 I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with 131 I-labelled cMAb U36 (directly labelled). Comparisons between 211 At-cMAb U36 and 125 I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31±2% vs 42.6±1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for 211 At-cMAb U36, with about 10% cell survival at 50 decays per cell. The 131 I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)

  12. 12 CFR 19.8 - Conflicts of interest.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Conflicts of interest. 19.8 Section 19.8 Banks... Uniform Rules of Practice and Procedure § 19.8 Conflicts of interest. (a) Conflict of interest in... measures at any stage of a proceeding to cure a conflict of interest in representation, including the...

  13. Studies of the 198Hg(d,d') and 198Hg(d,p) reactions

    Science.gov (United States)

    Diaz Varela, Alejandra; Garrett, P. E.; Rand, E. T.; Ball, G. C.; Bilstein, V.; Laffoley, A. T.; Maclean, A. D.; Svensson, C. E.; Faestermann, T.; Hertenberger, R.; Wirth, H.-F.

    2017-09-01

    Limits on the electric dipole moment (EDM) continue to decrease for 199Hg, the most stringent upper limit for a nuclear EDM to date. The experimental limit on the observed atomic EDM for 199Hg is converted to a limit on the nuclear EDM via a calculation of the Schiff moment, requiring knowledge of the nuclear structure of 199Hg. The E 3 and E 1 strength distributions to the ground state of 199Hg, and E 2 transitions amongst excited states, would be ideal information to further constrain 199Hg Schiff moment theoretical models. The high level density of 199Hg makes those determinations challenging, however the similar information can be obtained from exploring surrounding even-even Hg isotopes. As part of a campaign to study the Hg isotopes near 199Hg, two experiments, 198Hg(d,d') 198Hg and 198Hg(d,p)199Hg reaction were performed using the Q3D spectrograph at the Maier-Leibnitz Laboratory (MLL) at Garching, Germany. A 22 MeV deuterium beam was used to impinge a 198Hg32S target. The (d,d') reaction allows us to probe the desired E 2 and E 3 matrix elements, while the (d,p) reaction provides information on the neutron single-particle states of 199Hg.

  14. High-efficiency astatination of antibodies using N-iodosuccinimide as the oxidising agent in labelling of N-succinimidyl 3-(trimethylstannyl)benzoate

    International Nuclear Information System (INIS)

    Lindegren, S.; Andersson, H.; Baeck, T.; Jacobsson, L.; Karlsson, B.; Skarnemark, G.

    2001-01-01

    Monoclonal antibodies C215, reactive with colorectal carcinomas, and MOv18, reactive with most of the ovarian carcinomas, were radiohalogenated with [ 211 At]astatine. The radiohalogen was conjugate coupled to antibodies via the intermediate labelling reagent N-succinimidyl-3-(trimethylstannyl)benzoate (m-MeATE) in a two-step, single-pot reaction. Optimisation of the labelling of the reagent was achieved using N-iodosuccinimide, NIS, as the oxidising agent. The yields ranged from 69-95% in the labelling of 0.1-1.0 nmole of the m-MeATE precursor. Subsequent conjugation to antibodies resulted in yields of 58±7%. In vitro binding to tumour cells showed that the immunoreactivity of both antibodies was retained after astatine labelling

  15. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  16. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    Rothe, Sebastian

    2012-01-01

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  17. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  18. Radiobiological Effects of Alpha-Particles from Astatine-211: From DNA Damage to Cell Death

    Energy Technology Data Exchange (ETDEWEB)

    Claesson, Kristina

    2011-05-15

    In recent years, the use of high linear energy transfer (LET) radiation for radiotherapeutic applications has gained increased interest. Astatine-211 (211At) is an alpha-particle emitting radionuclide, promising for targeted radioimmunotherapy of isolated tumor cells and microscopic clusters. To improve development of safe radiotherapy using 211At it is important to increase our knowledge of the radiobiological effects in cells. During radiotherapy, both tumors and adjacent normal tissue will be irradiated and therefore, it is of importance to understand differences in the radio response between proliferating and resting cells. The aim of this thesis was to investigate effects in fibroblasts with different proliferation status after irradiation with alpha-particles from 211At or X-rays, from inflicted DNA damage, to cellular responses and biological consequences. Throughout this work, irradiation was performed with alpha-particles from 211A or X-rays. The induction and repair of double-strand breaks (DSBs) in human normal fibroblasts were investigated using pulsed-field gel electrophoresis and fragment analysis. The relative biological effectiveness (RBE) of 211At for DSB induction varied between 1.4 and 3.1. A small increase of DSBs was observed in cycling cells compared to stationary cells. The repair kinetics was slower after 211At and more residual damage was found after 24 h. Comparison between cells with different proliferation status showed that the repair was inefficient in cycling cells with more residual damage, regardless of radiation quality. Activation of cell cycle arrests was investigated using immunofluorescent labeling of the checkpoint kinase Chk2 and by measuring cell cycle distributions with flow cytometry analysis. After alpha-particle irradiation, the average number of Chk2-foci was larger and the cells had a more affected cell cycle progression for several weeks compared with X-irradiated cells, indicating a more powerful arrest after 211At

  19. 10 CFR 431.198 - Enforcement testing for distribution transformers.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Enforcement testing for distribution transformers. 431.198... COMMERCIAL AND INDUSTRIAL EQUIPMENT Distribution Transformers Compliance and Enforcement § 431.198 Enforcement testing for distribution transformers. (a) Test notice. Upon receiving information in writing...

  20. 37 CFR 1.98 - Content of information disclosure statement.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Content of information disclosure statement. 1.98 Section 1.98 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing...

  1. Bone Marrow Scans with Colloidal {sup 198}Au

    Energy Technology Data Exchange (ETDEWEB)

    Chang, Sung Soo; Whang, Kee Suk [Kyungpook National University College of Medicine, Daegu (Korea, Republic of)

    1973-03-15

    The bone marrow scans with colloidal {sup 198}Au were performed on 33 cases with hematologically normal patients and patients with various blood dyscrasia. Bone marrow aspirations were done at iliac crest in all cases but one. A correlation between the scan findings and an erythroid cellularity was evaluated. The following results were obtained. 1) Out of 33 cases, 23 (about 70%) showed a correlation between {sup 198}Au marrow uptakes on the scans and the erythroid cellularity. 2) The diseases in which no correlation existed between {sup 198}Au uptake and erythroid cellularity were aplastic anemia, acute leukemia and chronic myelogenous leukemia.

  2. Tritium stripping in a nitrogen glovebox using SAES St 198

    International Nuclear Information System (INIS)

    Klein, J.E.; Wermer, J.R.

    1994-01-01

    SAES metal getter material St 198 was chosen for glovebox stripper tests to evaluate its effectiveness of removing tritium from a nitrogen atmosphere. The St 198 material is unique from a number of other metal hydride-based getter materials in that it is relatively inert to nitrogen and can thus be used in nitrogen glovebox atmospheres. Six tritium stripper experiments which mock-up the use of a SAES St 198 stripper bed for a full-scale (10,500 liter) nitrogen glovebox have been completed. Experiments consisted of a release of small quantity of protium/deuterium spiked with tritium which were scaled to simulate tritium releases of 0.1 g., 1.0 g., and 10 g. into the glovebox. The tritium spike allows detection using tritium ion chambers. The St 198 stripper system produced a reduction in tritium activity of approximately two orders of magnitude in 24 hours (6--8 atmosphere turn-overs) of stripper operation

  3. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  4. Electron Scattering from MERCURY-198 and Mercury -204.

    Science.gov (United States)

    Laksanaboonsong, Jarungsaeng

    This experiment is the first electron scattering study on mercury isotopes. Electron scattering from ^{198}Hg and ^{204 }Hg has been performed at the NIKHEF-K Medium Energy Accelerator. Measured cross sections cover an effective momentum transfer range from 0.4 to 2.9 fm^ {-1}. Elastic cross sections were determined for scattering from both isotopes. Cross section for inelastic excitations in ^{198}Hg below 3 MeV were also determined. Measured cross sections were fit using DWBA phase shift codes to determine coefficients for Fourier-Bessel expansions of ground state and transition charge densities. Differences between the ground state charge densities of the two isotopes reveal the effect of the polarization of the proton core in response to the addition of neutrons. Spin and parity of several excited states of ^{198}Hg were determined. Extracted transition densities of these states show their predominantly collective nature. Charge densities for members of the ground state rotational band were compared with axially symmetric Hartree-Fock and geometrical model predictions.

  5. Scanning with Au198 in experimental hepatic trauma

    International Nuclear Information System (INIS)

    Faifer, J.G.; Macedo, A.R. de; Vicentini, M.L.M.; Hossne, W.S.

    1977-01-01

    Scintiscanning of the liver with Au 198 was performed in 30 mongrel dogs, with the purpose of evaluating the importance of this method in the diagnostic of liver traumatisms. In 18 animals the scanning was performed after 3 differents types of hepatic trauma: intraparenchymal hematoma, stab wound and lasceration of liver. In 12 dogs without hepatic trauma the scanning was performed with the purpose of establishing the pattern of the normal liver scan in the dog. Results indicate that scintiscanning of the liver is a good propaedeutic method in the evaluation of the presence and localization of traumatic hepatic lesion [pt

  6. Lung clearance of polydispersed colloidal 198Au particles

    International Nuclear Information System (INIS)

    D'Addabbo, A.; Fanfani, G.

    1975-01-01

    Lung clearance was studied on a group of subjects over 65 years old and on subjects aged between 30 and 40. A slowing down of material deposited in the bronchial tubes (polydispersed colloidal 198 Au particles) was observed in the senile subjects. This phenomenon is apparently related not only to a reduced activity of the vibratile ciliae, in connection with the frequent metaplasia of the bronchial cylindrical epithelium, but also to a quantitative and qualitative change in the mucopolysaccharides forming the mucus secretion [fr

  7. Collective oblate dipole rotational bands in 198Pb

    International Nuclear Information System (INIS)

    Clark, R.M.; Wadsworth, R.; Paul, E.S.; Beausang, C.W.; Ali, I.; Astier, A.; Cullen, D.M.; Dagnall, P.J.; Fallon, P.; Joyce, M.J.; Meyer, M.; Redon, N.; Regan, P.H.; Sharpey-Schafer, J.F.; Nazarewicz, W.; Wyss, R.

    1993-01-01

    The nucleus 198 Pb was populated via the 186 W( 17 O, 5n) 198 Pb reaction at beam energies of 92 and 98 MeV. Five collective rotational cascades of ΔI=1 transitions have been found. Four are highly regular, one much more irregular. The structures are incorporated into a level scheme which extends up to approximately spin 32 h and an excitation energy of about 10 MeV. Angular correlation measurements confirm the dipole character of the interband transitions. Their M1 multipolarity is inferred, and from this supposition the experimental data are interpreted in terms of oblate high-K two quasiproton configurations coupled to aligned neutron excitations. This interpretation is extended to include other ΔI=1 oblate structures observed in 194-201 Pb. It is shown that the pattern of observed moments of inertia can be understood in the simple unpaired picture involving neutron i 13/2 excitations. The identical bands observed are interpreted in terms of the normal-parity weakly-coupled singlet orbital. (orig.)

  8. 43 CFR 19.8 - Prospecting, mineral locations, mineral patents, and mineral leasing within National Forest...

    Science.gov (United States)

    2010-10-01

    ... patents, and mineral leasing within National Forest Wilderness. 19.8 Section 19.8 Public Lands: Interior... § 19.8 Prospecting, mineral locations, mineral patents, and mineral leasing within National Forest... locations, mineral patents, and mineral leasing within National Forest Wilderness are contained in parts...

  9. 40 CFR 267.198 - What are the general operating requirements for my tank systems?

    Science.gov (United States)

    2010-07-01

    ... FACILITIES OPERATING UNDER A STANDARDIZED PERMIT Tank Systems § 267.198 What are the general operating... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What are the general operating requirements for my tank systems? 267.198 Section 267.198 Protection of Environment ENVIRONMENTAL PROTECTION...

  10. MicroRNA-198 inhibited tumorous behaviors of human osteosarcoma through directly targeting ROCK1

    International Nuclear Information System (INIS)

    Zhang, Shilian; Zhao, Yuehua; Wang, Lijie

    2016-01-01

    Osteosarcoma is an aggressive primary sarcoma of bone and occurs mainly in adolescents and young adults. The prognosis of OS remains poor, and most of them will die due to local relapse or metastases. The discovery of microRNAs provides a new possibility for the early diagnosis and treatment of OS. Thus, the aim of this study was to explore the expression and functions of microRNA-198 (miR-198) in osteosarcoma. The expression levels of miR-198 were determined by qRT-PCR in osteosarcoma tissues and cell lines. Cell proliferation assays, migration and invasion assays were adopted to investigate the effects of miR-198 on tumorous behaviors of osteosarcoma cells. The results showed that miR-198 expression levels were lower in osteosarcoma tissues and cell lines. In addition, low miR-198 expression levels were correlated with TNM stage and distant metastasis. After miR-198 mimics transfection, cell proliferation, migration and invasion were significantly suppressed in the osteosarcoma cells. Furthermore, ROCK1 was identified as a novel direct target of miR-198 in osteosarcoma. These findings suggested that miR-198 may act not only as a novel prognostic marker, but also as a potential target for molecular therapy of osteosarcoma.

  11. MicroRNA-198 inhibited tumorous behaviors of human osteosarcoma through directly targeting ROCK1

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Shilian, E-mail: shilian_zhang@126.com; Zhao, Yuehua; Wang, Lijie

    2016-04-08

    Osteosarcoma is an aggressive primary sarcoma of bone and occurs mainly in adolescents and young adults. The prognosis of OS remains poor, and most of them will die due to local relapse or metastases. The discovery of microRNAs provides a new possibility for the early diagnosis and treatment of OS. Thus, the aim of this study was to explore the expression and functions of microRNA-198 (miR-198) in osteosarcoma. The expression levels of miR-198 were determined by qRT-PCR in osteosarcoma tissues and cell lines. Cell proliferation assays, migration and invasion assays were adopted to investigate the effects of miR-198 on tumorous behaviors of osteosarcoma cells. The results showed that miR-198 expression levels were lower in osteosarcoma tissues and cell lines. In addition, low miR-198 expression levels were correlated with TNM stage and distant metastasis. After miR-198 mimics transfection, cell proliferation, migration and invasion were significantly suppressed in the osteosarcoma cells. Furthermore, ROCK1 was identified as a novel direct target of miR-198 in osteosarcoma. These findings suggested that miR-198 may act not only as a novel prognostic marker, but also as a potential target for molecular therapy of osteosarcoma.

  12. Acquisition through Horizontal Gene Transfer of Plasmid pSMA198 by Streptococcus macedonicus ACA-DC 198 Points towards the Dairy Origin of the Species

    Science.gov (United States)

    Papadimitriou, Konstantinos; Anastasiou, Rania; Maistrou, Eleni; Plakas, Thomas; Papandreou, Nikos C.; Hamodrakas, Stavros J.; Ferreira, Stéphanie; Supply, Philip; Renault, Pierre; Pot, Bruno; Tsakalidou, Effie

    2015-01-01

    Background Streptococcus macedonicus is an intriguing streptococcal species whose most frequent source of isolation is fermented foods similarly to Streptococcus thermophilus. However, S. macedonicus is closely related to commensal opportunistic pathogens of the Streptococcus bovis/Streptococcus equinus complex. Methodology/Principal Findings We analyzed the pSMA198 plasmid isolated from the dairy strain Streptococcus macedonicus ACA-DC 198 in order to provide novel clues about the main ecological niche of this bacterium. pSMA198 belongs to the narrow host range pCI305/pWV02 family found primarily in lactococci and to the best of our knowledge it is the first such plasmid to be reported in streptococci. Comparative analysis of the pSMA198 sequence revealed a high degree of similarity with plasmids isolated from Lactococcus lactis strains deriving from milk or its products. Phylogenetic analysis of the pSMA198 Rep showed that the vast majority of closely related proteins derive from lactococcal dairy isolates. Additionally, cloning of the pSMA198 ori in L. lactis revealed a 100% stability of replication over 100 generations. Both pSMA198 and the chromosome of S. macedonicus exhibit a high percentage of potential pseudogenes, indicating that they have co-evolved under the same gene decay processes. We identified chromosomal regions in S. macedonicus that may have originated from pSMA198, also supporting a long co-existence of the two replicons. pSMA198 was also found in divergent biotypes of S. macedonicus and in strains isolated from dispersed geographic locations (e.g. Greece and Switzerland) showing that pSMA198’s acquisition is not a recent event. Conclusions/Significance Here we propose that S. macedonicus acquired plasmid pSMA198 from L. lactis via an ancestral genetic exchange event that took place most probably in milk or dairy products. We provide important evidence that point towards the dairy origin of this species. PMID:25584532

  13. The kinetics of phagocytosis of 198Au colloids ''in vitro''

    International Nuclear Information System (INIS)

    Astorri, N.L.; Bergoc, R.M.; Bianchin, A.M.; Caro, R.A.; Ihlo, J.E.; Rivera, E.S.

    1982-01-01

    The kinetics of the phagocytosis of 198-Au colloids by macrophages ''in vitro'' was studied by incubating during 5 hours phagocytic cells from the liver and the spleen of Wistar rats with colloidal radiogold particles, in the presence of an adequate culture medium (TC-199 with 10 per cent of Bovine Fetal Serum). In each experiment, the number of colloidal gold particles offered to each phatocytic cell, (Au) 0 and the mean rate of phagocytosis v, were calculated. The latter value was determined by measuring the radioactivity incorporated into the phagocytic cells during the incubation; it was expressed as the number of phagocytized colloidal gold particles per cell per minute. The values of log v = f [log (Au) 0 ] were plotted. The Lineweaver-Burk analysis of the results demonstrates that the kinetics of the phagocytosis of colloidal radiogold particles ''in vitro'' follows a model similar to Michaelis-Menten equations for enzyme reactions. The values of the substratum constant Ks and maximun velocity Vm were obtained by the regression analysis of the 1/v vs. 1/(Au) 0 graph. Vm was equal to 9.44 x 10 and 1.63 x 10 phagocytized colloidal gold particles per cell per minute for liver and spleen macrophages, respectively. Ks was equal to 6.01 x 10 9 and 8.02 x 10 8 colloidal gold particles per cell for liver and spleen macrophages, respectively. The significance of these differences is discussed and attributed mainly to a change of the specific engulfment rate constant. (author) [es

  14. Studies on implantation of 198Au-grain as a radiation therapy to cancer tissue

    International Nuclear Information System (INIS)

    Machida, Seiro

    1975-01-01

    The most effective dose of 198 Au-grain to be implanted and the clinicopathological findings after treatment are discussed. A safe dose of 198 Au-grain which could be implanted subcutaneously in rats, was under 2 mCi migration of 198 Au-grain was not recognized. In Yoshida sarcoma, transplanted subcutaneously into the backs of rats the most effective dose of 198 Au-grain was 2mCi/g of tumour tissue. However, about half of the rats implanted with this dosage died from the growing tumour. Histological examination of the implanted tumour tissue, revealed necrosis within a distance of only 0.4 mm from 198 Au-grain particles. In small metastatic tumours after 198 Au-grain implantation, there was necrosis i.e. pyknosis and karyolysis of the tumour cells, fibrosis and hyaline degeneration of the stroma. However, hardly any change in tumour size was detectable because of swelling and induration around the tumour. In some of the cases treated with 198 Au-grain combined with 60 Co or with chemotherapeutics, the tumour size was evidently reduced and became non-palable. Side effects were minimal except in one case which was afflicted temporarily with radiation sickness after an implantation of 200 mCi 198 Au-grain. In conclusion, the implantation of 198 Au-grain into the tumour was found to be very safe for the patients with surgically incurable cancer. Because of the short range of 198 Au-grain radioactivity, homogeneous density of 198 Au-grain into the whole tumour tissue is required. A combination with other radiations and/or with chemotherapeutics is also recommended. (author)

  15. 40 CFR 265.198 - Special requirements for ignitable or reactive wastes.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Special requirements for ignitable or reactive wastes. 265.198 Section 265.198 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) INTERIM STATUS STANDARDS FOR OWNERS AND OPERATORS OF HAZARDOUS WASTE...

  16. 40 CFR 264.198 - Special requirements for ignitable or reactive wastes.

    Science.gov (United States)

    2010-07-01

    ... waste, mixture, or dissolved material no longer meets the definition of ignitable or reactive waste... comply with the requirements for the maintenance of protective distances between the waste management... reactive wastes. 264.198 Section 264.198 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...

  17. 14 CFR 198.13 - Premium insurance-payment of premiums.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Premium insurance-payment of premiums. 198... (CONTINUED) WAR RISK INSURANCE AVIATION INSURANCE § 198.13 Premium insurance—payment of premiums. The insured must pay the premium for insurance issued under this part within the stated period after receipt of...

  18. Pulmonary uptake of 198Au during liver scanning in two patients with amyloidosis

    International Nuclear Information System (INIS)

    Goebel, R.

    1976-01-01

    Lung uptake of 198 Au-colloid, injected for a liver scan, is demonstrated in two patients with systemic amyloidosis. The incidence, importance and mechanism of this phenomenon is discussed. (orig.) [de

  19. Measurement of hepatic blood flow in the unanesthetized rabbit using 198Au and 125I rose bengal clearance technique

    International Nuclear Information System (INIS)

    Balabaud, C.; Roche, M.-C.; Dangoumau, Jacques

    1975-01-01

    Hepatic blood flow was measured in the unanesthetized rabbit using the clearance technique of 198 Au and 125 I RB. The values are: 71.82+-16.24ml.min -1 .kg -1 for 198 Au, and 60.21+-9.94ml.min -1 .kg -1 for 125 I RB (P 198 Au [fr

  20. 15 CFR 19.8 - When will Commerce entities suspend or terminate debt collection on a Commerce debt?

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false When will Commerce entities suspend or terminate debt collection on a Commerce debt? 19.8 Section 19.8 Commerce and Foreign Trade Office of the Secretary of Commerce COMMERCE DEBT COLLECTION Procedures To Collect Commerce Debts § 19.8 When will...

  1. Spectroscopy and measurement of electromagnetic moments in sup(198,200,210)Po

    International Nuclear Information System (INIS)

    Maier, K.H.

    1985-01-01

    The quadrupole coupling constants for the 210 Po Isup(π)=8 + , 11 - , 13 - isomers in Bi have been measured, and Q(11 - )=82(2) fm 2 and Q(13 - )=90(2) fm 2 normalized to Q( 210 Po8 + )=57 fm 2 are deduced. In beam γ-spectroscopy of sup(198,) 200 Po showed the (πh 2 sub(9/2) 8 + ) π(hsub(9/2)isub(13/2) 11 - ) and (visub(13/2) 12 + ) isomers. The B(E2 8 + ->6 + ) and Q(8 + ) in 198 Po to 210 Po are discussed, a sudden drop is found for the B(E2) in 198 Po. The B(E3, 11 - ->8 + ) rises very steeply in the light Po isotopes. (orig.)

  2. Synthesis and Characterization of Poly(Amidoamine Dendrimers Encapsulatd 198Au Nanoparticles

    Directory of Open Access Journals (Sweden)

    R. Ritawidya1,2

    2012-12-01

    Full Text Available Brachytherapy or internal radiotherapy is one of many methods used for treatment of cancer. This modality requires an agent with radionuclides that emits  or β particle with a proper energy. 198Au (99% β max = 0.96 MeV and t1/2 = 2.69 days is one of radionuclides that has been considered to be effective for the above-mentioned purpose. The purpose of this research was to synthesis and characterize poly(amidoamine (PAMAM G3.0 dendrimers encapsulated 198Au nanoparticles as a new brachytherapy agent. PAMAM G3.0 dendrimers encapsulated 198Au nanoparticles was successfully synthesized by a bottom-up method using sodium borohydride as a reductor. Purification was then performed by a size exclusion chromatography in order to separate large Au nanoparticles that were formed outside the cavity of PAMAM G3.0 dendrimers. Prior to the synthesis of PAMAM G3.0 dendrimers encapsulated 198Au nanoparticles, the synthetic procedure was first established by using a non-radioactive Au. The PAMAM G3.0 dendrimers encapsulated Au nanoparticles produced was then characterized by using an UV-Vis spectroscopy, a transmission electron microscopy (TEM, particle size analyzer (PSA, and an atomic absorption spectroscopy (AAS. Characterization results revealed that PAMAM G3.0 dendrimers encapsulated Au nanoparticles that were prepared from a reaction mixture of PAMAM G3.0 dendrimers and Au HAuCl4 with mol ratio of 2.8, was found to be a proper formula. It produced PAMAM G3.0 dendrimers encapsulated Au nanoparticles with diameter of 1.743 nm, spheris, uniform and drug loading value of 26.34%. This formula was then used in synthesis using radioactive Au, 198Au. Characterization results of PAMAM G3.0 dendrimers encapsulated 198Au nanoparticles gave a radiochemical purity of 99.4% and zero charge.

  3. In-beam spectroscopy of 198Po and 200Po nuclei

    International Nuclear Information System (INIS)

    Maj, A.

    1988-01-01

    The main purpose of this thesis is to answer the question whether any signs of collectivity or deformation are evident in 198 Po and 200 Po nuclei, situated on the border of the predicted new region of oblate deformation. Bearing this in mind spectroscopic investigations were performed. The level schemes of 198 Po and 200 Po were established, transition rates were determined and g-factors of isomeric states and, for 200 Po, the quadrupole moment of the 8 + - state were measured. The experimental techniques are described and the methods of evaluating the obtained data are presented. 74 refs., 7 figs., 9 tabs. (M.F.W.)

  4. ISO-PC Version 1.98: User`s guide

    Energy Technology Data Exchange (ETDEWEB)

    Rittmann, P.D.

    1995-05-02

    This document describes how to use Version 1.98 of the shielding program named ISO-PC. Version 1.98 corrects all known errors in ISOSHLD-II. In addition, a few numeric problems have been eliminated. There are three new namelist variables, 25 additional shielding materials, and 5 more energy groups. The two major differences with the original ISOSHLD-II are the removal of RIBD(radioisotope buildup and decay) source generator, and the removal of the non-uniform source distribution parameter, SSV1. This version of ISO-PC works with photon energies from 10 KeV to 10 MeV using 30 energy groups.

  5. Determination of the distribution of urea in baled straw using 198Au

    International Nuclear Information System (INIS)

    Marten, F.; Walljahn, M.

    1983-01-01

    A measuring method for the qualitative determination of urea in big compacts of straw with high density using 198 Au are described. The method allows at low cost and expenditure of time to draw conclusions concerning the productive quality of application facilities and to make necessary corrections of adjusting parameters

  6. Comparing the Methodologies in ASTM G198: Is There an Easy Way Out?

    Science.gov (United States)

    Samuel L. Zelinka

    2013-01-01

    ASTM(1) G198, Standard test method for determining the relative corrosion performance of driven fasteners in contact with treated wood, was accepted by consensus and published in 2011. The method has two different exposure conditions for determining fastener corrosion performance in treated wood. The first method places the wood and embedded...

  7. Comparing the Methodologies in ASTM G198 Using Combined Hygrothermal-Corrosion Modeling

    Science.gov (United States)

    Samuel L. Zelinka

    2013-01-01

    ASTM G198, “Standard test method for determining the relative corrosion performance of driven fasteners in contact with treated wood,” was accepted by consensus and published in 2011. The method has two different exposure conditions for determining fastener corrosion performance in treated wood. The first method places the wood and embedded fasteners in a...

  8. Application of Electrocoagulation Process for Reactive Red 198 Dye Removal from the Aqueous Solution

    Directory of Open Access Journals (Sweden)

    Mansooreh Dehghani

    2014-04-01

    Full Text Available Abstract Background and purpose:The main objectives of this research were to evaluating the application of electrocoagulation process for 198 dye from the aqueous phase and determining the optimum operating conditions to the dye removal using aluminum and iron electrodes. Materials and Methods:The present study was conducted in bench-scale. The spectrophotometer DR 5000 was used to determine the dye concentration. The effects of pH, retention time, voltage, dye concentration on the efficiency of electrocoagulation process were investigated. Data were analyzed in SPSS for Windows 16.0 using Pearson’scorrelation coefficient to analyze the relationship between these parameters. Results:The results showed that the optimal conditions for reactive red 198 (RR-198 dye removal from the aqueous solution are pH of 11, the voltage of 32 V, the initial dye concentration of 10 ppm, and the reaction time of 40 min. Pearson correlation analysis showed that there is a significant relationship between voltage and the reaction time with the removal efficiencies (P< 0.01. Conclusion:It was revealed that the removal efficiency of dye was directly proportional to the voltage and reaction time, but inversely proportional to the initial dye concentration. In conclusion, electrocoagulation process using two-fold iron and aluminum electrodes is an appropriate method for reducing the RR-198 dye in the aqueous phase.

  9. Rational Design of Cyclic Antimicrobial Peptides Based on BPC194 and BPC198

    Directory of Open Access Journals (Sweden)

    Anna D. Cirac

    2017-06-01

    Full Text Available A strategy for the design of antimicrobial cyclic peptides derived from the lead compounds c(KKLKKFKKLQ (BPC194 and c(KLKKKFKKLQ (BPC198 is reported. First, the secondary β-structure of BPC194 and BPC198 was analyzed by carrying out molecular dynamics (MD simulations. Then, based on the sequence pattern and the β-structure of BPC194 or BPC198, fifteen analogues were designed and synthesized on solid-phase. The best peptides (BPC490, BPC918, and BPC924 showed minimum inhibitory concentration (MIC values <6.2 μM against Pseudomonas syringae pv. syringae and Xanthomonas axonopodis pv. vesicatoria, and an MIC value of 12.5 to 25 μM against Erwinia amylovora, being as active as BPC194 and BPC198. Interestingly, these three analogues followed the structural pattern defined from the MD simulations of the parent peptides. Thus, BPC490 maintained the parallel alignment of the hydrophilic pairs K1–K8, K2–K7, and K4–K5, whereas BPC918 and BPC924 included the two hydrophilic interactions K3–Q10 and K5–K8. In short, MD simulations have proved to be very useful for ascertaining the structural features of cyclic peptides that are crucial for their biological activity. Such approaches could be further employed for the development of new antibacterial cyclic peptides.

  10. 9 CFR 381.198 - Importer to make application for inspection of poultry products offered for entry.

    Science.gov (United States)

    2010-01-01

    ... MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION POULTRY PRODUCTS... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Importer to make application for inspection of poultry products offered for entry. 381.198 Section 381.198 Animals and Animal Products FOOD...

  11. Tritium stripping in a nitrogen glove box using palladium/zeolite and SAES St 198 trademark

    International Nuclear Information System (INIS)

    Klien, J.E.; Wermer, J.R.

    1995-01-01

    Glove box clean-up experiments were conducted in a nitrogen glove box using palladium deposited on zeolite (Pd/z) and a SAES St 198 trademark getter as tritium stripping materials. Protium/deuterium samples spiked with tritium were released into a 620 liter glove box to simulate tritium releases in a 10,500 liter glove box. The Pd/z and the SAES St 198 trademark stripper beds produced a reduction in tritium activity of approximately two to three orders of magnitude and glove box clean-up was limited by a persistent background tritium activity level. Attempts to significantly reduce the glove box activity to lower levels without purging were unsuccessful

  12. Synoviorthesis with sup 198 Au colloid gold in haemophilia patients. A preliminary report

    Energy Technology Data Exchange (ETDEWEB)

    Ortonowski, G.; Ziemski, J.M.; Kucharski, W.; Woy-Wojciechowski, J. (Institute of Haematology, Warsaw (Poland). Dept. of Surgery Institute of Clinical Medicine, Warsaw (Poland). Dept. of Nuclear Medicine)

    1990-01-01

    In 1988-1989 fifteen patients with severe haemophilia A and recurrent bleedings into the knee joint, aged from 19 to 44 years were treated by an intraarticular injection of {sup 198}Au colloid gold. So far 10 of them were assessed after 6 months follow-up. In 6 cases cessation and in 2 cases reduction in number and volume of bleeding were observed. Only in 2 patients the frequency of haemarthroses remained unchanged. No significant difference in tracer uptake was observed between pretreatment {sup 99m}Tc-pertrechnate gamma scans of the knee joints and controls completed 6 months after the radiogold injections. It is worthy to stress the lower costs of the {sup 198}Au synoviorthesis as compared with surgical synovectomy of the knee joint. The radioisotope method is also much less traumatic to the patient than the surgical one. (orig.).

  13. Influence of Corynebacterium parvum on the phagocytosis of /sup 198/Au colloids in rats

    Energy Technology Data Exchange (ETDEWEB)

    Bergoc, R.M.; Bianchin, A.M.; Caro, R.A.; Ihlo, J.E.; Rivera, E.S. (Buenos Aires Univ. Nacional (Argentina). Facultad de Farmacia y Bioquimica)

    1982-07-01

    The kinetics of the phagocytosis of gelatin-protected /sup 198/Au colloids in Wistar rats treated with Corynebacterium Parvum (CBP), was studied in order to explain its mechanism of immunomodulation. A previously developed extracorporeal blood circulation technique was used. The changes in the rate of phagocytosis, v, after the administration of CBP, for a dose of the /sup 198/Au colloid smaller or higher than the substratum constant, were studied. In the first case, no significant changes of v were observed; in the second case, significant increases of v were determined, which reached a maximum 6 days after the CBP administration. The kinetic analysis of the obtained data indicates that the action of CBP is exerted on the stage of the entrance of the colloidal particle into the reticuloendothelial cell.

  14. Influence of Corynebacterium parvum on the phagocytosis of 198Au colloids in rats

    International Nuclear Information System (INIS)

    Bergoc, R.M.; Bianchin, A.M.; Caro, R.A.; Ihlo, J.E.; Rivera, E.S.

    1982-01-01

    The kinetics of the phagocytosis of gelatin-protected 198 Au colloids in Wistar rats treated with Corynebacterium Parvum (CBP), was studied in order to explain its mechanism of immunomodulation. A previously developed extracorporeal blood circulation technique was used. The changes in the rate of phagocytosis, v, after the administration of CBP, for a dose of the 198 Au colloid smaller or higher than the substratum constant, were studied. In the first case, no significant changes of v were observed; in the second case, significant increases of v were determined, which reached a maximum 6 days after the CBP administration. The kinetic analysis of the obtained data indicates that the action of CBP is exerted on the stage of the entrance of the colloidal particle into the reticuloendothelial cell. (author) [es

  15. Three-dimensional viewing and dosimetric calculations of Au-198 implants of the prostate

    International Nuclear Information System (INIS)

    Avizonis, V.N.; Anderson, K.M.; Jani, S.K.; Hussey, D.H.

    1991-01-01

    Dose gradients for brachytherapy vary considerably in three dimensions, which complicates conventional two-dimensional dosimetry. Recent developments in computer graphics technology have enabled visualization of anatomy and radiation doses in three dimensions. The objective of this paper is to develop a three-dimensional viewing and dosimetry program for brachytherapy and to test this system in phantoms and in patients undergoing Au-198 implants in the prostate. Three-dimensional computer algorithms for the author's Silicon Graphics supercomputing workstation were developed, tested, and modified on the basis of studies in phantoms and patients. Studies were performed on phantoms of known dimensions and gold seeds in known locations to assess the accuracy of volume reconstruction, seed placement, and isodose distribution. Isodose curves generated with the three-dimensional system were compared with those generated by a Theratronics Treatment Planning Computer using conventional methods. Twenty patients with permanent Au-198 interstitial implants in the prostate were similarly studied

  16. Application of 198Au colloid in the treatment of chronic knee synovial effusions

    International Nuclear Information System (INIS)

    Buril, J.; Zak, J.

    1979-01-01

    25 cases of chronic synovial exudates of the knee joint were treated with the use of 198 Au colloid (5mCi). Improvement was noted in two thirds of the patients after different numbers of applications (one to five). No improvement was seen in four cases of progressive polyarthritis or in two patients with gonarthrosis. This was to be expected though the number of the cases of the disease treated was very low. (author)

  17. miR-198 Represses the Proliferation of HaCaT Cells by Targeting Cyclin D2

    Directory of Open Access Journals (Sweden)

    Jian Wang

    2015-07-01

    Full Text Available Background: MiR-198 has been considered as an inhibitor of cell proliferation, invasion, migration and a promoter of apoptosis in most cancer cells, while its effect on non-cancer cells is poorly understood. Methods: The effect of miR-198 transfection on HaCaT cell proliferation was firstly detected using Cell Count Kit-8 and the cell cycle progression was analyzed by flow cytometry. Using bioinformatics analyses and luciferase assay, a new target of miR-198 was searched and identified. Then, the effect of the new target gene of miR-198 on cell proliferation and cell cycle was also detected. Results: Here we showed that miR-198 directly bound to the 3′-UTR of CCND2 mRNA, which was a key regulator in cell cycle progression. Overexpressed miR-198 repressed CCND2 expression at mRNA and protein levels and subsequently led to cell proliferation inhibition and cell cycle arrest in the G1 phase. Transfection ofSiCCND2 in HaCaT cells showed similar inhibitory effects on cell proliferation and cell cycle progression. Conclusion: In conclusion, we have identified that miR-198 inhibited HaCaT cell proliferation by directly targeting CCND2.

  18. Study of various processes for marking sediments with gold-198; Etude de divers procedes de marquages de sediments par l'or 198

    Energy Technology Data Exchange (ETDEWEB)

    Jeanneau, B [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1967-12-15

    The use of radioactive isotopes for the study of sediment deposits is based mainly on two methods: marking in the mass - a glass of an element which can be activated replaces the sediment; surface marking - a physico-chemical process is used to deposit a radio-element at the surface of the sediment. The second process is used in particular for sands when it is advantageous to have a large number of particles for statistical analysis. The aim of this work was to develop a rapid and simple method of marking which could be applied on the actual site of the experiment where equipment, may be limited. The method recommended for marking sand with gold-198 is a combination of the Petersen (treatment with tin chloride) and Campbell (treatment with silver) methods combined with prior treatments with nitric acid and caustic soda. Using this method it is possible to deposit 125 mg of gold per kilo of sediment with a yield of 95 per cent (i.e. 10 Ci/kg) using a hydrochloric acid solution containing gold. The problem of the solidity of the deposits, of their value and of their reproducibility is discussed from the point of view of the mineral constitution of the sand. (author) [French] L'utilisation d'isotopes radioactifs pour l'etude des deplacements sedimentaires fait, principalement appel a deux methodes: le marquage massique - un verre contenant un element activable remplace le sediment; le marquage superficiel - un traitement physico-chimique permet de deposer un radioelement a la surface du sediment. Le second procede est surtout employe pour les sables lorsqu'il est utile de disposer d'un grand nombre de grains pour des raisons statistiques. Le but de ce travail etait de mettre au point une methode simple et rapide de marquage pouvant etre appliquee sur le site meme de l'experience pour les utilisateurs disposant d'un equipement limite. Le procede preconise pour le marquage des sables par l'or 198 est une combinaison des methodes Petersen (traitement au chlorure d

  19. Coulomb excitation of the 4+1 states of 194Pt, 196Pt and 198Pt

    International Nuclear Information System (INIS)

    Fewell, M.P.; Gyapong, G.J.; Spear, R.H.

    1987-09-01

    Probabilities for the Coulomb excitation of the 4 1 + states of 194 Pt, 196 Pt, 198 Pt by the backscattering of 4 He, 12 C and 16 O ions are reported. Model-independent values of the matrix elements 1 + ; M(E4), 4 1 + > and 1 + , M(E2), 4 1 + > are extracted. Agreement with previous measurements of these matrix elements is good. Values of β 2 and β 4 are determined for 194 Pt and compared with calculations of these quantities

  20. Update of the BIG 1-98 Trial: where do we stand?

    Science.gov (United States)

    Joerger, Markus; Thürlimann, Beat

    2009-10-01

    There is accumulating data on the clinical benefit of aromatase inhibitors in the adjuvant treatment of early-stage breast cancer in postmenopausal women. The Breast International Group (BIG) 1-98 study is a randomized, phase 3, double-blind trial comparing four adjuvant endocrine treatments of 5 years duration in postmenopausal women with hormone-receptor-positive breast cancer: letrozole or tamoxifen monotherapy, sequential treatment with tamoxifen followed by letrozole, or vice versa. This article summarizes data presented at the 2009 St. Gallen early breast cancer conference: an update on the monotherapy arms of the BIG 1-98 study, and results from the sequential treatment arms. Implications for daily practice from BIG 1-98 and from other adjuvant trials will be discussed. Despite cross-over from tamoxifen to letrozole by 25% of the patients after unblinding of the tamoxifen monotherapy arm, the improvement of disease-free survival (HR 0.88, 0.78-0.99, p = 0.03) and time to distant recurrence (HR 0.85, 0.72-1.00, p = 0.05) for letrozole monotherapy as compared to tamoxifen monotherapy remained significant in the intention-to-treat (ITT) analysis. A trend for an overall survival advantage for letrozole was seen in the ITT analysis (HR 0.87, 0.75-1.02, p = 0.08). No statistically significant differences were found for the sequential treatment arms versus letrozole monotherapy, with respect to disease-free survival, time to distant recurrence or overall survival. Cumulative incidence analysis of breast cancer recurrence favors the initiation of adjuvant endocrine treatment with letrozole instead of tamoxifen, especially in patients at higher risk for early recurrence. Similarly, data suggest that patients commenced on letrozole can be switched to tamoxifen after 2 years, if required. The BIG 1-98 study update with median follow up of 76 months confirms a significant reduction in the risk of breast cancer recurrence and a trend towards improved overall survival

  1. Lifetimes near the bandhead of a shears band in 198Pb

    International Nuclear Information System (INIS)

    Kruecken, R.; Kruecken, R.; Clark, R.M.; Deleplanque, M.A.; Diamond, R.M.; Fallon, P.; Lee, I.Y.; Macchiavelli, A.O.; Schmid, G.J.; Stephens, F.S.; Vetter, K.; Dewald, A.; Peusquens, R.; Brentano, P. von; Hauschild, K.

    1998-01-01

    Subpicosecond lifetimes of states near the bandhead of an M1 band in 198 Pb have been measured with the recoil-distance Doppler-shift technique using the Gammasphere array and the Cologne plunger. The deduced B(M1) values are in agreement with the predictions of the tilted axis cranking (TAC) model. Their spin dependence continues the trend set by recently published B(M1) values for the high spin states in this band. The emerging picture gives strong support to the concept of open-quotes magnetic rotation,close quotes an alternative mode for the generation of rotational spectra in nuclei. copyright 1998 The American Physical Society

  2. Study of solid phase kinetics during cyanidation using the 198 Au radioactive tracer

    International Nuclear Information System (INIS)

    Barbus, A.; Pop, I.I.; Gaspar, E.

    1995-01-01

    During cyanidation, the various gold bearing pyrite sorts exhibit different behaviour, that sometimes cause increased cyanidation times influencing the reagent and power consumption, in the same time generating fluctuations in the recovery efficiencies. The introduction of the 198 Au radioactive tracer into the cyanidation circuit enabled us to follow several parameters of the cyanidation kinetics: the average residence time of the gold bearing pyrite in the technological equipment, information about the homogenization process, dispersion of solids and gold dissolution efficiency on each technological stage. (author)

  3. Hepatic blood flow with colloidal 198Au in the diagnosis of chronic hepatitis in children

    International Nuclear Information System (INIS)

    Marian, L.; Szantay, V.

    1975-01-01

    Tracer quantities of colloidal 198 Au were used to estimate the hepatic blood flow in normal children and in children with active or progressive chronic hepatitis and also to obtain scintigrams of the liver. In active chronic hepatitis a significant decrease in HBF values was observed, suggesting that the method may be used as a diagnostic criterion which is superior to hepatic scintigraphy. In progressive chronic hepatitis HBF values even lower than those in active hepatitis were observed. Together with more characteristic clinical findings and abnormal results of biochemical function tests, they underline the value of the method in estimating the severity and the evolution of the disease. (orig.) [de

  4. Gyromagnetic ratios of excited states in 198Pt; measurements and interacting boson approximation model calculations

    Science.gov (United States)

    Stuchbery, A. E.; Ryan, C. G.; Bolotin, H. H.; Morrison, I.; Sie, S. H.

    1981-07-01

    The enhanced transient hyperfine field manifest at the nuclei of swiftly recoiling ions traversing magnetized ferromagnetic materials was utilized to measure the gyromagnetic ratios of the 2 +1, 2 +2 and 4 +1 states in 198Pt by the thin-foil technique. The states of interest were populated by Coulomb excitation using a beam of 220 MeV 58Ni ions. The results obtained were: g(2 +1) = 0.324 ± 0.026; g(2 +2) = 0.34 ± 0.06; g(4 +1) = 0.34 ± 0.06. In addition, these measurements served to discriminate between the otherwise essentially equally probable values previously reported for the E2/M1 ratio of the 2 +2 → 2 +1 transition in 198Pt. We also performed interacting boson approximation (IBA) model-based calculations in the O(6) limit symmetry, with and without inclusion of a small degree of symmetry breaking, and employed the M1 operator in both first- and second-order to obtain M1 selection rules and to calculate gyromagnetic ratios of levels. When O(6) symmetry is broken, there is a predicted departure from constancy of the g-factors which provides a good test of the nuclear wave function. Evaluative comparisons are made between these experimental and predicted g-factors.

  5. Percutaneous transperineal placement of gold 198 seeds for treatment of carcinoma of the prostate

    Energy Technology Data Exchange (ETDEWEB)

    Crusinberry, R.A.; Kramolowsky, E.V.; Loening, S.A.

    1987-01-01

    Thirty-one patients have been treated for carcinoma of the prostate with /sup 198/Au seeds placed transperineally using transrectal ultrasonic guidance. Twenty patients have been followed postoperatively for periods ranging from 3 to 31 months, with an average follow-up time of 12 months. Cumulative dose of radiation to the prostate calculated by dosimetry was either 9000 rads or 15,000 rads. Serial transrectal ultrasound examinations performed on these patients showed a decrease in prostate size in all patients within 6 months of treatment, with a statistically significant decrease observed between the third and sixth months. No significant difference in amount or rate of tumor regression was noted when tumor stage and grade were correlated to volume decrease after treatment. Patients who received the larger doses of radiation (15,000 rads) showed a significantly greater rate of decline in prostatic volume than those who received 9000 rads. Seven patients underwent prostate biopsy between 12 and 18 months after treatment; six biopsies showed residual tumor. Complications after treatment included urinary retention because of prostatic edema (three), radiation urethritis (three), and rectal ulceration (one). Transperineal placement of /sup 198/Au is well tolerated and offers an alternative to external beam radiation for treatment of carcinoma of the prostate.

  6. SCM-198 attenuates early atherosclerotic lesions in hypercholesterolemic rabbits via modulation of the inflammatory and oxidative stress pathways.

    Science.gov (United States)

    Zhang, Yanfei; Guo, Wei; Wen, Yadan; Xiong, Qinghui; Liu, Hongrui; Wu, Jian; Zou, Yunzeng; Zhu, Yizhun

    2012-09-01

    To investigate SCM-198 (also known as "leonurine"), a compound in Herba leonuri, as well as its effect on the progression of atherosclerosis in hypercholesterolemic rabbits and underlying mechanisms. Thirty New Zealand male White rabbits (5 groups, n = 6) were fed either a normal diet or a high-cholesterol diet (1%). The rabbits on the high-cholesterol diet received treatments of low, moderate, and high doses of SCM-198 and placebo concurrently. Eight weeks later, the animals underwent ultrasonographic imaging. They were then sacrificed for further pathological and molecular biological analysis. SCM-198-treated rabbits showed a significant alleviation in the development of atherosclerosis in a dose-dependent manner. The lesions were smaller after the SCM-198 treatments. In addition, the elasticity of the arteries and hemodynamic status improved, accompanied with a decrease in smooth muscle cell migration and, macrophage infiltration, as well as the expression of platelet-endothelial cell adhesion molecule-1 (PECAM-1) in the aortas. Marginal changes in the lipid parameters were found in the SCM-198-treated rabbits, with high-density lipid cholesterol (HDL-C) elevation and triglyceride (TG) reduction at the high dose. SCM-198 treatment dose-dependently reduced levels of serum soluble vascular cell adhesion molecule-1 (sVCAM-1), soluble intercellular adhesion molecule-1 (sICAM-1), interleukin-6 (IL-6) and tumor necrosis factor-α (TNF-α), as well as the mRNA levels of VCAM-1, IL-6, TNF-α, monocyte chemoattractant protein-1 (MCP-1), iNOS and MMP-9 in the aorta. In addition, SCM-198 also dose-dependently increased the total antioxidant capacities and in parallel decreased the lipid peroxidation levels in the serum and liver. The antioxidant effects of SCM-198 were implicated by the enhanced activities of catalase (CAT), superoxide dismutase (SOD), glutathione peroxidase (GPx) and levels of glutathione (GSH) in the liver, as well as the mRNA levels of CAT, SOD-1 and

  7. A novel derivative of doxorubicin, AD198, inhibits canine transitional cell carcinoma and osteosarcoma cells in vitro.

    Science.gov (United States)

    Rathore, Kusum; Cekanova, Maria

    2015-01-01

    Doxorubicin (DOX) is one of the most commonly used chemotherapeutic treatments for a wide range of cancers. N-benzyladriamycin-14-valerate (AD198) is a lipophilic anthracycline that has been shown to target conventional and novel isoforms of protein kinase C (PKC) in cytoplasm of cells. Because of the adverse effects of DOX, including hair loss, nausea, vomiting, liver dysfunction, and cardiotoxicity, novel derivatives of DOX have been synthesized and validated. In this study, we evaluated the effects of DOX and its derivative, AD198, on cell viability of three canine transitional cell carcinoma (K9TCC) (K9TCC#1-Lillie, K9TCC#2-Dakota, K9TCC#4-Molly) and three canine osteosarcoma (K9OSA) (K9OSA#1-Zoe, K9OSA#2-Nashville, K9OSA#3-JJ) primary cancer cell lines. DOX and AD198 significantly inhibited cell proliferation in all tested K9TCC and K9OSA cell lines in a dose-dependent manner. AD198 inhibited cell viability of tested K9TCC and K9OSA cell lines more efficiently as compared to DOX at the same concentration using MTS (3-(4,5-dimethyl-2-yl)-5-(3-carboxymethoxyphenyl)-2-(4-sulfophenyl)-2h-tetrazolium) assay. AD198 had lower IC50 values as compared to DOX for all tested K9TCC and K9OSA cell lines. In addition, AD198 increased apoptosis in all tested K9TCC and K9OSA cell lines. AD198 increased the caspase activity in tested K9TCC and K9OSA cell lines, which was confirmed by caspase-3/7 assay, and cleavage of poly (ADP-ribose) polymerase (PARP) was confirmed by Western blotting analysis. In addition, AD198 cleaved PKC-δ, which subsequently activated the p38 signaling pathway, resulting in the apoptosis of tested K9TCC and K9OSA cell lines. Inhibition of the p38 signaling pathway by SB203580 rescued DOX- and AD198-induced apoptosis in tested K9TCC and K9OSA cell lines. Our in vitro results suggest that AD198 might be considered as a new treatment option for K9TCC and K9OSA cell lines cancers in vivo.

  8. A novel derivative of doxorubicin, AD198, inhibits canine transitional cell carcinoma and osteosarcoma cells in vitro

    Directory of Open Access Journals (Sweden)

    Rathore K

    2015-09-01

    Full Text Available Kusum Rathore, Maria Cekanova Department of Small Animal Clinical Sciences, College of Veterinary Medicine, The University of Tennessee, Knoxville, TN, USA Abstract: Doxorubicin (DOX is one of the most commonly used chemotherapeutic treatments for a wide range of cancers. N-benzyladriamycin-14-valerate (AD198 is a lipophilic anthracycline that has been shown to target conventional and novel isoforms of protein kinase C (PKC in cytoplasm of cells. Because of the adverse effects of DOX, including hair loss, nausea, vomiting, liver dysfunction, and cardiotoxicity, novel derivatives of DOX have been synthesized and validated. In this study, we evaluated the effects of DOX and its derivative, AD198, on cell viability of three canine transitional cell carcinoma (K9TCC (K9TCC#1-Lillie, K9TCC#2-Dakota, K9TCC#4-Molly and three canine osteosarcoma (K9OSA (K9OSA#1-Zoe, K9OSA#2-Nashville, K9OSA#3-JJ primary cancer cell lines. DOX and AD198 significantly inhibited cell proliferation in all tested K9TCC and K9OSA cell lines in a dose-dependent manner. AD198 inhibited cell viability of tested K9TCC and K9OSA cell lines more efficiently as compared to DOX at the same concentration using MTS (3-(4,5-dimethyl-2-yl-5-(3-carboxymethoxyphenyl-2-(4-sulfophenyl-2h-tetrazolium assay. AD198 had lower IC50 values as compared to DOX for all tested K9TCC and K9OSA cell lines. In addition, AD198 increased apoptosis in all tested K9TCC and K9OSA cell lines. AD198 increased the caspase activity in tested K9TCC and K9OSA cell lines, which was confirmed by caspase-3/7 assay, and cleavage of poly (ADP-ribose polymerase (PARP was confirmed by Western blotting analysis. In addition, AD198 cleaved PKC-δ, which subsequently activated the p38 signaling pathway, resulting in the apoptosis of tested K9TCC and K9OSA cell lines. Inhibition of the p38 signaling pathway by SB203580 rescued DOX- and AD198-induced apoptosis in tested K9TCC and K9OSA cell lines. Our in vitro results suggest

  9. Removal of Reactive Red 198 by Nanoparticle Zero Valent Iron in the Presence of Hydrogen Peroxide

    Directory of Open Access Journals (Sweden)

    Siroos Shojaei

    2017-04-01

    Full Text Available Although dyes are widely used in textile industries, they are carcinogenic, teratogenic and mutagenic. Industries discharge their wastewater containing a variety of colors into water resources and make harmful effect on the environment. The present study aims to Evaluate removal of reactive red 198 by nanoparticle zero valent iron (NZVI in the presence of hydrogen peroxide from aqueous solution. The effective parameters on the removal of dye such as the hydrogen peroxide concentration of NZVI, contact time, pH and dye concentration were investigated and optimized. According to the results, the combination of NZVI with hydrogen peroxide is more effective than single hydrogen peroxide. At pH = 4, contact time= 40 min, 200 M of hydrogen peroxide, dye concentration= 75 mg/L and concentration of NZVI 2g/L, color removal was achieved 91% approximately. Based on the results of experiments, using hydrogen peroxide- NZVI has high efficiency in removal of azo dye type.

  10. The extraction of low-concentrations of gold(I) with 198Au as a radiotracer

    International Nuclear Information System (INIS)

    Jianzhun Jiang; Chunli Liu; Weijin Zhou; Hongcheng Gao

    2002-01-01

    The solvent extraction of gold from alkaline cyanide solution was studied by using 198 Au as a radiotracer. The influence of several variables on the gold extraction, including the concentration of gold, the molar ratio of extractants to gold(I), the volume percentage of cosolvent and the pH value of the aqueous phase, was investigated. The results indicated that the radioactive tracer technique is a quick, accurate, and convenient tool to investigate the extraction behavior of an element existing in low concentrations. The experimental results indicated that the studied amines, tetradecyldimethylbenzylammonium chloride, N1923 and tri-n-octylamine, could be used as extractants for the recovery of gold from aqueous alkaline cyanide solutions. (author)

  11. Test of Magnetic Rotation near the band head in ^197,198Pb

    Science.gov (United States)

    Krücken, R.; Clark, R. M.; Deleplanque, M. A.; Diamond, R. M.; Fallon, P.; Macchiavelli, A. O.; Lee, I. Y.; Schmid, G. J.; Stephens, F. S.; Vetter, K.; Dewald, A.; Peusquens, R.; von Brentano, P.; Baldsiefen, G.; Chmel, S.; Hübel, H.; Becker, J. A.; Bernstein, L. A.; Hauschild, K.

    1998-04-01

    The concept of magnetic rotation is tested near the band head of shears-bands in ^197,198Pb by means of a lifetime experiment with the recoil distance method (RDM). The experiment was performed using the Gammasphere array in conjunction with the Cologne Plunger. The B(M1) values extracted from the measured lifetimes can prove the applicability of the concept of magnetic rotation for the states near the band head of these shears bands. The RDM results are compared with tilted axis cranking and shell model calculations. Furthermore the results will be used to test earlier DSAM lifetime measurements for states at higher spins. Preliminary results of this topic will be presented. This work is supported by DOE grant numbers DE-AC03-76SF00098 (LBNL), DE-FG02-91ER40609 (Yale), W-7405-ENG-48 (LLNL) and by the German BMBF for Cologne (No. 06 OK 668) and Bonn.

  12. Gold-198 and rose bengal marked with iodine-131 in the diagnostic of hepatic vesicular affections

    International Nuclear Information System (INIS)

    Manambelona Razafimalaza, J.

    1961-06-01

    Colloidal gold-198 makes it possible to obtain clear images of hepatic parenchyma; the examination can be repeated from different angles thus demonstrating the presence of pathologically inert regions, whether they be hydatic cysts, abscesses or neoplasia. The study of the disappearance curve for the colloid, together with a measurement of the blood volume, makes it possible also to calculate the hepatic flow. Using Rose Bengal marked with iodine-131, it is possible to obtain images of the liver and of the bile ducts, and to follow the elimination of the dye in the intestines. The simultaneous recording of the disappearance curves for the blood and of the appearance of the dye in the intestines constitutes an useful working test which is particularly sensible for evaluating the permeability of the bile ducts and, to a certain degree, the site of an obstruction. (author) [fr

  13. Role of rotational energy component in the dynamics of 16O+198Pt reaction

    Directory of Open Access Journals (Sweden)

    Sharma Manoj K.

    2017-01-01

    Full Text Available The role of rotational energy is investigated in reference to the dynamics of 16O+198Pt →214Rn∗ reaction using the sticking (IS and the non-sticking (INS limits of moment of inertia within the framework of dynamical cluster decay model. The decay barrier height and barrier position get significantly modified for the use of sticking or non-sticking choice, which in turn reproduce the evaporation residue and the fusion-fission cross-sections nicely by the IS approach, while the INS approach provides feasible addressal of data only for evaporation residue channel. Moreover, the fragmentation path of decaying fragments of 214Rn∗ compound nucleus gets influenced for different choices of moment of inertia. Beside this, the role of nuclear deformations i.e. static, dynamic quadurpole (β2 and higher order static deformation up to β4 are duly investigated for both choices of the moment of inertia.

  14. Use of special radioactive molds of gold-198 foils for brachytherapy in skin tumors

    International Nuclear Information System (INIS)

    Fernandes, Marco Antonio Rodrigues

    2000-01-01

    This work presents a methodology for manufacturing molds of radioactive gold-198 foils for treatment of skin tumors. The metallic purity of the gold foils produced by the Brazilian market is analyzed and compared to the characteristics of imported materials. Techniques for analyses of the activation homogeneity and dose profile in the plane of the mold are presented. The MicroShield, Version 4 System is used in the theoretical determination of the dose rate along the radioactive molds with different geometries and a comparison with experimental values obtained by optic density readings from special films used in quality control of radiotherapy equipment, dosimetry for thimble ionization chamber and thermoluminescent dosimeters is performed. The dosimeter calibration curve (dose-answer) obtained for the gold-198 energy, is compared with that obtained by a high dose rate iridium-192 small source, commonly used in the brachytherapy procedures. The studies show that the best homogeneity of dose distribution is obtained distributing the radioactive material in the form of concentric rings, with different activities, in number and dimensions dependent on the area to be treated. The method of the radiation dose calculation of the molds presented in this work, is compared with the traditional method used by brachytherapy services for low dose rate. Twenty lesions were treated with the proposed molds. The effectiveness of this methodology is further supported by the cosmetic-therapeutic results of the clinical applications, as well as cost analysis of the procedures. Also, it is analyzed the homogeneity of the dose rate distribution for an irradiated disk with attenuation by two silver coin, objectifying to eliminate loss of mass and consequently uncertainties in the activation when the sections of the disks are made in concentric rings. (author)

  15. The global establishment of a highly-fluoroquinolone resistant Salmonella enterica serotype Kentucky ST198 strain

    Directory of Open Access Journals (Sweden)

    Simon eLe Hello

    2013-12-01

    Full Text Available While the spread of Salmonella enterica serotype Kentucky resistant to ciprofloxacin across Africa and the Middle-East has been described recently, the presence of this strain in humans, food, various animal species (livestock, pets, and wildlife and in environment is suspected in other countries of different continents. Here, we report results of an in-depth molecular epidemiological study on a global human and non-human collection of S. Kentucky (n=70.We performed XbaI-pulsed field gel electrophoresis and multilocus sequence typing, assessed mutations in the quinolone resistance-determining regions, detected β-lactam resistance mechanisms, and screened the presence of the Salmonella genomic island 1 (SGI1. In this study, we highlight the rapid and extensive worldwide dissemination of the ciprofloxacin-resistant S. Kentucky ST198-X1-SGI1 strain since the mid-2000s in an increasingly large number of contaminated sources, including the environment. This strain has accumulated an increasing number of chromosomal and plasmid resistance determinants and has been identified in the Indian subcontinent, Southeast Asia and Europe since 2010. The second substitution at position 87 in GyrA (replacing the amino acid Asp appeared helpful for epidemiological studies to track the origin of contamination.This global study provides evidence leading to the conclusion that high-level resistance to ciprofloxacin in S. Kentucky is a simple microbiological trait that facilitates the identification of the epidemic clone of interest, ST198-X1-SGI1. Taking this into account is essential in order to detect and monitor it easily and to take rapid measures in livestock to ensure control of this infection.

  16. Discovery of the 198 s X-Ray Pulsar GRO J2058+42

    Science.gov (United States)

    Wilson, Colleen A.; Finger, Mark H.; Harmon, B. Alan; Chakrabarty, Deepto; Strohmayer, Tod

    1997-01-01

    GRO J2058+42, a transient 198 second x-ray pulsar, was discovered by the Burst and Transient Source Experiment (BATSE) on the Compton Gamma-Ray Observatory (CGRO), during a "giant" outburst in 1995 September-October. The total flux peaked at about 300 mCrab (20-50 keV) as measured by Earth occultation. The pulse period decreased from 198 s to 196 s during the 46-day outburst. The pulse shape evolved over the course of the outburst and exhibited energy dependent variations. BATSE observed five additional weak outbursts from GRO J2058+427 each with two week duration and peak pulsed flux of about 15 mcrab (20-50 keV), that were spaced by about 110 days. An observation of the 1996 November outburst by the Rossi X-ray Timing Explorer (RXTE) Proportional Counter Array (PCA) localized the source to within a 4' radius error circle (90% confidence) centered on R.A. = 20 h 59 m.0, Decl. = 41 deg 43 min (J2000). Additional shorter outbursts with peak pulsed fluxes of about 8 mCrab were detected by BATSE halfway between the first four 15 mCrab outbursts. The RXTE All-Sky Monitor detected 8 weak outbursts with approximately equal durations and intensities. GRO J2058+42 is most likely a Be/X-ray binary that appears to outburst at periastron and apastron. No optical counterpart has been identified to date and no x-ray source was present in the error circle in archival ROSAT observations.

  17. Discovery of the 198 Second X-Ray Pulsar GRO J2058+42

    Science.gov (United States)

    Wilson, Colleen A.; Finger, Mark H.; Harmon, B. Alan; Chakrabarty, Deepto; Strohmayer, Tod

    1998-01-01

    GRO J2058+42, a transient 198 s X-ray pulsar, was discovered by the Burst and Transient Source Experiment (BATSE) on the Compton Gamma Ray Observatory (CGRO) during a "giant" outburst in 1995 September-October. The total flux peaked at about 300 mcrab (20-50 keV) as measured by Earth occultation. The pulse period decreased from 198 to 196 s during the 46 day outburst. The pulse shape evolved over the course of the outburst and exhibited energy-dependent variations. BATSE observed five additional weak outbursts from GRO J2058 + 42, each with a 2 week duration and a peak-pulsed flux of about 15 mcrab (20-50 keV), that were spaced by about 110 days. An observation of the 1996 November outburst by the Rossi X-Ray Timing Explorer (RXTE) proportional counter array (PCA) localized the source to within a 4 s radius error circle (90% confidence) centered on R.A. = 20h 59m.0, decl. = 41 deg 43 s (J2000). Additional shorter outbursts with peak-pulsed fluxes of about 8 mcrab were detected by BATSE halfway between the first four 15 mcrab outbursts. The RXTE All-Sky Monitor detected all eight weak outbursts with approximately equal durations and intensities. GRO J2058 + 42 is most likely a Be/X-ray binary that appears to outburst at periastron and apastron, No optical counterpart has been identified to date, and no X-ray source was present in the error circle in archival ROSAT observations.

  18. Lifetimes of excited states in 196, 198Pt; Application of interacting boson approximation model to even Pt isotopes systematics

    Science.gov (United States)

    Bolotin, H. H.; Stuchbery, A. E.; Morrison, I.; Kennedy, D. L.; Ryan, C. G.; Sie, S. H.

    1981-11-01

    The lifetimes and lifetime limits of the low-lying excited states up to and including the 6 1+ levels in 196, 198Pt were determined by the recoil-distance method (RDM). Gamma-ray angular distributions in 198Pt were also measured. These states were populated by multiple Coulomb excitation using 220 MeV 58Ni ion beams and the measurements were carried out in coincidence with back-scattered projectiles. The measured mean lives of the states and B(E2) values inferred for the transitions between levels are presented. These specific findings, and the observed structure systematics obtained from the combination of the present results and those of prior workers for the even 194-198Pt isotopes, are critically compared with our structure calculations employing the interacting boson approximation (IBA) model incorporating a symmetry-breaking quadrupole force; evaluative comparisons are also made with boson expansion theory (BET) calculations.

  19. Lifetimes of excited states in 196,198Pt; application of interacting boson approximation model to even Pt isotopes systematics

    International Nuclear Information System (INIS)

    Bolotin, H.H.; Stuchbery, A.E.; Morrison, I.; Kennedy, D.L.; Ryan, C.G.; Sie, S.H.

    1981-01-01

    The lifetimes and lifetime limits of the low-lying excited states up to and including the 6 + 1 levels in sup(196, 198)Pt were determined by the recoil-distance method (RDM). Gamma-ray angular distributions in 198 Pt were also measured. These states were populated by multiple Coulomb excitation using 220 MeV 58 Ni ion beams and the measurements were carried out in coincidence with backscattering projectiles. The measured mean lives of the states and B(E2) values inferred for the transitions between levels are presented. These specific findings, and the observed structure systematics obtained from the combination of the present results and those of prior workers for the even sup(194-198)Pt isotopes, are critically compared with our structure calculations employing the interacting boson approximation (IBA) model incorporating a symmetry-breaking quadrupole force; evaluative comparisons are also made with boson expansion theory (BET) calculations. (orig.)

  20. Dosimetry considerations in the replacement of Radon-222 sources by gold-198 sources for the treatment of patients

    International Nuclear Information System (INIS)

    Swindon, T.N.

    1978-10-01

    Radon-222 sources have been used in Australia for the treatment of patients since 1929 and the calculation of absorbed doses from such sources is well established. An alternative to radon-222 is gold-198 which, in suitable form, may be used for permanent implantations and for surface, interstitial or intra-cavitary applications. Because radon-222 and gold-198 have different characteristics, the data to be used in calculating the absorbed dose to a point in a treatment volume will depend on the particular source used. The data are related to the energies and abundances of the beta and gamma rays emitted from the nuclei and on their half-lives (Tsub(1/2)). The energies of the beta and gamma rays emitted by radon-222 (in equilibrium with its decay products) and by gold-198 are given

  1. Comparison of liver scintigraphy with sup(99m)Tc-phytate and 198Au-colloid in diffuse hepatic disorders

    International Nuclear Information System (INIS)

    Kamoi, Itsuma; Watanabe, Katsushi; Kawahira, Kenjiro; Nakayama, Chikashi; Higashi, Yoshitaka

    1975-01-01

    sup(99m)Tc-phytate was evaluated as a liver scintigraphic radiopharmaceutical, and the results were compared with those of 198 Au-colloid. Both radionuclides were used on the same day in 55 cases of diffuse hepatic disorders. In 52 of the 55 cases, excellent liver images were obtained with sup(99m)Tc-phytate. Compared with 198 Au-colloid, sup(99m)Tc-phytate was more highly concentrated in the spleen and bone marrow and with higher background radioactivity, although their distributions generally coincided. The known diagnostic criteria for liver scintigraphy with 198 Au-colloid in diffuse hepatic disorders were proven applicable to sup(99m)Tc-phytate. (auth.)

  2. ramR Mutations Affecting Fluoroquinolone Susceptibility in Epidemic Multidrug-Resistant Salmonella enterica Serovar Kentucky ST198

    Directory of Open Access Journals (Sweden)

    Axel eCloeckaert

    2013-07-01

    Full Text Available A screening for non-target mutations affecting fluoroquinolone susceptibility was conducted in epidemic multidrug-resistant Salmonella enterica serovar Kentucky ST198. Among a panel of representative isolates (n=30, covering the epidemic, only three showed distinct mutations in ramR resulting in enhanced expression of genes encoding the AcrAB-TolC efflux system and low increase in ciprofloxacin MIC. No mutations were detected in other regulatory regions of this efflux system. Ciprofloxacin resistance in serovar Kentucky ST198 is thus currently mainly due to multiple target gene mutations.

  3. Lower expressed miR-198 and its potential targets in hepatocellular carcinoma: a clinicopathological and in silico study

    Directory of Open Access Journals (Sweden)

    Huang WT

    2016-08-01

    Full Text Available Wen-Ting Huang,1,* Han-Lin Wang,1,* Hong Yang,2 Fang-Hui Ren,1 Yi-Huan Luo,1 Chun-Qin Huang,1 Yue-Ya Liang,1 Hai-Wei Liang,1 Gang Chen,1 Yi-Wu Dang1 1Department of Pathology, 2Department of Ultrasonography, First Affiliated Hospital of Guangxi Medical University, Nanning, People’s Republic of China *These authors contributed equally to this work Purpose: To investigate the clinicopathological value and potential roles of microRNA-198 (miR-198 in hepatocellular carcinoma (HCC.Methods: Ninety-five formalin-fixed paraffin-embedded HCC and the para-cancerous liver tissues were gathered. Real-time reverse transcription quantitative polymerase chain reaction was applied to determine the miR-198 expression. The association between the miR-198 expression and clinicopathological features was examined. Meanwhile, potential target messenger RNAs of miR-198 in HCC were obtained from 14 miRNA prediction databases and natural language processing method, in which we pooled the genes related to the tumorigenesis and progression of HCC and classified them by their frequency. The selected target genes were finally analyzed in the Gene Ontology analysis and Kyoto Encyclopedia of Genes and Genomes pathway.Results: miR-198 expression was significantly lower in HCC than that in adjacent noncancerous liver tissues (1.30±0.72 vs 2.01±0.58, P<0.001. Low miR-198 expression was also correlated to hepatitis C virus infection (r=-0.48, P<0.001, tumor capsular infiltration (r=-0.43, P<0.001, metastasis (r=-0.26, P<0.010, number of tumor nodes (r=-0.25, P=0.013, vaso-invasion (r=-0.24, P=0.017, and clinical tumor node metastasis stage (r=-0.23, P=0.024. Altogether, 1,048 genes were achieved by the concurrent prediction from at least four databases and natural language processing indicated 1,800 genes for HCC. Further, 127 overlapping targets were further proceeded with for pathway analysis. The most enriched Gene Ontology terms in the potential target messenger RNAs of mi

  4. Results of infusion of pleural and peritoneal calcinoses with colloidal radiogold Au-198

    International Nuclear Information System (INIS)

    Grundmann, J.; Schnabel, U.

    1980-01-01

    This study begins with a general part, containing a description of the usual techniques, a summary of the side effects and complications and also a survey over the indications and contra-indications. This chapter is followed by the evaluation of the histologies taken of 572 patients with 744 applications. These patients received infusions of Au-198 intrapleurally and/or intraperitoneally between Januray 1st, 1960 and December 31st, 1970, in the Rudolf-Virchow Hospital, Berlin. The consideration of the overall patient population is followed by a classification of the individual primary tumours according to various aspects. In order to judge about the effectiveness of the applied radiogold therapy, we calculated the average survival times of the individual patient groups and additionally we assessed the influence due to effusion. For the 155 patients who received radiogold intrapleurally once, a rate of success of 56.1% resulted; this rate was 58.8% for the 58 patients suffering from carcinoma of the breast, and for the 59 patients with bronchial carcinoma this rate was 56.1%. Correspondingly we calculated a rate of success of 40.4% for 94 patients with intraperitoneal radiogold infusion and ascites. In the 57 patients suffering from ovarian tumours and ascites, we found a rate of success of 57.9%. Ten patients, who received radiogold not only intrapleurally, but also intraperitoneally, showed a mean survival rate of 16 months. (orig./MG) [de

  5. Retention studies in rats exposed to monodisperse aerosols of /sup 198/Au labeled carnauba wax particles

    Energy Technology Data Exchange (ETDEWEB)

    Tarroni, G.; Bassi, P.; Belvisi, M.B.; Bianco, A.

    1981-01-01

    Rats were exposed to monodisperse carnauba wax aerosols labeled with colloidal /sup 198/Au and the retained activity was followed both in vivo and in the lungs of serially sacrified animals. In vitro and in vivo tests have shown low leaching rates of the label. The deposited activity could then be followed without correction for particle solubility. The activity in vivo shows a three-exponential decay, characterized by half-times of a few hours, one day, and one month corresponding to the clearance of the material deposited respectively in the extrathoracic airways, in the tracheo-bronchial, and in the alveolar regions. A correlation was found between long term cleared activity and particle size but no correlation was found between particle size and clearance half times in the size range investigated. Statistical evaluation of the activity vs time in vivo and in excised lungs has shown that the long term retained activity pertains to the alveolar region and, if a large number of animals is not used, more accurate data of pulmonary clearance can be obtained by in vivo measurements than by serial sacrifices.

  6. Treatment of periocular tumours of horses using radioactive gold198 grains

    International Nuclear Information System (INIS)

    Wyn-Jones, G.

    1979-01-01

    The literature is briefly reviewed concerning the clinical features of equine cutaneous tumours. The data from 19 horses with periocular skin tumours are reported together with the results of their treatment by implantation with radioactive gold 198 . The principles governing the implantation of radioactive sources are explained and a method for computing the initial activity of the sources is outlined. Five histologically different tumours were treated in this series of 19 horses, 2 horses were bilaterally affected. The techniques of implantation using a simple needle/stilette combination and a purpose built gold grain implantation gun are described and the post-operative course of the animals is traced. The treatment was successful in ablating the tumour mass and preventing regrowth in 19 of 21 periocular tumour groups. The cosmetic effects of the treatment were found to be satisfactory. Emphasis is laid on the care needed in handling the radioactive material and on the need for a thorough understanding of the principles involved in radiotherapy. Doses received by the operator during an implantation procedure are quoted which show that the technique is safe as well as being effective. (author)

  7. Evaporation residue excitation function measurement for 19F + 194,198Pt reactions

    International Nuclear Information System (INIS)

    Singh, Varinderjit; Behera, B.R.; Kaur, Maninder

    2012-01-01

    Nuclear dissipation is one of the active fields in the present day nuclear physics research. Experimental signatures for dissipation are observed through large excess in pre-fission neutrons, γ-ray multiplicities from the compound nucleus, giant dipole resonance (GDR) γ-rays, light charged particles and evaporation residues in comparison to standard statistical model, for the heavy-ion induced fusion-fission or fusion-evaporation reactions (ERs). From the analysis of a large set of experimental data, it is well established that there exists a large dissipation at nuclear temperature above 1 MeV. But most of these probes are not sensitive to the dissipation within saddle. The ER cross-section is a probe which is sensitive to dissipation within the saddle point. Hence, the study of ER cross-section can be helpful in estimating the dissipation effects inside the saddle point. Also the other motivation for these measurements is to see the effect of shell closure on dissipation. With this motivation the evaporation cross-sections for 19 F + 194,198 Pt are measured at beam energy of 101 to 137.3 MeV. Of the above systems 19 F + 194 Pt populates 213 Fr (N = 126) shell closed compound nucleus (CN) whereas, other system populate 217 Fr (N = 130) non-shell closed CN

  8. 198Au grain implantation for early tongue cancer in patients of advanced age or poor performance status

    International Nuclear Information System (INIS)

    Ryu, Yoshiharu; Shibuya, Hitoshi; Hayashi, Keiji

    2013-01-01

    Brachytherapy using 198 Au grains is minimally invasive and the only curative treatment for early tongue cancer in patients of advanced age or poor performance status available in our institution. From March 1993 to February 2008, 198 Au grains were used to treat a group of 96 Stage I–II tongue cancer patients who could not undergo surgery or brachytherapy using 192 Ir pins because of an advanced age (≥75 years) or poor performance status (≥2). The patients were followed for 3.9 ± 3.3 years, and the cause-specific survival and local control rates were determined. Survival analyses were performed using the Kaplan-Meier method, and univariate and multivariate analyses were performed using the Cox proportional hazard model. The results were compared with those for a group of 193 early tongue-cancer patients who underwent treatment using iridium pins. The 5-year cause-specific survival and local control rates of the 198 Au grains group were 71% and 68%, respectively, both of which were 16% lower than the corresponding rates for the 192 Ir pins group. Our study demonstrated that as the last curative treatment available, 198 Au grain implantation could be used to achieve moderate treatment results for early tongue cancer in patients of advanced age or poor performance status

  9. Use of 198 Au, with surface labelling, in the study of solid transport by bed load in large natural channels

    International Nuclear Information System (INIS)

    Nakahira, S.

    1987-01-01

    The present study aims to present a method of measuring the bed load transport using a radioisotope technique in large natural channels. This study describes the basic principles of radioisotope application in this field, emphasizing the use of 198 Au for surface labelling of a natural sediment. Moreover, it presents the theoretical aspects, critical analysis, recommendations and comments on the methodology proposed. (author)

  10. 42 CFR 84.198 - Half-mask facepieces, full facepieces, mouthpieces, hoods, and helmets; fit; minimum requirements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Half-mask facepieces, full facepieces, mouthpieces... APPROVAL OF RESPIRATORY PROTECTIVE DEVICES Chemical Cartridge Respirators § 84.198 Half-mask facepieces, full facepieces, mouthpieces, hoods, and helmets; fit; minimum requirements. (a) Half-mask facepieces...

  11. Usefulness of 198Au grain implants in the treatment of oral and oropharyngeal cancer

    International Nuclear Information System (INIS)

    Horiuchi, Junichi; Shibuya, Hitoshi; Matsumoto, Satoru; Hoshina, Masao; Suzuki, Soji; Takeda, Masamune

    1991-01-01

    A series of 177 patients with squamous cell carcinoma of the oral cavity and oropharynx were treated with 198 Au grain (gold grain) implants. Sites of the lesion included the tongue, mouth floor, buccal mucosa and oropharynx, especially the soft palate and faucial arch. Three-fourths of the patients were treated in combination with prior external beam irradiation. A permanent implant dose (total decay) of 80-90 Gy was given in the form of gold grains alone and in combination with an external dose of no more than 30 Gy, and 60-70 Gy, total decay, was given after an external dose greater than 30 Gy. The 2-year recurrence-free rate was 86.2 percent in the case of T 1 N 0 , 72.6 percent in T 2 N 0 and 72.2 percent in T 3 N 0 . The difference in the results of implant therapy alone and combined therapy was not significant. Late complications were minimal after grain implantation alone, and when used in combination, less than 70 mCi of grain activity after a 40 Gy external dose did not seem to be a serious hazard with respect to bone damage except in the case of cancer of the mouth floor. Gold grain implants were useful and easily applied under local anesthesia to early or super-ficial lesions at sites where a rigid linear source could not be used. Exposure of the radiology staff was only 5-10 mrad in the case of the usual 10-15 (50-75 mCi) implant grains. (author). 12 refs.; 3 figs. ; 5 tabs

  12. Determination of the solid consumption in the transport of sands in sea beds with gold 198

    International Nuclear Information System (INIS)

    Rodriguez A, G.

    1983-01-01

    The study of the movement of sediments in sea beds, is necessary when one plans to build a port. Among the techniques used for this studies, it is the radiotracer balance that gives an useful estimation of the quantity of sediment that it moves per day and by meter (perpendicular to the displacement). The main objectives of this work are: to) to present the characteristics of the obtaining of the used radiotracer, describing details those used safety measures, b) to describe the handling of the radiotracer and it radiological safety, during the transport and injection in the sea bottom, c) description of the detection way and the used equipment, d) to describe the information processing obtained in the field and finally, e) the estimate of the solid consumption and the determination of the direction and speed of displacement of those sediments in the sea bottom, in front of the Tabasco coast, to be used jointly with the information obtained by means of other techniques so that one can make a good planning of the operations of dredging during the construction and later on the maintenance of the Dos Bocas marine terminal. The first step is to obtain the radiotracer that in this case was sand of uniform grain metric, marked superficially with Gold-198. The second step is to transport the sand to the place of interest, to place it in the injection equipment and to deposit it in the sea bottom. The third step is to detect the radiotracer in the sea bed, from a craft that drags a sled, which takes mounted a scintillation detector of sodium iodide activated with thallium NaI(Tl) (probe). The fourth step is to process the field information and to obtain the corresponding results. (Author)

  13. Symptoms of endocrine treatment and outcome in the BIG 1-98 study.

    Science.gov (United States)

    Huober, J; Cole, B F; Rabaglio, M; Giobbie-Hurder, A; Wu, J; Ejlertsen, B; Bonnefoi, H; Forbes, J F; Neven, P; Láng, I; Smith, I; Wardley, A; Price, K N; Goldhirsch, A; Coates, A S; Colleoni, M; Gelber, R D; Thürlimann, B

    2014-01-01

    There may be a relationship between the incidence of vasomotor and arthralgia/myalgia symptoms and treatment outcomes for postmenopausal breast cancer patients with endocrine-responsive disease who received adjuvant letrozole or tamoxifen. Data on patients randomized into the monotherapy arms of the BIG 1-98 clinical trial who did not have either vasomotor or arthralgia/myalgia/carpal tunnel (AMC) symptoms reported at baseline, started protocol treatment and were alive and disease-free at the 3-month landmark (n = 4,798) and at the 12-month landmark (n = 4,682) were used for this report. Cohorts of patients with vasomotor symptoms, AMC symptoms, neither, or both were defined at both 3 and 12 months from randomization. Landmark analyses were performed for disease-free survival (DFS) and for breast cancer free interval (BCFI), using regression analysis to estimate hazard ratios (HR) and 95 % confidence intervals (CI). Median follow-up was 7.0 years. Reporting of AMC symptoms was associated with better outcome for both the 3- and 12-month landmark analyses [e.g., 12-month landmark, HR (95 % CI) for DFS = 0.65 (0.49-0.87), and for BCFI = 0.70 (0.49-0.99)]. By contrast, reporting of vasomotor symptoms was less clearly associated with DFS [12-month DFS HR (95 % CI) = 0.82 (0.70-0.96)] and BCFI (12-month DFS HR (95 % CI) = 0.97 (0.80-1.18). Interaction tests indicated no effect of treatment group on associations between symptoms and outcomes. While reporting of AMC symptoms was clearly associated with better DFS and BCFI, the association between vasomotor symptoms and outcome was less clear, especially with respect to breast cancer-related events.

  14. Oil flow rate measurements using 198Au and total count technique

    International Nuclear Information System (INIS)

    Goncalves, Eduardo R.; Crispim, Verginia R.

    2013-01-01

    In industrial plants, oil and oil compounds are usually transported by closed pipelines with circular cross-section. The use of radiotracers in oil transport and processing industrial facilities allows calibrating flowmeters, measuring mean residence time in cracking columns, locate points of obstruction or leak in underground ducts, as well as investigating flow behavior or industrial processes such as in distillation towers. Inspection techniques using radiotracers are non-destructive, simple, economic and highly accurate. Among them, Total Count, which uses a small amount of radiotracer with known activity, is acknowledged as an absolute technique for flow rate measurement. A viscous fluid transport system, composed by four PVC pipelines with 13m length (12m horizontal and 1m vertical) and 1/2, 3/4, 1 and 2-inch gauges, respectively, interconnected by maneuvering valves was designed and assembled in order to conduct the research. This system was used to simulate different flow conditions of petroleum compounds and for experimental studies of flow profile in the horizontal and upward directions. As 198 Au presents a single photopeak (411,8 keV), it was the radioisotope chosen for oil labeling, in small amounts (6 ml) or around 200 kBq activity, and it was injected in the oil transport lines. A NaI scintillation detector 2'x 2', with well-defined geometry, was used to measure total activity, determine the calibration factor F and, positioned after a homogenization distance and interconnected to a standardized electronic set of nuclear instrumentation modules (NIM), to detect the radioactive cloud. (author)

  15. Accidental Radiogold ({sup 198}Au) Liver Scan Overdose with Fatal Outcome

    Energy Technology Data Exchange (ETDEWEB)

    Baron, J. M.; Yachnin, S.; Polcyn, R.; Fitch, F. W.; Sturner, W. Q. [Pritzker School of Medicine of the University of Chicago and Argonne Cancer Research Hospital (operated by the University of Chicago for the United States Atomic Energy Commission), Chicago, IL (United States)

    1969-10-15

    The first reported instance of accidental overdosage with intravenously administered radioactive colloidal gold ({sup 198}Au) given for liver scanning is described. A 73-year-old female with erythremic myelosis accompanied by hepatosplenomegaly received 200 millicuries instead of the intended dose of 200 microcuties. She was transferred to the Argonne Cancer Research Hospital at the University of Chicago the following day. External monitoring on the second day showed 35 mR/h at 1 metre. Total body scanning of the patient without administration of additional isotope revealed high activity and an abnormally extensive reticuloendothelial uptake. Blood activity at that time was 0.04 microcuries per millilitre of whole blood. Estimated radiation dosage to be received by the bone marrow was 400-500 Rand by the liver was 7000-8000 R. There were no symptoms of acute radiation exposure. The patient was placed in strict isolation on the fifth day, and surgical scrub precautions were continued until day 63. Supportive care included buffy . coat and platelet packs, prophylactic sterilization of the gastrointestinal tract, and, later, androgen and corticosteroids. The expected decrease in peripheral blood lymphocytes, granulocytes, and platelets occurred in the order mentioned. Liver size decreased, but function tests did not deteriorate. There was no difficulty with clinical infection during the granulocytopenic phase. Lymphocytes and, later, granulocytes showed recovery to subnormal levels, but platelets failed to rise above 8000/mm{sup 3} after the 21st day. The patient developed haematuria and purpura, and suffered a terminal spontaneous intracerebral haemorrhage on the 69th day. At post mortem there was evidence for patchy areas of granulocytic and erythroid marrow regeneration, and some extramedullary sites contained isolated clones of young red cell precursors. There were no specific changes in the liver. The lack of effective methods to mobilize or metabolize colloidal

  16. Disruption of the Putative Vascular Leak Peptide Sequence in the Stabilized Ricin Vaccine Candidate RTA1-33/44-198

    Directory of Open Access Journals (Sweden)

    Charles B. Millard

    2013-01-01

    Full Text Available Vitetta and colleagues identified and characterized a putative vascular leak peptide (VLP consensus sequence in recombinant ricin toxin A-chain (RTA that contributed to dose-limiting human toxicity when RTA was administered intravenously in large quantities during chemotherapy. We disrupted this potentially toxic site within the more stable RTA1-33/44-198 vaccine immunogen and determined the impact of these mutations on protein stability, structure and protective immunogenicity using an experimental intranasal ricin challenge model in BALB/c mice to determine if the mutations were compatible. Single amino acid substitutions at the positions corresponding with RTA D75 (to A, or N and V76 (to I, or M had minor effects on the apparent protein melting temperature of RTA1-33/44-198 but all four variants retained greater apparent stability than the parent RTA. Moreover, each VLP(− variant tested provided protection comparable with that of RTA1-33/44-198 against supralethal intranasal ricin challenge as judged by animal survival and several biomarkers. To understand better how VLP substitutions and mutations near the VLP site impact epitope structure, we introduced a previously described thermal stabilizing disulfide bond (R48C/T77C along with the D75N or V76I substitutions in RTA1-33/44-198. The D75N mutation was compatible with the adjacent stabilizing R48C/T77C disulfide bond and the Tm was unaffected, whereas the V76I mutation was less compatible with the adjacent disulfide bond involving C77. A crystal structure of the RTA1-33/44-198 R48C/T77C/D75N variant showed that the structural integrity of the immunogen was largely conserved and that a stable immunogen could be produced from E. coli. We conclude that it is feasible to disrupt the VLP site in RTA1-33/44-198 with little or no impact on apparent protein stability or protective efficacy in mice and such variants can be stabilized further by introduction of a disulfide bond.

  17. Outcomes of special histotypes of breast cancer after adjuvant endocrine therapy with letrozole or tamoxifen in the monotherapy cohort of the BIG 1-98 trial

    DEFF Research Database (Denmark)

    Munzone, E; Giobbie-Hurder, A; Gusterson, B A

    2015-01-01

    BACKGROUND: We investigated the outcomes of postmenopausal women with hormone receptor-positive, early breast cancer with special histotypes (mucinous, tubular, or cribriform) enrolled in the monotherapy cohort of the BIG 1-98 trial. PATIENTS AND METHODS: The intention-to-treat BIG 1-98 monothera...

  18. GPX1 Pro(198)Leu polymorphism, erythrocyte GPX activity, interaction with alcohol consumption and smoking, and risk of colorectal cancer

    DEFF Research Database (Denmark)

    Hansen, Rikke Dalgaard; Krath, Britta N.; Frederiksen, Kirsten

    2009-01-01

    polymorphism and several lifestyle factors predict GPX activity in erythrocytes. The present study was nested within the prospective “Diet, Cancer and Health” study of 57,053 Danes including 375 colorectal cancer cases and a comparison group of 779 individuals matched on gender. Biomaterial was sampled...... and information on lifestyle factors was obtained from questionnaires filled in at enrolment in 1993–1997. GPX1 Pro198Leu, hOGG1 Ser326Cys and erythrocyte GPX enzyme activity were not associated with risk of colorectal cancer. We observed a higher risk associated with alcohol consumption and smoking among......198Leu genotype, gender, smoking intensity, and intake of fruits and vegetables. Our results indicate that lifestyle-related oxidative stress may be a risk factor for colorectal cancer among subjects with a lowered defence....

  19. Letrozole compared with tamoxifen for elderly patients with endocrine-responsive early breast cancer: the BIG 1-98 trial

    DEFF Research Database (Denmark)

    Crivellari, D.; Sun, Z.; Coates, A.S.

    2008-01-01

    PURPOSE: To explore potential differences in efficacy, treatment completion, and adverse events (AEs) in elderly women receiving adjuvant tamoxifen or letrozole for five years in the Breast International Group (BIG) 1-98 trial. METHODS: This report includes the 4,922 patients allocated to 5 years...... of letrozole or tamoxifen in the BIG 1-98 trial. The median follow-up was 40.4 months. Subpopulation Treatment Effect Pattern Plot (STEPP) analysis was used to examine the patterns of differences in disease-free survival and incidences of AEs according to age. In addition, three categoric age groups were...... had superior efficacy (DFS) compared with tamoxifen in all age groups. On the basis of a small number of patients older than 75 years (6%), age per se should not unduly affect the choice of adjuvant endocrine therapy Udgivelsesdato: 2008/4/20...

  20. COMBINED TREATMENT OF 198 CASES OF INSOMNIA WITH ACUPUNCTURE OF BODY ACUPOINTS PLUS PELLET PRESSING OF OTOPOINTS

    Institute of Scientific and Technical Information of China (English)

    李兰敏; 张立夫; 王丹

    2001-01-01

    Objective: To observe the therapeutic effect of acupuncture of body acupoints plus otopoint pelletpressing for treatment of insomnia. Methods: A total of 198 cases of insomnia patients were observed. Straight inserted the filiform needles into Shenmen (HT 7), Neiguan (PC 6), Zhaohai (KI 6) and Zusanli (ST 36) and manipulated the needles with uniform reinforcing-reducing method, then otopoints as Ershenmen (MA-TF 1 ), Shen (MA-SC), Gan (MA-SC 5), etc. were stimulated by pressing the stuck vaccaria seeds. Ten treatments were considered as a therapeutic course. Results: Of the 198 cases, 65 (32%) were cured, 76 (38%) had remarkable improvement, 53 (26%) had improvement and 4 (2%) had no effect, with the total effective rate being 97% Conclusion:Acupuncture of body acupoints plus otopoint pellet pressing works well in treatment of insomnia.

  1. Synthetic localization of a second toxin-binding region within residues α182-198 of Torpedo acetylcholine receptor

    International Nuclear Information System (INIS)

    Mulac-Jericevic, B.; Atassi, M.Z.

    1986-01-01

    A peptide, corresponding to the region 182-198 (peptide αT182-198) of the α chain of Torpedo californica acetylcholine (AChR) was synthesized, purified and characterized. The binding activities of this peptide to α-bungarotoxin and to cobratoxin were studied and compared to the activities of the previously reported synthetic peptide αT125-147 of Torpedo α chain. Binding studies were performed by quantitative radiometric titrations by studying the binding of 125 I-labelled peptides to toxin adsorbents and the binding of 125 I labelled toxins to peptide adsorbents. The specificity of the binding was confirmed by appropriate inhibition experiments. The results showed unequivocally that the α chain of AChR contains a second toxin binding region which resides within, but may not comprise all of, the residues 182-198. The binding of toxins to one synthetic region is inhibited by the other. Thus, the α chain of AChR contains at least two toxin binding regions which may either be two faces of a larger single binding site or, alternatively, two binding sites that are spatially very close and thus the binding of one synthetic region to the toxin site could sterically obstruct the binding of the second synthetic region

  2. Preparation of magnetic composite based on zinc oxide nanoparticles and chitosan as a photocatalyst for removal of reactive blue 198

    International Nuclear Information System (INIS)

    Nguyen, Van Cuong; Nguyen, Ngoc Lam Giang; Hue Pho, Quoc

    2015-01-01

    In this study a novel magnetic composite used as a photocatalyst with combination of zinc oxide nanoparticles and chitosan (ZnO/Fe 3 O 4 /CS) was synthesized by a simple co-precipitation method. The role of the prepared magnetic nanocomposite is to improve the removal efficiency of textile dye due to the photocatalytic activity of zinc oxide nanoparticles and reusable capacity of Fe 3 O 4 magnetic nanoparticles. Constituents and structure properties of ZnO/Fe 3 O 4 /CS were investigated by scanning electron microscopy (SEM), x-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR) and thermogravimetric analysis (TGA). Magnetic property of the prepared composite was determined by vibrating sample magnetometer (VSM). The results demonstrated that ZnO/Fe 3 O 4 /CS nanocomposite dramatically improved the removal efficiency of reactive blue 198 dye (RB198) with high photocatalytic activity and easy separation by a permanent magnet. In addition, the photocatalytic activity of the prepared composite was also performed under different parameters such as contact time, initial pH, the amount of composite and initial concentration of RB198. Interestingly, ZnO/Fe 3 O 4 /CS nanocomposite still showed high removal efficiency after recycling three times and performed in a real textile dyeing wastewater. (paper)

  3. Reagents for Astatination of Biomolecules. 5. Evaluation of hydrazone linkers in 211At- and 125I-labeled closo-decaborate(2-) conjugates of Fab′ as a means of decreasing kidney retention

    Science.gov (United States)

    Wilbur, D. Scott; Chyan, Ming-Kuan; Hamlin, Donald K.; Nguyen, Holly; Vessella, Robert L.

    2011-01-01

    Evaluation of monoclonal antibody (MAb) fragments (e.g. Fab′, Fab or engineered fragments) as cancer-targeting reagents for therapy with the α-particle emitting radionuclide astatine-211 (211At) has been hampered by low in vivo stability of the label and a propensity of these proteins localize to kidneys. Fortunately, our group has shown that the low stability of the 211At label, generally a meta- or para-[211At]astatobenzoyl conjugate, on MAb Fab′ fragments can be dramatically improved by use of closo-decaborate(2-) conjugates. However, the higher stability of radiolabeled MAb Fab′ conjugates appears to result in retention of the radioactivity in kidneys. This investigation was conducted to evaluate whether the retention of radioactivity in kidney might be decreased by the use of acid-cleavable hydrazone between the Fab′ and the radiolabeled closo-decaborate(2-) moiety. Five conjugation reagents containing sulfhydryl-reactive maleimide groups, a hydrazone functionality and a closo-decaborate(2-) moiety were prepared. In four of the five conjugation reagents, a discrete polyethylene glycol (PEG) linker was used, and one substituent adjacent to the hydrazone was varied (phenyl, benzoate, anisole or methyl) to provide varying acid-sensitivity. In the initial studies, the five maleimido-closo-decaborate(2-) conjugation reagents were radioiodinated (125I or 131I), then conjugated with an anti-PSMA Fab′ (107-1A4 Fab′). Biodistributions of the five radioiodinated Fab′ conjugates were obtained in nude mice at 1, 4 and 24 h post injection (pi). In contrast to closo-decaborate(2-) conjugated to 107-1A4 Fab′ through a non-cleavable linker, two conjugates containing either a benzoate or a methyl substituent on the hydrazone functionality displayed clearance rates from kidney, liver and spleen that were similar to those obtained with directly radioiodinated Fab′ (i.e. no conjugate). The maleimido-closo-decaborate(2-) conjugation reagent containing a benzoate

  4. Relative Effectiveness of Letrozole Compared With Tamoxifen for Patients With Lobular Carcinoma in the BIG 1-98 Trial

    DEFF Research Database (Denmark)

    Metzger Filho, Otto; Giobbie-Hurder, Anita; Mallon, Elizabeth

    2015-01-01

    assigned onto the Breast International Group (BIG) 1-98 trial and who had centrally reviewed pathology data were included (N = 2,923). HER2-negative IDC and ILC were additionally classified as hormone receptor-positive with high (luminal B [LB] -like) or low (luminal A [LA] -like) proliferative activity......PURPOSE: To evaluate the relative effectiveness of letrozole compared with tamoxifen for patients with invasive ductal or lobular carcinoma. PATIENTS AND METHODS: Patients diagnosed with early-stage invasive ductal carcinoma (IDC) or classic invasive lobular carcinoma (ILC) who were randomly...

  5. Test of time reversal invariance in p-p elastic scattering at 198.5 MeV

    International Nuclear Information System (INIS)

    Davis, C.A.; Greeniaus, L.G.; Moss, G.A.

    1986-01-01

    A precise measurement of the polarization-analyzing power difference in p-p elastic scattering has been made at 198.5 MeV to improve the experimental limits on time reversal violation in proton-proton scattering in this energy region. The experiment was performed in a kinematic regime where sensitivities to time reversal violating amplitudes should be high. Experimental methods which eliminated the need to refer to absolute values of the beam polarization or to the analyzing power of a polarimeter were used. The result is (P-A) = 0.0047 with a statistical uncertainty of +- 0.0025 and a systematic uncertainty of +- 0.0015

  6. Cholesterol, Cholesterol-Lowering Medication Use, and Breast Cancer Outcome in the BIG 1-98 Study

    DEFF Research Database (Denmark)

    Borgquist, Signe; Giobbie-Hurder, Anita; Ahern, Thomas P

    2017-01-01

    on cholesterol levels and hypercholesterolemia per se may counteract the intended effect of aromatase inhibitors. Patients and Methods The Breast International Group (BIG) conducted a randomized, phase III, double-blind trial, BIG 1-98, which enrolled 8,010 postmenopausal women with early-stage, hormone receptor......-positive invasive breast cancer from 1998 to 2003. Systemic levels of total cholesterol and use of CLM were measured at study entry and every 6 months up to 5.5 years. Cumulative incidence functions were used to describe the initiation of CLM in the presence of competing risks. Marginal structural Cox proportional...

  7. Recent results of measurements of evaporation residue excitation functions for 19F+194,196,198Pt and 16,18O+198Pt systems with HYRA spectrometer at IUAC

    Directory of Open Access Journals (Sweden)

    Behera B.R.

    2015-01-01

    Full Text Available In this talk results of the evaporation residue (ER cross sections for the 19F+194,196,198Pt (forming compound nuclei 213,215,217Fr and 16,18O+198Pt (forming compound nuclei 214,216Rn systems measured at Hybrid Recoil mass Analyzer (HYRA spectrometer installed at the Pelletron+LINAC accelerator facility of the Inter University Accelerator Center (IUAC, New Delhi are reported. The survival probabilities of 215Fr and 217Fr with neutron numbers N = 126 are found to be lower than the survival probabilities of 215Fr and 217Fr with neutron numbers N = 128 and 130 respectively. Statistical model analysis of the ER cross sections show that an excitation energy dependent scaling factor of the finite-range rotating liquid drop model fission barrier is necessary to fit the experimental data. For the case of 214,216Rn, the experimental ER cross sections are compared with the predictions from the statistical model calculations of compound nuclear decay where Kramer’s fission width is used. The strength of nuclear dissipation is treated as a free parameter in the calculations to fit the experimental data.

  8. Recent results of measurements of evaporation residue excitation functions for 19F+194,196,198Pt and 16,18O+198Pt systems with HYRA spectrometer at IUAC

    Science.gov (United States)

    Behera, B. R.

    2015-01-01

    In this talk results of the evaporation residue (ER) cross sections for the 19F+194,196,198Pt (forming compound nuclei 213,215,217Fr) and 16,18O+198Pt (forming compound nuclei 214,216Rn) systems measured at Hybrid Recoil mass Analyzer (HYRA) spectrometer installed at the Pelletron+LINAC accelerator facility of the Inter University Accelerator Center (IUAC), New Delhi are reported. The survival probabilities of 215Fr and 217Fr with neutron numbers N = 126 are found to be lower than the survival probabilities of 215Fr and 217Fr with neutron numbers N = 128 and 130 respectively. Statistical model analysis of the ER cross sections show that an excitation energy dependent scaling factor of the finite-range rotating liquid drop model fission barrier is necessary to fit the experimental data. For the case of 214,216Rn, the experimental ER cross sections are compared with the predictions from the statistical model calculations of compound nuclear decay where Kramer's fission width is used. The strength of nuclear dissipation is treated as a free parameter in the calculations to fit the experimental data.

  9. Application of gold-198 in investigation of technological processes in cellulose and paper industry and in production of combined forage

    International Nuclear Information System (INIS)

    Petkov, P.M.; Kralev, Kh.I.

    1979-01-01

    To label cellulose fibers and sawdust in investigation of acting installations for production of cellulose and semicellulose, gold-198 was used. The aim of investigation was to determine time of material's transfer in the cellulose production shop from the boiler to the outlet from washer and in the semicellulose production shop from the feeding bunker to refiners. Stable labelling of the cellulose fibers and sawdust has been gained, which permitted successfully to perform investigations of two installations in spite of high temperature and pressure and aggressive medium. Gold-198 is also a good indicator in investigations of technological lines of feed mills. After labelling of one of the main components of fodder mixture, it is introduced into mixer in the proportion used in the production for mixing. It is possible to trace process of mixing either by means of continious registering of by means of sampling. As a result of investigations, optimal time of mixing, segregation processes influence of the factory transport and intershop idle stand on the homogenity of product for factories with different equipment, can be determined [ru

  10. Self-charging of 198Au-labeled monodisperse gold aerosols studied with a miniature electrical mobility spectrometer

    International Nuclear Information System (INIS)

    Yeh, H.C.; Newton, G.J.; Raabe, O.G.; Boor, D.R.

    1976-01-01

    Knowledge of the electrostatic character of an aerosol may be essential in assessing its potential inhalation hazard. In inhalation studies with radioactive aerosols, the aerosol charge state may change in the course of transport due to the emission of α, β or γ radiations. This paper describes an experimental study of the self-charging of 198 Au-labeled aerosols of monodisperse gold spheres by β emission. A miniature aerosol electrical mobility spectrometer, suitable for use in inhalation studies with radioactive aerosols, was developed and used in this study. This device is relatively inexpensive, easy to manufacture and its contamination by radioactive material has been minimized. Using polystyrene latex spheres, ranging in diameter from 0.176 to 1.18 μm, the spectrometer was calibrated with flow rates ranging from 400 to 4800 ml/min. Experiments with two sizes of 198 Au-labeled monodisperse gold aerosols were performed. Results indicate that the radioactivity of an aerosol can cause self-charging and affect the charge distribution. (author)

  11. Preparation and characterization of monodisperse microcapsules with alginate and bentonite via external gelation technique encapsulating Pseudomonas putida Rs-198.

    Science.gov (United States)

    Li, Xuan; Wu, Zhansheng; He, Yanhui; Ye, Bang-Ce; Wang, Jun

    2017-10-01

    This paper evaluated the external gelation technique for preparing microcapsules. The microcapsules were consisted of Pseudomonas putida Rs-198 (Rs-198) core and sodium alginate (NaAlg)-bentonite (Bent) shell. Different emulsification rotation speeds and core/shell ratios were used to prepare the microcapsules of each formulation. The near-spherical microcapsules were monodisperse with a mean diameter of 25-100 μm and wrinkled surfaces. Fourier transform infrared spectrophotometry (FTIR) and thermogravimetric analysis (TGA) revealed the physical mixture of the wall material and the superior thermal stability of the microcapsules. Percentage yield, water content, and encapsulation efficiency were evaluated and correlated with the changes in emulsification rotation speed and core/shell ratio. In vitro release experiments demonstrated that 60% of the bacteria were released from the NaAlg-Bent microcapsules within three days. Considerably better survival was observed for encapsulated cells compared to free cells, especially in pH 4.0 and 10.0. In summary, the desired properties of microcapsules can be obtained by external gelation technique and the microcapsules on the bacteria had a good protective effect.

  12. Characterization of the SUMO-binding activity of the myeloproliferative and mental retardation (MYM-type zinc fingers in ZNF261 and ZNF198.

    Directory of Open Access Journals (Sweden)

    Catherine M Guzzo

    Full Text Available SUMO-binding proteins interact with SUMO modified proteins to mediate a wide range of functional consequences. Here, we report the identification of a new SUMO-binding protein, ZNF261. Four human proteins including ZNF261, ZNF198, ZNF262, and ZNF258 contain a stretch of tandem zinc fingers called myeloproliferative and mental retardation (MYM-type zinc fingers. We demonstrated that MYM-type zinc fingers from ZNF261 and ZNF198 are necessary and sufficient for SUMO-binding and that individual MYM-type zinc fingers function as SUMO-interacting motifs (SIMs. Our binding studies revealed that the MYM-type zinc fingers from ZNF261 and ZNF198 interact with the same surface on SUMO-2 recognized by the archetypal consensus SIM. We also present evidence that MYM-type zinc fingers in ZNF261 contain zinc, but that zinc is not required for SUMO-binding. Immunofluorescence microscopy studies using truncated fragments of ZNF198 revealed that MYM-type zinc fingers of ZNF198 are necessary for localization to PML-nuclear bodies (PML-NBs. In summary, our studies have identified and characterized the SUMO-binding activity of the MYM-type zinc fingers in ZNF261 and ZNF198.

  13. Gold-198 and rose bengal marked with iodine-131 in the diagnostic of hepatic vesicular affections; L'or{sup 198} et le rose bengale marque a l'iode{sup 131} dans le diagnostic des affections hepatovesiculaires

    Energy Technology Data Exchange (ETDEWEB)

    Manambelona Razafimalaza, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1961-06-15

    Colloidal gold-198 makes it possible to obtain clear images of hepatic parenchyma; the examination can be repeated from different angles thus demonstrating the presence of pathologically inert regions, whether they be hydatic cysts, abscesses or neoplasia. The study of the disappearance curve for the colloid, together with a measurement of the blood volume, makes it possible also to calculate the hepatic flow. Using Rose Bengal marked with iodine-131, it is possible to obtain images of the liver and of the bile ducts, and to follow the elimination of the dye in the intestines. The simultaneous recording of the disappearance curves for the blood and of the appearance of the dye in the intestines constitutes an useful working test which is particularly sensible for evaluating the permeability of the bile ducts and, to a certain degree, the site of an obstruction. (author) [French] L'or colloidal-198 permet d'obtenir avec nettete des images du parenchyme hepatique; l'examen peut etre repete sous plusieurs incidences mettant ainsi en evidence les zones muettes pathologiques, qu'il s'agisse de kystes hydatiques, d'abces ou de neoplasies. L'etude de la courbe d'epuration du colloide completee par une mesure du volume sanguin offre en outre la possibilite de calculer le debit hepatique. A l'aide du rose bengale marque a l'iode-131, il est possible d'obtenir des images du foie et de la vesicule biliaire, et de suivre l'elimination intestinale du colorant. L'enregistrement simultane des courbes d'epuration sanguine et d'apparition intestinale constitue une epreuve fonctionnelle particulierement sensible pour apprecier la permeabilite des voies biliaires et dans une certaine mesure le site d'une obstruction. (auteur)

  14. Molecular risk assessment of BIG 1-98 participants by expression profiling using RNA from archival tissue

    International Nuclear Information System (INIS)

    Antonov, Janine; Altermatt, Hans Jörg; Aebi, Stefan; Jaggi, Rolf; Popovici, Vlad; Delorenzi, Mauro; Wirapati, Pratyaksha; Baltzer, Anna; Oberli, Andrea; Thürlimann, Beat; Giobbie-Hurder, Anita; Viale, Giuseppe

    2010-01-01

    The purpose of the work reported here is to test reliable molecular profiles using routinely processed formalin-fixed paraffin-embedded (FFPE) tissues from participants of the clinical trial BIG 1-98 with a median follow-up of 60 months. RNA from fresh frozen (FF) and FFPE tumor samples of 82 patients were used for quality control, and independent FFPE tissues of 342 postmenopausal participants of BIG 1-98 with ER-positive cancer were analyzed by measuring prospectively selected genes and computing scores representing the functions of the estrogen receptor (eight genes, ER-8), the progesterone receptor (five genes, PGR-5), Her2 (two genes, HER2-2), and proliferation (ten genes, PRO-10) by quantitative reverse transcription PCR (qRT-PCR) on TaqMan Low Density Arrays. Molecular scores were computed for each category and ER-8, PGR-5, HER2-2, and PRO-10 scores were combined into a RISK-25 score. Pearson correlation coefficients between FF- and FFPE-derived scores were at least 0.94 and high concordance was observed between molecular scores and immunohistochemical data. The HER2-2, PGR-5, PRO-10 and RISK-25 scores were significant predictors of disease free-survival (DFS) in univariate Cox proportional hazard regression. PRO-10 and RISK-25 scores predicted DFS in patients with histological grade II breast cancer and in lymph node positive disease. The PRO-10 and PGR-5 scores were independent predictors of DFS in multivariate Cox regression models incorporating clinical risk indicators; PRO-10 outperformed Ki-67 labeling index in multivariate Cox proportional hazard analyses. Scores representing the endocrine responsiveness and proliferation status of breast cancers were developed from gene expression analyses based on RNA derived from FFPE tissues. The validation of the molecular scores with tumor samples of participants of the BIG 1-98 trial demonstrates that such scores can serve as independent prognostic factors to estimate disease free survival (DFS) in

  15. Fission excitation function for 19F + 194,196,198Pt at near and above barrier energies

    Directory of Open Access Journals (Sweden)

    Singh Varinderjit

    2015-01-01

    Full Text Available Fission excitation functions for 19F + 194,196,198Pt reactions populating 213,215,217Fr compound nuclei are reported. Out of these three compound nuclei, 213Fr is a shell closed (N=126 compound nucleus and the other two are away from the shell closure. From a comparison of the experimental fission cross-sections with the statistical model predictions, it is observed that the fission cross-sections are underestimated by the statistical model predictions using shell corrected finite range rotating liquid drop model (FRLDM fission barriers. Further the FRLDM fission barriers are reduced to fit the fission cross-sections over the entire measured energy range.

  16. Studies on hemodynamics in liver diseases by the use of colloidal gold198 uptakes by liver and spleen

    International Nuclear Information System (INIS)

    Matsunaga, Atsushi

    1983-01-01

    In this study, hepatic blood flow was observed using colloidal gold 198 uptakes by the liver and spleen in the pathogenic conditions in which the uptake was increased in the area of extra hepatic reticuloendothelial systems (especially in splenic RES). The change in the uptake ability of the liver and the contribution to it of intra and extra hepatic shunts were examined. In addition, study was made on the mechanism of how splenic visualization occurred in the colloidal gold 198 scintigram in liver diseases. Out of 84 subjects, 35, 11, 24, and 8 had hepatic cirrhosis and precirrhosis and chronic and acute hepatitis, respectively, and 6 were normal. The results obtained in this study were as follows: (1) The mean value of splenic clearance (splenic blood flow component) in hepatic cirrhosis was 88+-67.5 ml/min. This accounts for approximately 14.6+-11.9 % of the total RES clearance (Classic Effective Hepatic Blood Flow). (2) In hepatic cirrhosis, Classic Hepatic Blood Flow which had been measured up to date was considered to be overestimation by about 19.9+-20.4 % over the mean value of hepatic clearance (hepatic blood flow component) obtained in this study, (3) The hepatic clearance was better indicator of liver disease than the total RES clearance, (4) The ratio between hepatic clearance and cardiac output was considered to be a useful index in assessing the amount of intra and extra hepatic shunts, which had an inverse relationship to the ability of colloid uptake by the liver. (5) Splenic visualization in hepatic cirrhosis was shown to have resulted from the increase in splenic extraction of the colloid, followed by the increase in total splenic blood flow. (author)

  17. Clinical value of miR-198-5p in lung squamous cell carcinoma assessed using microarray and RT-qPCR.

    Science.gov (United States)

    Liang, Yue-Ya; Huang, Jia-Cheng; Tang, Rui-Xue; Chen, Wen-Jie; Chen, Peng; Cen, Wei-Luan; Shi, Ke; Gao, Li; Gao, Xiang; Liu, An-Gui; Peng, Xiao-Tong; Chen, Gang; Huang, Su-Ning; Fang, Ye-Ying; Gu, Yong-Yao

    2018-02-02

    To examine the clinical value of miR-198-5p in lung squamous cell carcinoma (LUSC). Gene Expression Omnibus (GEO) microarray datasets were used to explore the miR-198-5p expression and its diagnostic value in LUSC. Real-time reverse transcription quantitative polymerase chain reaction was used to evaluate the expression of miR-198-5p in 23 formalin-fixed, paraffin-embedded (FFPE) LUSC tissues and corresponding non-cancerous tissues. The correlation between miR-198-5p expression and clinic pathological features was assessed. Meanwhile, putative target messenger RNAs of miR-198-5p were identified based on the analysis of differentially expressed genes in the Cancer Genome Atlas (TCGA) and 12 miRNA prediction tools. Subsequently, the putative target genes were sent to Gene Ontology and Kyoto Encyclopedia of Genes and Genomes pathway analyses. MiR-198-5p was low expressed in LUSC tissues. The combined standard mean difference (SMD) values of miR-198-5p expression based on GEO datasets were - 0.30 (95% confidence interval (CI) - 0.54, - 0.06) and - 0.39 (95% CI - 0.83, 0.05) using fixed effect model and random effect model, respectively. The sensitivity and specificity were not sufficiently high, as the area under the curve (AUC) was 0.7749 (Q* = 0.7143) based on summarized receiver operating characteristic (SROC) curves constructed using GEO datasets. Based on the in-house RT-qPCR, miR-198-5p expression was 4.3826 ± 1.7660 in LUSC tissues and 4.4522 ± 1.8263 in adjacent normal tissues (P = 0.885). The expression of miR-198-5p was significantly higher in patients with early TNM stages (I-II) than that in cases with advanced TNM stages (III-IV) (5.4400 ± 1.5277 vs 3.5690 ± 1.5228, P = 0.008). Continuous variable-based meta-analysis of GEO and PCR data displayed the SMD values of - 0.26 (95% CI - 0.48, - 0.04) and - 0.34 (95% CI - 0.71, 0.04) based on fixed and random effect models, respectively. As for the diagnostic

  18. SCM-198 inhibits microglial overactivation and attenuates Aβ(1-40)-induced cognitive impairments in rats via JNK and NF-кB pathways.

    Science.gov (United States)

    Hong, Zhen-Yi; Shi, Xue-Ru; Zhu, Kai; Wu, Ting-Ting; Zhu, Yi-Zhun

    2014-08-19

    Neuroinflammation mediated by overactivated microglia plays a key role in many neurodegenerative diseases, including Alzheimer's disease (AD). In this study, we investigated for the first time the anti-neuroinflammatory effects and possible mechanisms of SCM-198 (an alkaloid extracted from Herbaleonuri), which was previously found highly cardioprotective, both in vitro and in vivo. For in vitro experiments, lipopolysaccharide (LPS) or β-amyloid(1-40) (Aβ(1-40)) was applied to induce microglial overactivation. Proinflammatory mediators were measured and activations of NF-κB and mitogen-activated protein kinases' (MAPKs) pathways were investigated. Further protective effect of SCM-198 was evaluated in microglia-neuron co-culture assay and Sprague-Dawley (SD) rats intrahippocampally-injected with Aβ(1-40). SCM-198 reduced expressions of nitric oxide (NO), TNF-α, IL-1β and IL-6 possibly via, at least partially, inhibiting c-Jun N-terminal kinase (JNK) and NF-κB signaling pathways in microglia. Co-culture assay showed that activated microglia pretreated with SCM-198 led to less neuron loss and decreased phosphorylation of tau and extracellular signal-regulated kinase (ERK) in neurons. Besides, SCM-198 also directly protected against Aβ(1-40)-induced neuronal death and lactate dehydrogenase (LDH) release in primary cortical neurons. For in vivo studies, SCM-198 significantly enhanced cognitive performances of rats 12 days after intrahippocampal injections of aged Aβ(1-40) peptides in the Morris water maze (MWM), accompanied by less hippocampal microglial activation, decreased synaptophysin loss and phosphorylation of ERK and tau. Co-administration of donepezil and SCM-198 resulted in a slight cognitive improvement in SD rats 50 days after intrahippocampal injections of aged Aβ(1-40) peptides as compared to only donepezil or SCM-198 treated group. Our findings are the first to report that SCM-198 has considerable anti-neuroinflammatory effects on inhibiting

  19. SCM-198 Ameliorates Cognitive Deficits, Promotes Neuronal Survival and Enhances CREB/BDNF/TrkB Signaling without Affecting Aβ Burden in AβPP/PS1 Mice

    Directory of Open Access Journals (Sweden)

    Zhen-Yi Hong

    2015-08-01

    Full Text Available SCM-198 is an alkaloid found only in Herba leonuri and it has been reported to possess considerable neuroprotective effects in animal models of ischemic stroke, Parkinson’s disease and Alzheimer’s disease (AD. In this study, we demonstrated for the first time that 3-month oral SCM-198 treatment could significantly improve both recognition and spatial memory, inhibit microgliosis and promote neuronal survival in amyloid-β protein precursor and presenilin-1(AβPP/PS1 double-transgenic mice without affecting amyloid-β (Aβ burden. In addition, decreases in cAMP-response element-binding protein (CREB phosphorylation, brain-derived neurotrophic factor (BDNF and tropomyosin-related kinase B (TrkB phosphorylation were attenuated by SCM-198 both in vivo and in primary cortical neurons, which could be blocked by protein kinase A (PKA inhibitors, suggesting the involvement of upstream PKA in enhancing the BDNF/TrkB/CREB signaling by SCM-198. Our results indicate that SCM-198, a drug that could promote neuronal survival and enhance BDNF/TrkB/CREB signaling, has beneficial effects on behavioral and biochemical alterations without affecting Aβ burden in AβPP/PS1 mice and might become a potential drug candidate for AD treatment in the future.

  20. Dental size reduction in Indonesian Homo erectus: Implications for the PU-198 premolar and the appearance of Homo sapiens on Java.

    Science.gov (United States)

    Polanski, Joshua M; Marsh, Hannah E; Maddux, Scott D

    2016-01-01

    The recent recovery of a hominin maxillary third premolar, PU-198, within the faunal collections from Punung Cave (East Java) has led to assertions that Homo sapiens appeared on Java between 143,000 and 115,000 years ago. The taxonomic assignment of PU-198 to H. sapiens was based predominantly on the small size of the specimen, following an analysis which found little to no overlap in premolar size between Homo erectus and terminal Pleistocene/Holocene H. sapiens. Here, we re-evaluate the use of size in the taxonomic assignment of PU-198 in light of 1) new buccolingual and mesiodistal measurements taken on the fossil, 2) comparisons to a larger sample of H. erectus and H. sapiens maxillary third premolars, and 3) evidence of a diachronic trend in post-canine dental size reduction among Javan H. erectus. Our results demonstrate PU-198 to be slightly larger than previously suggested, reveal substantial overlap in premolar size between H. erectus and H. sapiens, and indicate a statistically significant reduction in premolar size between early and late Javan H. erectus. Our findings cast doubt on the assignment of PU-198 to H. sapiens, and accordingly, question the appearance of H. sapiens on Java between 143,000 and 115,000 years ago. Copyright © 2015 Elsevier Ltd. All rights reserved.

  1. SCM-198 Ameliorates Cognitive Deficits, Promotes Neuronal Survival and Enhances CREB/BDNF/TrkB Signaling without Affecting Aβ Burden in AβPP/PS1 Mice.

    Science.gov (United States)

    Hong, Zhen-Yi; Yu, Shuang-Shuang; Wang, Zhi-Jun; Zhu, Yi-Zhun

    2015-08-07

    SCM-198 is an alkaloid found only in Herba leonuri and it has been reported to possess considerable neuroprotective effects in animal models of ischemic stroke, Parkinson's disease and Alzheimer's disease (AD). In this study, we demonstrated for the first time that 3-month oral SCM-198 treatment could significantly improve both recognition and spatial memory, inhibit microgliosis and promote neuronal survival in amyloid-β protein precursor and presenilin-1(AβPP/PS1) double-transgenic mice without affecting amyloid-β (Aβ) burden. In addition, decreases in cAMP-response element-binding protein (CREB) phosphorylation, brain-derived neurotrophic factor (BDNF) and tropomyosin-related kinase B (TrkB) phosphorylation were attenuated by SCM-198 both in vivo and in primary cortical neurons, which could be blocked by protein kinase A (PKA) inhibitors, suggesting the involvement of upstream PKA in enhancing the BDNF/TrkB/CREB signaling by SCM-198. Our results indicate that SCM-198, a drug that could promote neuronal survival and enhance BDNF/TrkB/CREB signaling, has beneficial effects on behavioral and biochemical alterations without affecting Aβ burden in AβPP/PS1 mice and might become a potential drug candidate for AD treatment in the future.

  2. Comparison of liver scintigraphy with /sup 99m/Tc-phytate and /sup 198/Au-colloid in diffuse hepatic disorders

    Energy Technology Data Exchange (ETDEWEB)

    Kamoi, I; Watanabe, K; Kawahira, K; Nakayama, C; Higashi, Y [Kyushu Univ., Fukuoka (Japan). Faculty of Medicine

    1975-07-01

    sup(99m)Tc-phytate was evaluated as a liver scintigraphic radiopharmaceutical, and the results were compared with those of /sup 198/Au-colloid. Both radionuclides were used on the same day in 55 cases of diffuse hepatic disorders. In 52 of the 55 cases, excellent liver images were obtained with sup(99m)Tc-phytate. Compared with /sup 198/Au-colloid, sup(99m)Tc-phytate was more highly concentrated in the spleen and bone marrow and with higher background radioactivity, although their distributions generally coincided. The known diagnostic criteria for liver scintigraphy with /sup 198/Au-colloid in diffuse hepatic disorders were proven applicable to sup(99m)Tc-phytate.

  3. Novel anti-diabetic effect of SCM-198 via inhibiting the hepatic NF-κB pathway in db/db mice.

    Science.gov (United States)

    Huang, Hui; Xin, Hong; Liu, Xinhua; Xu, Yajun; Wen, Danyi; Zhang, Yahua; Zhu, Yi Zhun

    2012-04-01

    There are reports of early evidence that suggest the involvement of chronic low-grade inflammation in the pathogenesis of Type 2 diabetes. Thus, substances that have effects in reducing inflammation could be potential drugs for Type 2 diabetes. Leonurine (4-guanidino-n-butyl syringate; SCM-198) is an alkaloid in HL (Herba leonuri), which was reported to possess anti-inflammatory properties. We hypothesize that SCM-198 may have beneficial effects on Type 2 diabetes. In the present study, we attempted to test this hypothesis by evaluating the anti-diabetic effect of SCM-198 and the possible underlying mechanisms of its effects in db/db mice. SCM-198 (50, 100 and 200 mg/kg of body weight), pioglitazone (50 mg/kg of body weight, as a positive control) or 1% CMC-Na (sodium carboxymethylcellulose) were administered to the db/db or db/m mice once daily for 3 weeks. After 3 weeks, SCM-198 (200 mg/kg of body weight) treatment significantly reduced the fasting blood glucose level and increased the plasma insulin concentration in the db/db mice, meanwhile it significantly lowered the plasma TAG (triacylglycerol) concentration and increased the HDL (high-density lipoprotein)-cholesterol concentration. Moreover, the dysregulated transcription of the hepatic glucose metabolic enzymes, including GK (glucokinase), G6Pase (glucose-6-phosphatase) and PEPCK (phosphoenolpyruvate carboxykinase), was recovered by an Akt-dependent pathway. The pro-inflammatory mediators {such as TNFα (tumour necrosis factor α), IL (interleukin)-6, IL-1β, degradation of IκB [inhibitor of NF-κB (nuclear factor-κB)] α and thereafter activation of NF-κB} were reversed by SCM-198 treatment in the db/db mice. The present study provides first evidence that SCM-198 exhibits anti-inflammatory activity and has an ameliorating effect on diabetic symptoms via inhibiting of NF-κB/IKK (IκB kinase) pathway. Consequently, we suggest that SCM-198 may be a prospective agent for prevention and

  4. Intrathecal application of /sup 198/Au colloid in acute leukemia and non-Hodgkin's lymphoma in chilhood. 2. Metaphylaxis of meningosis neoplastica

    Energy Technology Data Exchange (ETDEWEB)

    Metz, O; Unverricht, A; Stoll, W [Friedrich-Schiller-Universitaet, Jena (German Democratic Republic)

    1979-08-01

    7 children suffering from acute lymphatic leukemia (ALL) and non-Hodgkin's lymphoma, resp., were injected intrathecally with /sup 198/Au colloid for metaphylaxis. The children had been cured of 8 relapses of miningosis and received irregularly intrathecal injections of methotrexate for cerebral maintenance therapy. The median cerebral period of remission was 52 weeks. 1 child suffering from ALL had been free from meningosis relapses for 128 weeks. Continuous cytostatic therapy is necessary for methaphylaxis. However, despite of the good results presented, /sup 198/Au colloid can not be recommended for long-term therapy because radiation injuries are to be expected.

  5. ORIGINAL ARTICLE 198

    African Journals Online (AJOL)

    boaz

    Résumé. La qualité de l'eau du fleuve Sokoto a été évalué pour déterminer sa charge bactérienne et types. Les techniques .... Discrete isolates from heterotrophic plate agar, kept on ..... (2009) Rainfall simulation in greenhouse microcosms to ...

  6. Effect of N/Z in pre-scission neutron multiplicity for 16,18O+198Pt systems

    International Nuclear Information System (INIS)

    Sandal, R.; Behera, B.R.; Singh, V.; Kaur, M.; Kumar, A.; Singh, G.; Singh, K.P.; Sugathan, P.; Jhingan, A.; Golda, K.S.; Chatterjee, M.B.; Bhowmik, R.K.; Kalkal, S.; Siwal, D.; Goyel, S.; Mandal, S.; Prasad, E.; Sadhukhan, J.; Pal, S.; Mahta, K.; Saxena, A.

    2014-01-01

    This paper reports the summary of the experimental results of pre-scission neutron multiplicities from four compound nuclei, namely 210,212,214,216 Rn, and statistical model analysis of the corresponding data. The compound nuclei 210,212,214,216 Rn having N/Z values as 1.441, 1.465, 1.488, 1.511 respectively are populated through the 16,18 O+ 194,198 Pt reactions at excitation energies of 50, 61, 71.7 and 79 MeV. The measured neutron multiplicities are further analyzed with the statistical model of nuclear decay where fission hindrance due to nuclear dissipation is considered. The N/Z dependence of the dissipation strength at lowest excitation energy of the compound nuclei suggests shell closure effects. However, such effects are not observed at higher excitations where the variation of the dissipation strength with N/Z does not show any specific trend. The variation of N/Z in fission time scale is also shown. (authors)

  7. Field displacement during external radiotherapy in prostatic adenocarcinoma treated with radioactive 198Au implants and external irradiation

    International Nuclear Information System (INIS)

    Lennernaes, B.; Letocha, H.; Rikner, G.; Magnusson, A.; Nilsson, S.

    1995-01-01

    The purpose of this work was to study displacement error and internal movements of the prostate during external beam radiotherapy. Verification films in the frontal (n=194) and lateral (n=64) portals were investigated in 14 patients treated with radioactive 198 Au implants. Displacement errors of two implants were investigated. In seven patients, filling of the rectum and the bladder with contrast medium or isotonic saline was performed during CT investigation for planning purposes to detect movements of the prostate. Most (95%) of the displacement errors were less than 10 mm in the frontal portal and less than 15 mm in the lateral portals. No correlation to the patient's weight was found. The displacement errors were randomly distributed. The spatial relations between the implants were not altered during the treatments. Small movements of the prostate were observed. To conclude, the positioning system employed at present (laser) can be sufficient for the margins used (2 cm). In lateral portals, however, the system did not have the ability to detect a possible systematic displacement error from simulator to accelerator. The intention is to decrease the margins to 1 cm, which will necessitate a better positioning system. (orig.)

  8. Prevalência de manifestações oculares em 198 pacientes com artrite reumatóide: um estudo retrospectivo Prevalence of ocular manifestation in 198 patients with rheumatoid arthritis: a restrospective study

    Directory of Open Access Journals (Sweden)

    Raphael Guimarães Bettero

    2008-06-01

    Full Text Available OBJETIVO: Estimar a prevalência de manifestações oculares na população local de artrite reumatóide (AR. Estimar se a presença de auto-anticorpos como fator reumatóide (FR e fator antinuclear (FAN influi no aparecimento destas manifestações e se existe associação entre o aparecimento de manifestações oculares e índice funcional do paciente, idade ao diagnóstico e tempo de doença. MÉTODOS: Foram estudados retrospectivamente 198 prontuários de pacientes com AR, acompanhados durante o período de 2003 a 2006. Avaliou-se a prevalência das manifestações oftalmológicas, perfil de auto-anticorpos, dados demográficos e índice funcional de Steinbrock destes pacientes. RESULTADOS: Síndrome de Sjögren secundária apareceu em 12,1% dos pacientes sendo mais comum em mulheres (p=0,049 e em pacientes com maior dano articular (p=0,016. Ceratite ulcerativa e esclerite incidiram em torno de 2% dos pacientes. Fator reumatóide (FR e fator antinuclear (FAN assim como tempo de doença e idade do paciente ao diagnóstico não influíram no aparecimento das manifestações estudadas. CONCLUSÃO: A síndrome de Sjögren secundária é a manifestação ocular mais prevalente em pacientes com AR, sendo mais comum em mulheres e em pacientes com mais disfunção articular.PURPOSE: To study the prevalence of eye manifestations in the local rheumatoid arthritis (RA population, as well as to know if the presence of rheumatoid factor (RF and antinuclear antibodies (ANA affect this profile. To study if there is association between eye manifestations and patient's articular functional index, age at diagnosis and illness duration. METHODS: We reviewed 198 charts of rheumatoid arthritis patients followed-up from 2003 to 2006. They were studied for: prevalence of ophthalmologic manifestations, autoantibody profile, demographic data and Steinbrock's functional index. RESULTS: Secondary Sjögren's syndrome was seen in 12.1% of the patients being more common

  9. Obesity and risk of recurrence or death after adjuvant endocrine therapy with letrozole or tamoxifen in the breast international group 1-98 trial

    DEFF Research Database (Denmark)

    Ewertz, Marianne; Gray, Kathryn P; Regan, Meredith M

    2012-01-01

    To examine the association of baseline body mass index (BMI) with the risk of recurrence or death in postmenopausal women with early-stage breast cancer receiving adjuvant tamoxifen or letrozole in the Breast International Group (BIG) 1-98 trial at 8.7 years of median follow-up....

  10. Evaluation of the liver scintigraphy with /sup 99m/Tc-Sn-colloid. II. C Clinical studies by comparison with /sup 198/Au-colloid

    Energy Technology Data Exchange (ETDEWEB)

    Kimura, K; Nishimura, T; Takeda, H; Furukawa, T [Osaka Univ. (Japan). Faculty of Medicine; Kajiya, Fumihiko

    1975-08-01

    Clinical significance of the liver scintigraphy with sup(99m)Tc-Sn-colloid was evaluated in comparison with those with /sup 198/Au-colloid. The liver scintigrams with sup(99m)Tc-Sn-colloid and /sup 198/Au-colloid were done in 36 cases of various hepatic diseases and RI accumulation curves in the liver and the spleen, and the blood disapearance curves were also obtained. The conclusions were as follows. The liver scintigrams with sup(99m)Tc-Sn-colloid proved to be more sensitive in the detection of tumors, especially, in the lower margin, left lobe and superficial layers of the liver than those with /sup 198/Au-colloid. In all cases, including normal and cirrhotic subjects, visualizations of the spleen were seen on the scintigrams with sup(99m)Tc-Sn-colloid. In diffuse hepatic diseases, comparing both radiopharmaceuticals, the splenic accumulations were studied qualitatively and quantitatively. As a result, the ratio (spleen/liver) was thought to be useful for the differentiation of diffuse hepatic diseases concerned with splenic function and/or size. It was also shown that sup(99m)Tc-Sn-colloid was useful as a spleen scanning agent. The Tl/2 in the liver accumulation curves with sup(99m)Tc-Sn-colloid were not as clearly differentiated in the various hepatic diseases as those with /sup 198/Au-colloid where those indexes were useful in the evaluation of liver functions.

  11. Associations between GPX1 Pro198Leu polymorphism, erythrocyte GPX activity, alcohol consumption and breast cancer risk in a prospective cohort study

    DEFF Research Database (Denmark)

    Ravn-Haren, Gitte; Olsen, A.; Tjonneland, A.

    2006-01-01

    Breast cancer may be related to oxidative stress. Breast cancer patients have been reported to have lower antioxidant enzyme activity than healthy controls and the polymorphism GPX1 Pro198Leu has been associated with risk of lung and breast cancer. The purpose of the present nested case...

  12. Determination of the solid consumption in the transport of sands in sea beds with gold 198; Determinacion del gasto solido en el transporte de arenas en lechos marinos con oro 198

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez A, G

    1983-07-01

    The study of the movement of sediments in sea beds, is necessary when one plans to build a port. Among the techniques used for this studies, it is the radiotracer balance that gives an useful estimation of the quantity of sediment that it moves per day and by meter (perpendicular to the displacement). The main objectives of this work are: to) to present the characteristics of the obtaining of the used radiotracer, describing details those used safety measures, b) to describe the handling of the radiotracer and it radiological safety, during the transport and injection in the sea bottom, c) description of the detection way and the used equipment, d) to describe the information processing obtained in the field and finally, e) the estimate of the solid consumption and the determination of the direction and speed of displacement of those sediments in the sea bottom, in front of the Tabasco coast, to be used jointly with the information obtained by means of other techniques so that one can make a good planning of the operations of dredging during the construction and later on the maintenance of the Dos Bocas marine terminal. The first step is to obtain the radiotracer that in this case was sand of uniform grain metric, marked superficially with Gold-198. The second step is to transport the sand to the place of interest, to place it in the injection equipment and to deposit it in the sea bottom. The third step is to detect the radiotracer in the sea bed, from a craft that drags a sled, which takes mounted a scintillation detector of sodium iodide activated with thallium NaI(Tl) (probe). The fourth step is to process the field information and to obtain the corresponding results. (Author)

  13. Astatine-211 labeling. A study towards automatic production of astatinated antibodies

    International Nuclear Information System (INIS)

    Emma Aneheim; Per Albertsson; Sture Lindegren; Holger Jensen

    2015-01-01

    Targeted alpha therapy is especially interesting for therapy of microscopic cancer tumors due to short path length and high linear energy transfer of the alpha particles. One of the most promising nuclides for targeted alpha therapy is 211 At. To facilitate larger clinical studies using 211 At, the current manual synthesis of radiolabeled antibodies would benefit from being transferred into an automated method. In this work, successful modifications of the manual synthesis have been performed in order to adapt it to automation. The automatic synthesis has also been tested using the modified synthesis method. (author)

  14. T1 and T2 squamous cell carcinomas of the floor of the mouth: results of brachytherapy mainly using 198Au grains

    International Nuclear Information System (INIS)

    Matsumoto, Satoru; Takeda, Masamune; Shibuya, Hitoshi; Suzuki, Soji

    1996-01-01

    Purpose: To investigate the effectiveness of brachytherapy provided by this institution over a 25-year period, and to specifically verify the efficacy of 198 Au grain therapy, this study evaluated the outcomes in patients given brachytherapy for T1 and T2 squamous cell carcinomas (SCCs) of the floor of the mouth. Methods and Materials: A retrospective analysis of data from 90 patients with T1 and T2 SCCs of the floor of the mouth who underwent brachytherapy between 1965 and 1989. Therapy mainly consisted of 198 Au grain implants with or without external irradiation. As for the brachytherapeutic source, 15 patients were treated with radon seeds, 60 with 198 Au grains, 10 with radium needles, 3 with cobalt needles, and 2 with iridium hairpins. Based on the 1987 International Union Against Cancer (UICC) classification, the SCC stagings and number of cases per staging follow: Stage I (T1N0), 21 cases; Stage II (T2N0), 55 cases; and Stage III-IV (T1-2N1-2), 14 cases. The minimum follow-up time was 3 years. Results: The local control rates of these SCCs, based on tumor size, were 89% for T1 lesions, 76% for T2a (≤ 3 cm) lesions, and 56% for T2b (> 3 cm) lesions, and 82% for T1-2 lesions without a gingival involvement, in contrast to 55% for lesions with a gingival involvement (p 198 Au grain brachytherapy, local control was achieved in 93% of the T1 lesions, 79% of the T2a lesions, and in 56% of the T2b lesions. Further, the incidence of severe complications requiring surgery was low (5%). Conclusion: For T1N0 and T2aN0 SCCs of the floor of the mouth, excluding lesions with a gingival involvement, 198 Au grain brachytherapy alone or in combination with external radiotherapy was found to be efficacious

  15. Dynamic Study on the Hepatobiliary Diseases with Combination of 131I-Rose bengal and 198Au-Colloid Scintiphotography

    International Nuclear Information System (INIS)

    Rhee, Yong Kok

    1971-01-01

    The radioactive 131 I-Rose bengal serial scintiphotography was performed in 62 patients with the hepatobiliary diseases and in 20 normal subjects. This approach permitted visualization of the hepatic uptake of 131 I-Rose bengal from the circulation and its excretion into the biliary trees and the intestines. In some of these patients, gallbladder function was examined, using eggs as a gallbladder constrictor. The time of maximum hepatic uptake was well correlated to the conventional biochemical liver function tests. In addition to 131 I-Rose bengal scintiphotography, 198 Au-colloid scintiphotography was also performed to make comparison of these two tests. The results obtained were as follows: 1) In normal subjects, the maximum hepatic uptake of 131 I-Rose bengal occurred at 23±2.9 minutes, the initial hepatic excretion at 34±5.1 minutes, the visualization of the gallbladder at 29±5.7 minutes and the intestinal visualization at 54±25.8 minutes. The radioactivity in the gallbladder decreased to 10.7±5.0% one hour after the ingestion of eggs. 2) In the patients with cirrhosis of the liver, there was a delayed and decreased hepatic uptake. The maximum hepatic uptake occurred at 43±12.9 minutes. The differences in the results of uptake between the cirrhotic and the normal group were statistically significant. The initial hepatic excretion occurred at 60±18.5 minutes and had tendency of delaying compared with the normal controls. The gallbladder was visualized in 13 of 16 cases (81%) and its visualization occurred at 49±14.6 minutes with a tendency to be delayed compared with the normal controls. The intestinal visualization occurred at 63±15.8 minutes and its delaying tendency was somewhat more prominent. 3) In patients with hepatitis, the maximum hepatic uptake occurred at 59±21.4 minutes and was significantly delayed. The initial hepatic excretion occurred at 82±34.3 minutes and the results revealed a delaying tendency. The gallbladder was visualized in 15

  16. Treatment Adherence and Its Impact on Disease-Free Survival in the Breast International Group 1-98 Trial of Tamoxifen and Letrozole, Alone and in Sequence

    DEFF Research Database (Denmark)

    Chirgwin, Jacquie H; Giobbie-Hurder, Anita; Coates, Alan S

    2016-01-01

    PURPOSE: To investigate adherence to endocrine treatment and its relationship with disease-free survival (DFS) in the Breast International Group (BIG) 1-98 clinical trial. METHODS: The BIG 1-98 trial is a double-blind trial that randomly assigned 6,193 postmenopausal women with hormone receptor......-positive early breast cancer in the four-arm option to 5 years of tamoxifen (Tam), letrozole (Let), or the agents in sequence (Let-Tam, Tam-Let). This analysis included 6,144 women who received at least one dose of study treatment. Conditional landmark analyses and marginal structural Cox proportional hazards......). Sequential treatments were associated with higher rates of nonpersistence (Tam-Let, 20.8%; Let-Tam, 20.3%; Tam 16.9%; Let 17.6%). Adverse events were the reason for most trial treatment early discontinuations (82.7%). Apart from sequential treatment assignment, reduced adherence was associated with older age...

  17. Bone fractures among postmenopausal patients with endocrine-responsive early breast cancer treated with 5 years of letrozole or tamoxifen in the BIG 1-98 trial

    DEFF Research Database (Denmark)

    Rabaglio, M; Sun, Z; Price, K N

    2009-01-01

    of letrozole or tamoxifen in the BIG 1-98 trial who received at least some study medication (median follow-up 60.3 months). Bone fracture information (grade, cause, site) was collected every 6 months during trial treatment. RESULTS: The incidence of bone fractures was higher among patients treated......BACKGROUND: To compare the incidence and timing of bone fractures in postmenopausal women treated with 5 years of adjuvant tamoxifen or letrozole for endocrine-responsive early breast cancer in the Breast International Group (BIG) 1-98 trial. METHODS: We evaluated 4895 patients allocated to 5 years...... with letrozole [228 of 2448 women (9.3%)] versus tamoxifen [160 of 2447 women (6.5%)]. The wrist was the most common site of fracture in both treatment groups. Statistically significant risk factors for bone fractures during treatment included age, smoking history, osteoporosis at baseline, previous bone...

  18. Total internal conversion coefficient of the 260. 9 keV (7/sup +/->3/sup -/) transition in sup(198m)Tl

    Energy Technology Data Exchange (ETDEWEB)

    Venkateswara Rao, N.; Suryanarayana, C.; Narayana, D.G.S.; Bhuloka Reddy, S.; Satynarayana, G.; Sastry, D.L.; Chintalapudi, S.N.

    1986-02-21

    The 1.87 hours 543.7 keV (7/sup +/) isomeric state in /sup 198/Tl is produced via /sup 197/Au(..cap alpha.., 3n)sup(198m)Tl (Esub(..cap alpha..) = 35 MeV) reaction. The total conversion coefficient of 260.9 keV (7/sup +/ -> 3/sup -/) is determined for the first time by the intensity balance method. The value of ..cap alpha..sub(T)(260.9 keV) is found to be 40.1 +- 8.6 which is in good agreement with the theoretical value of Hager and Seltzer for pure M4 transition. The gamma transition probability of the 260.9 keV (M4) is calculated using the present value of ..cap alpha..sub(T) and compared with the single-particle estimate.

  19. How does the development of the financial industry advance renewable energy? A panel regression study of 198 countries over three decades

    OpenAIRE

    Scholtens, Bert; Veldhuis, Rineke

    2015-01-01

    Abstract We investigate how the development of the financial industry connects with renewable energy. We analyze 198 countries over three decades in various model settings (fixed effects, random effects, dynamic panel). We use a wide range of proxies for the development of the financial industry and establish that in general this development has a positive impact on renewable energy capacity. Especially, the relative size of the commercial banking industry as well as of private credit and the...

  20. Variations of nuclear charge radii in mercury isotopes with A = 198, 199, 200, 201, 202, and 204 from x-ray isotope shifts

    International Nuclear Information System (INIS)

    Lee, P.L.; Boehm, F.; Hahn, A.A.

    1978-01-01

    The isotope shifts of atomic K x rays were measured for pairs of the six mercury isotopes with A = 198, 199, 200, 201, 202, and 204, using a curved crystal spectrometer. The changes of the nuclear charge radii were derived in terms of delta 2 > and deltaR/sub k/ and compared with optical an muonic isotope shift data. From our results, a renormalization of the optical data was obtained

  1. Comparison by quantitative scanning of the distribution in the body of yttrium-90 and gold-198 after intra-articular injection

    International Nuclear Information System (INIS)

    Williams, E.D.; Caughey, D.E.; John, M.B.; Hurley, P.J.

    1975-01-01

    A new radiopharmaceutical, yttrium-90 ferric hydroxide colloid, has been used to treat knee effusion in patients with rheumatoid arthritis. With a view to assessing absorbed radiation dose, a study was initiated to compare its body distribution with that of gold-198, which has also been used for this purpose. The treated knee was in each case scanned immediately after injection using a dual 5-inch detector scanner, and again two, four and seven days later, when the regional lymph nodes and liver were also scanned. Using calibration factors obtained by scanning water phantoms, data from the scans were used to calculate the percentage of the injected radioactivity in each site. Radioactivity in blood and urine was also measured. Ten knees have been treated, each with five mCi yttrium-90, and twelve with 10 mCi gold-198. The treated knee was immobilized, and the patient rested in bed for four days, to minimize loss of radioactivity from the knee. With this procedure, both radionuclides were found to be equally well retained in the knee. However, the lymph node uptake of yttrium was lower than for gold. Yttrium-90 emits only beta radiation, so the gonadal radiation done in patients treated with yttrium-90 is estimated to be much less than in those treated with gold-198. (author)

  2. Experimental Observation of Anisotropic Adler-Bell-Jackiw Anomaly in Type-II Weyl Semimetal WTe1.98 Crystals at the Quasiclassical Regime

    Science.gov (United States)

    Lv, Yang-Yang; Li, Xiao; Zhang, Bin-Bin; Deng, W. Y.; Yao, Shu-Hua; Chen, Y. B.; Zhou, Jian; Zhang, Shan-Tao; Lu, Ming-Hui; Zhang, Lei; Tian, Mingliang; Sheng, L.; Chen, Yan-Feng

    2017-03-01

    The asymmetric electron dispersion in type-II Weyl semimetal theoretically hosts anisotropic transport properties. Here, we observe the significant anisotropic Adler-Bell-Jackiw (ABJ) anomaly in the Fermi-level delicately adjusted WTe1.98 crystals. Quantitatively, CW , a coefficient representing the intensity of the ABJ anomaly along the a and b axis of WTe1.98 are 0.030 and 0.051 T-2 at 2 K, respectively. We found that the temperature-sensitive ABJ anomaly is attributed to a topological phase transition from a type-II Weyl semimetal to a trivial semimetal, which is verified by a first-principles calculation using experimentally determined lattice parameters at different temperatures. Theoretical electrical transport study reveals that the observation of an anisotropic ABJ along both the a and b axes in WTe1.98 is attributed to electrical transport in the quasiclassical regime. Our work may suggest that electron-doped WTe2 is an ideal playground to explore the novel properties in type-II Weyl semimetals.

  3. The Blood Disappearance Rate of 198Au-Colloid and Changes of Hepatic Blood Flow During Position Change in Normal Persons and in Patients with Various Hepatic Diseases

    International Nuclear Information System (INIS)

    Cho, Bo Yeon; Hong, Kee Suk; Koh, Chang Soon; Lee, Mun Ho

    1977-01-01

    To evaluate the diagnostic significance of the blood disappearance rate of 198 Au-colloid and to evaluate the change of hepatic blood flow during position change from supine to erect, we measured the half time of blood disappearance rate of 198 Au-colloid using external counting method in 94 normal persons and in 77 patients with various hepatic diseases. The results obtained were as follows: 1) In normal control, the mean blood disappearance half time of 198 Au-colloid in supine position was 2.7±0.4 minutes. There was no significant difference of hepatic blood flow in age and sex. 2) In acute hepatitis, chronic hepatitis and hepatic cirrhosis, the mean blood disappearance half times in supine position were 3.0±0.45, 3.5±0.74, 7.2±3.6 minutes respectively. The hepatic blood flow of the patients with chronic hepatitis and hepatic cirrhosis were significantly decreased than that of normal control. 3) In the normal control and acute hepatitis, the decreases of the hepatic blood flow during the position change from supine to erect were 27.7% and 22.6% respectively.

  4. STDとしての男子尿道炎・子宮頸管炎の疫学的・治療学的研究 - NY-198(Lomefloxacin)による検討 -

    OpenAIRE

    熊本, 悦明; 広瀬, 崇興; 林, 謙治; 郷路, 勉; 児玉, 直彦; 宮岸, 武弘; 上野, 了; 毛利, 和弘; 阿部, 清孝

    1990-01-01

    Urethritis in males and cervicitis in females, which were sexually transmitted diseases, were treated with NY-198, a new quinolone antibiotic, and its efficacy was studied. Seventeen male patients with gonorrheal urethritis were administered a single 300 mg dose of NY-198. The efficacy rate on the 3rd day after administration was 100%, but it was 85.7% on the 7th day due to recurrence in 1 patient. The results of treatment of non-gonorrheal infections were as follow. In this treatment, NY-198...

  5. Evidence for {open_quotes}magnetic rotation{close_quotes} in nuclei: New results on the M1-bands of {sup 198,199}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Clark, R.M. [Lawrence Berkeley National Lab., CA (United States)

    1996-12-31

    Lifetimes of states in four of the M1-bands in {sup 198,199}Pb have been determined through a Doppler Shift Attenuation Method measurement performed using the Gammasphere array. The deduced B(M1) values, which are a sensitive probe of the underlying mechanism for generating these sequences, show remarkable agreement with Tilted Axis Cranking (TAC) calculations. Evidence is also presented for the possible termination of the bands. The results represent clear evidence for a new concept in nuclear excitations: {open_quote}magnetic rotation{close_quote}.

  6. Gold nanoparticles production using reactor and cyclotron based methods in assessment of {sup 196,198}Au production yields by {sup 197}Au neutron absorption for therapeutic purposes

    Energy Technology Data Exchange (ETDEWEB)

    Khorshidi, Abdollah, E-mail: abkhorshidi@yahoo.com

    2016-11-01

    Medical nano-gold radioisotopes is produced regularly using high-flux nuclear reactors, and an accelerator-driven neutron activator can turn out higher yield of {sup 197}Au(n,γ){sup 196,198}Au reactions. Here, nano-gold production via radiative/neutron capture was investigated using irradiated Tehran Research Reactor flux and also simulated proton beam of Karaj cyclotron in Iran. {sup 197}Au nano-solution, including 20 nm shaped spherical gold and water, was irradiated under Tehran reactor flux at 2.5E + 13 n/cm{sup 2}/s for {sup 196,198}Au activity and production yield estimations. Meanwhile, the yield was examined using 30 MeV proton beam of Karaj cyclotron via simulated new neutron activator containing beryllium target, bismuth moderator around the target, and also PbF{sub 2} reflector enclosed the moderator region. Transmutation in {sup 197}Au nano-solution samples were explored at 15 and 25 cm distances from the target. The neutron flux behavior inside the water and bismuth moderators was investigated for nano-gold particles transmutation. The transport of fast neutrons inside bismuth material as heavy nuclei with a lesser lethargy can be contributed in enhanced nano-gold transmutation with long duration time than the water moderator in reactor-based method. Cyclotron-driven production of βeta-emitting radioisotopes for brachytherapy applications can complete the nano-gold production technology as a safer approach as compared to the reactor-based method. - Graphical abstract: This figure describes gold nanoparticles production via cyclotron based method. The aim of investigating is to estimate activity and saturation yield of {sup 197}Au(n,γ){sup 198}Au and {sup 197}Au(n,2n){sup 196}Au reactions using Karaj cyclotron available in Iran. The feasibility of a cyclotron-driven production of βeta-emitting radioisotopes was investigated for therapeutic applications via a new neutron activator design. - Highlights: • Nano-gold radioisotope production

  7. Comment on “Mathematical modeling of unicellular microalgae and cyanobacteria metabolism for biofuel production” by Baroukh et al. [Curr Opin Biotechnol. 2015, 33:198–205

    Energy Technology Data Exchange (ETDEWEB)

    Song, Hyun-Seob; Ramkrishna, Doraiswami

    2016-04-01

    This letter concerns an article recently published in Current Opinion in Biotechnology by Baroukh et al. entitled "Mathematical modeling of unicellular microalgae and cyanobacteria metabolism for biofuel production" (2015 Mar 26; 33:198-205). The issue we wish to bring to light is the authors’ claim that dynamic metabolic models including Hybrid Cybernetic Model (HCM) (Kim et al., 2008; Song et al., 2009) and Lumped HCM (L-HCM) (Song and Ramkrishna, 2010; 2011) are based on the balanced growth hypothesis so that they are unable to simulate the accumulation of intracellular metabolites. This is a misrepresentation of these models due to the following reasons.

  8. Dynamic and scintigraphic studies of diffuse hepatic diseases using /sup 99m/Tc-Sn-phytate. Comparative analyses with /sup 198/Au-colloid

    Energy Technology Data Exchange (ETDEWEB)

    Akisada, M [Mitsui Memorial Hospital, Tokyo (Japan); Miyamae, T

    1975-09-01

    From March 1974 to May 1974, liver scintigraphies were performed at Mitsui Memorial Hospital. Three groups of patients were composed of: 24 of liver cirrhosis, 29 of chronic hepatitis and 30 of a normal control group. The mixture of 1.5 mCi of sup(99m)Tc-phytate and 30 ..mu..Ci of /sup 198/Au-colloid were injected rapidly. Ksub(L) value of sup(99m)Tc-phytate in the liver cirrhosis group was lower than the chronic hepatitis group, which was lower than the normal group. The correlation between Tsub(1/2) (L) and Tsub(1/2)(P): In the normal group, the coefficient correlation between Tsub(1/2)(L) and Tsub(1/2)(P) was fairly good both in sup(99m)Tc-phytate and in /sup 198/Au-colloid, whereas the correlation was low in the chronic hepatitis group and liver cirrhosis group. The how correlation between the Ksub(L) values of sup(99m)Tc-phytate and /sup 198/Au-colloid: The correlation of the Ksub(L) value was low in all three groups. Ksub(L) values in sup(99m)Tc-phytate were higher than they were in /sup 198/Au-colloid in all three groups. When each probe was placed on the temporal and thigh region simultaneously for obtaining the peripheral blood clearance, the Tsub(1/2)(P) value (temporal) was always smaller than the Tsub(1/2)(P) value (thigh). Grade of kidney visualization in liver scintigraphy using sup(99m)Tc-phytate: Kidney activities were seen in 72.9% of 83 patients and there was no grade difference between the normal,chronic hepatitis and liver cirrhosis group. An additional attempt to determine the nature and size of ''sup(99m)Tc-phytate in vivo colloid'', Ca ion was added to sup(99m)Tc-phytate solution prior to the injection. Lung, spleen, and liver were simultaneously visualized using this ''in vitro sup(99m)Tc-phytate minicolloid''.

  9. Blood disappearance rate of /sup 198/Au-colloid and changes of hepatic blood flow during position change in normal persons and in patients with various hepatic diseases

    Energy Technology Data Exchange (ETDEWEB)

    Cho, B Y [Capital Armed Forces General Hospital, Seoul (Republic of Korea); Hong, K S; Koh, C S; Lee, M [Seoul National Univ., Seoul (Republic of Korea). Coll. of Medicine

    1977-01-01

    To evaluate the diagnostic significance of the blood disappearance rate of /sup 198/Au-colloid and to evaluate the change of hepatic blood flow during position change from supine to erect, we measured the half time of blood disappearance rate of 7,1/sup 98/Au-colloid using external counting method in 94 normal persons and in 77 patients with various hepatic diseases. The results obtained were as follows: 1. In normal control, the mean blood disappearance half time of /sup 198/Au-colloid in supine position was 2.7+-0.4 minutes. There was no significant difference of hepatic blood flow in age and sex. 2. In acute hepatitits, chronic hepatitis and hepatic cirrhosis, the mean blood disappearance half times in supine position were 3.0+-0.45, 3.5+-0.74, 7.2+-3.6 minutes respectively. The hepatic blood flow of the patients with chronic hepatitis and hepatic cirrhosis were significantly decreased than that of normal control. 3. In the normal control and acute hepatitis, the decreaces of the hepatic blood flow during the position change from supine to erect were 27.7% and 22.6% respectively.

  10. Gyromagnetic ratios of low-lying excited states in the even 192-198Pt isotopes; experimental measurements and theoretical predictions

    International Nuclear Information System (INIS)

    Stuchbery, A.E.; Ryan, C.G.; Morrison, I.; Bolotin, H.H.

    1981-01-01

    The gyromagnetic ratios of the 2 2 + and 4 1 + states in 196 Pt were measured relative to that of its 2 1 + level. The thin-foil IMPAC technique was employed utilizing the enhanced transient hyperfine magnetic field present at the nuclei of swiftly recoiling ions traversing magnetized ferromagetic materials. The states of interest were populated by Coulomb excitation using beams of 220-MeV 58 Ni ions. For g(2 1 + ) taken as 0.326+-0.014, the present measurements yielded g(2 2 + ) = 0.30+-0.06 and g(4 1 + ) 0.30+-0.05. These results and those reported by prior workers for the g-factors of corresponding levels in 192 Pt, 194 Pt, 198 Pt are used to trace the systematics of the magnetic moments of these low-lying levels in the even 192 - 198 Pt isotopes. Interacting Boson Approximation model-based calculations of the g-factors of these states were also carried out. The experimental theoretical results are compared

  11. The blood disappearance rate of 198Au-colloid and changes of hepatic blood flow during position change in normal persons and in patients with various hepatic diseases

    International Nuclear Information System (INIS)

    Cho, B.Y.; Hong, K.S.; Koh, C.S.; Lee, M.

    1977-01-01

    To evaluate the diagnostic significance of the blood disappearance rate of 198 Au-colloid and to evaluate the change of hepatic blood flow during position change from supine to erect, we measured the half time of blood disappearance rate of 7,1 98 Au-colloid using external counting method in 94 normal persons and in 77 patients with various hepatic diseases. The results obtained were as follows: 1. In normal control, the mean blood disappearance half time of 198 Au-colloid in supine position was 2.7+-0.4 minutes. There was no significant difference of hepatic blood flow in age and sex. 2. In acute hepatitits, chronic hepatitis and hepatic cirrhosis, the mean blood disappearance half times in supine position were 3.0+-0.45, 3.5+-0.74, 7.2+-3.6 minutes respectively. The hepatic blood flow of the patients with chronic hepatitis and hepatic cirrhosis were significantly decreased than that of normal control. 3. In the normal control and acute hepatitis, the decreaces of the hepatic blood flow during the position change from supine to erect were 27.7% and 22.6% respectively. (author)

  12. Diagnostic Significance of the Blood Disappearance Rate of {sup 131}I-Rose Bengal and of {sup 198}Au colloid in Hepatobiliary Diseases

    Energy Technology Data Exchange (ETDEWEB)

    Chun, Young Kyoon; Hahn, Shim Suk; Koh, Chang Soon [Seoul National University College of Medicine, Seoul (Korea, Republic of)

    1971-09-15

    The liver function test was performed by means of two radioisotope tracer techniques in 20 normal subjects and in 63 patients with hepatobiliary diseases. The blood disappearance rates of {sup 131}I-rose bengal and of {sup 198}Au colloid were determined by external counting method. The hepatocellular function and the hepatic blood flow were estimated from the observed data and the results were compared with those of the conventional liver function tests. The results obtained were as follows: 1. The mean blood disappearance half time of {sup 131}I-rose bengal was 6.6+-0.63 minutes in normal control, 17.7+-6.93 in cirrhosis of the liver, 16.6+-4. 80 in acute hepatitis, and 14 7+-3.46 in obstructive jaundice. It was markedly prolonged in the hepatobiliary diseases as compared with the normal control, but there was no significant difference among the hepatobiliary diseases. 2.The mean blood disappearance half time of {sup 198}Au colloid was 4. 0+-0. 66 minutes in normal control, 9.8+-3.42 in cirrhosis of the liver, 4.4+-0.82 in acute hepatitis, and 5.0+-1.42 in obstructive jaundice. The difference between cirrhosis of the liver and normal control was statistically significant. However, there was no definite difference among acute hepatitis, obstructive jaundice, and normal control. The mean blood disappearance rate constant (K value) was 0.177+-0.028/minute in normal control, In cirrhosis of the liver, it was markedly decreased which was suggestive of the reduced hepatic blood flow. 3. The ratio of {sup 131}I-rose bengal blood disappearance half time to {sup 198}Au colloid disappearance half time was 1.68+-0.20 in normal control, 1.82+-0.31 in cirrhosis of the liver, 3.80+-0.82 in acute hepatitis, and 3.01+-0.54 in obstructive jaundice. The ratios in acute hepatitis and obstructive jaundice were remarkably higher than those in normal control and cirrhosis of the liver. 4. There was a significant correlation between the blood disappearance half time of {sup 131}I

  13. Diagnostic Significance of the Blood Disappearance Rate of 131I-Rose Bengal and of 198Au colloid in Hepatobiliary Diseases

    International Nuclear Information System (INIS)

    Chun, Young Kyoon; Hahn, Shim Suk; Koh, Chang Soon

    1971-01-01

    The liver function test was performed by means of two radioisotope tracer techniques in 20 normal subjects and in 63 patients with hepatobiliary diseases. The blood disappearance rates of 131 I-rose bengal and of 198 Au colloid were determined by external counting method. The hepatocellular function and the hepatic blood flow were estimated from the observed data and the results were compared with those of the conventional liver function tests. The results obtained were as follows: 1. The mean blood disappearance half time of 131 I-rose bengal was 6.6±0.63 minutes in normal control, 17.7±6.93 in cirrhosis of the liver, 16.6±4. 80 in acute hepatitis, and 14 7±3.46 in obstructive jaundice. It was markedly prolonged in the hepatobiliary diseases as compared with the normal control, but there was no significant difference among the hepatobiliary diseases. 2.The mean blood disappearance half time of 198 Au colloid was 4. 0±0. 66 minutes in normal control, 9.8±3.42 in cirrhosis of the liver, 4.4±0.82 in acute hepatitis, and 5.0±1.42 in obstructive jaundice. The difference between cirrhosis of the liver and normal control was statistically significant. However, there was no definite difference among acute hepatitis, obstructive jaundice, and normal control. The mean blood disappearance rate constant (K value) was 0.177±0.028/minute in normal control, In cirrhosis of the liver, it was markedly decreased which was suggestive of the reduced hepatic blood flow. 3. The ratio of 131 I-rose bengal blood disappearance half time to 198 Au colloid disappearance half time was 1.68±0.20 in normal control, 1.82±0.31 in cirrhosis of the liver, 3.80±0.82 in acute hepatitis, and 3.01±0.54 in obstructive jaundice. The ratios in acute hepatitis and obstructive jaundice were remarkably higher than those in normal control and cirrhosis of the liver. 4. There was a significant correlation between the blood disappearance half time of 131 I-rose bengal and that of 198 Au colloid in

  14. Cross-sections of 197Au(n,α)198Au and 63Cu(n,α)64Cu induced by 252Cf neutrons

    International Nuclear Information System (INIS)

    Mandal, Ranjita; Sengupta, D.; Roy, Malobika; Naik, Mamta; Bhoraskar, V.N.

    2014-01-01

    Analytical work, employing nuclear techniques, is normally carried out through (n,α) reaction because of the availability of neutrons either from reactors or laboratory sources such as Sb-Be, Am-Be, Ra-Be, Po-Be, 252 Cf, etc. The laboratory neutron sources are though portable and adaptable to a particular experimental arrangement, suffer from the disadvantage of slow neutron yield (except 252 Cf). In this set up since the neutrons available are monoenergetic, it was thought appropriate to initiate a program to measure cross-sections of a few nuclear reactions which have practical applications. Earlier studies on cross-section measurement of the reaction 197 Au(n,α) 198 Au and 63 Cu(n,α) 64 Cu has been carried out using different sources, monitors and techniques

  15. Measurement of Gamow-Teller and spin dipole strength in the 45Sc(n,p)45Ca reaction at 198 MeV

    International Nuclear Information System (INIS)

    Alford, W.P.; Celler, A.; Brown, B.A.; Long, S.; Raywood, K.

    1990-11-01

    The reaction 45 Sc(n,p) 45 Ca has been studied at an energy of 198 MeV with energy resolution of about 1 MeV. Measurements were carried out at nominal angles 0, 3, 6, 9, 12, 15, and 18 degrees and spectra obtained up to ∼40 MeV excitation energy in 45 Ca. Significant Gamow-Teller strength is observed at an excitation energy of about 7 MeV, somewhat higher than predicted by shell model calculations. The strength observed is in agreement with calculations using g A /g V ≅ 1. The spin dipole giant resonance is seen with centroid at about 15 MeV excitation and total cross section of 25 mb/sr at an angle of 6 degrees. (Author) (22 refs., 9 figs.)

  16. Transient field measurements of g-factors in 194,196,198Pt; g(21+) systematics in transitional W, Os, Pt nuclei

    International Nuclear Information System (INIS)

    Stuchbery, A.E.; Lampard, G.J.; Bolotin, H.H.

    1991-01-01

    Transient field processions were measured simultaneously for levels in the nuclei 182,184,186 W and 194,196,198 Pt as their ions traversed polarized Gd hosts. These results allow a critical evaluation of conflicting g-factor values reported previously for the even Pt isotopes. Mass variations of g(2 1 + ) in the even W, Os, Pt nuclei are examined using the proton-neutron interacting boson model (IBM-2). The measured g-factors depart from the simplest IBM-2 description perhaps due to subshell effects and/or small contributions from non-collective configurations which cause the neutron-boson g-factor to vary with mass. 46 refs., 5 tabs., 7 figs

  17. The advantage of letrozole over tamoxifen in the BIG 1-98 trial is consistent in younger postmenopausal women and in those with chemotherapy-induced menopause

    DEFF Research Database (Denmark)

    Chirgwin, Jacquie; Sun, Zhuoxin; Smith, Ian

    2012-01-01

    subclinical ovarian estrogen production), and those with chemotherapy-induced menopause who may experience return of ovarian function. In these situations tamoxifen may be preferable to an aromatase inhibitor. Among 4,922 patients allocated to the monotherapy arms (5 years of letrozole or tamoxifen......) in the BIG 1-98 trial we identified two relevant subpopulations: patients with potential residual ovarian function, defined as having natural menopause, treated without adjuvant or neoadjuvant chemotherapy and age ≤ 55 years (n = 641); and those with chemotherapy-induced menopause (n = 105). Neither...... of the subpopulations examined showed treatment effects differing from the trial population as a whole (interaction P values are 0.23 and 0.62, respectively). Indeed, both among the 641 patients aged ≤ 55 years with natural menopause and no chemotherapy (HR 0.77 [0.51, 1.16]) and among the 105 patients...

  18. Astatine-211 labelled proteins and their stability in vivo

    International Nuclear Information System (INIS)

    Yi Changhou; Jin Jannan; Zhang Shuyuan; Wang Ketai; Zhang Dayuan; Zhou Maolun

    1989-01-01

    211 At or 131 I labelled proteins, e.g. 211 At-IgG or 211 At-BSA (bovine serum albumin) were prepared by 211 At reaction with the diazo-compound of para-aminobenzoic acid, which is then conjugated with IgG or BSA via an acylation reaction. The 211 At-carbon bond was found metabolically stable under in vivo conditions. For the labelling of proteins with 211 At or 131 I, other methods of direct oxidation are also described. The results show that for the labelling of proteins with 211 At, high rate of incorporation can be obtained with hydrogen peroxide as oxidant, but the labelling of proteins with 131 I is more favourable with the strong oxidant Chloramine-T. (author) 12 refs.; 6 figs

  19. High-level fluoroquinolone resistant Salmonella enterica serovar Kentucky ST198 epidemic clone with IncA/C conjugative plasmid carrying bla(CTX-M-25) gene.

    Science.gov (United States)

    Wasyl, Dariusz; Kern-Zdanowicz, Izabela; Domańska-Blicharz, Katarzyna; Zając, Magdalena; Hoszowski, Andrzej

    2015-01-30

    Multidrug resistant Salmonella Kentucky strains have been isolated from turkeys in Poland since 2009. Multiple mutations within chromosomal genes gyrA and parC were responsible for high-level ciprofloxacin resistance. One of the isolates was extended spectrum β-lactamase- (ESBL) positive: the strain 1643/2010 carried a conjugative 167,779 bps plasmid of IncA/C family. The sequence analysis revealed that it carried a blaCTX-M-25 gene and an integron with another β-lactamase encoding gene-blaOXA-21. This is the first known report of a CTX-M-25 encoding gene both in Poland and in Salmonella Kentucky world-wide, as well as in the IncA/C plasmid. Analysis of the integron showed a novel arrangement of gene cassettes-aacA4, aacC-A1 and blaOXA-21 where the latter might result from an intergeneric gene transfer. The study confirmed Salmonella Kentucky population isolated in Poland belongs to global epidemics of high level fluoroquinolone resistant clone ST198 that can carry rare β-lactamase genes. Copyright © 2014 Elsevier B.V. All rights reserved.

  20. Antiapoptotic effect of novel compound from Herba leonuri - leonurine (SCM-198): a mechanism through inhibition of mitochondria dysfunction in H9c2 cells.

    Science.gov (United States)

    Liu, Xin Hua; Pan, Li Long; Gong, Qi Hai; Zhu, Yi Zhun

    2010-12-01

    Apoptosis of cardiomyocytes induced by oxidative stress play a critical role in cardiac dysfunction associated with ventricular remodeling and heart failure. We recently reported that leonurine attenuated hypoxia-induced cardiomyocyte damage. In this study, we investigated the mechanism of leonurine (originally from Herba leonuri but we synthesized it chemically it as also called SCM-198) (H₂O₂)-induced rat embryonic heart-derived H9c2 cells from apoptosis. Exposing H9c2 cells to H₂O₂ significantly decreased cell viability, and this was attenuated by pretreatment with leonurine for 4 h in a concentration-dependent manner. Meanwhile, leonurine was found to reduce intracellular reactive oxygen species (ROS) generation in H₂O₂-stimulated cell. Moreover, H9c2 cells stimulated by H₂O₂ was accompanied with apparent apoptotic characteristics, including fragmentation of DNA, apoptotic body formation, release of cytochrome c, translocation of Bax to mitochondria, loss of mitochondrial membrane potential (ΔΨ(m)) and activation of caspase 3. Furthermore, H₂O₂ also induced rapid and significant phosphorylation of the c-Jun-N-terminal kinase 1/2 (JNK1/2), which was inhibited SP600125 (a JNK1/2 inhibitor). All of these events were attenuated by leonurine pretreatment. Taken together, these results demonstrated that leonurine could protect H9c2 cells from H₂O₂-induced apoptosis via modulation of mitochondrial dysfunction associated with blocking the activation of JNK1/2.

  1. Sport, sex and age increase risk of illness at the Rio 2016 Summer Paralympic Games: a prospective cohort study of 51 198 athlete days.

    Science.gov (United States)

    Derman, Wayne; Schwellnus, Martin P; Jordaan, Esme; Runciman, Phoebe; Blauwet, Cheri; Webborn, Nick; Lexell, Jan; Van de Vliet, Peter; Tuakli-Wosornu, Yetsa; Kissick, James; Stomphorst, Jaap

    2018-01-01

    To describe the epidemiology of illness at the Rio 2016 Summer Paralympic Games. A total of 3657 athletes from 78 countries, representing 83.5% of all athletes at the Games, were monitored on the web-based injury and illness surveillance system (WEB-IISS) over 51 198 athlete days during the Rio 2016 Summer Paralympic Games. Illness data were obtained daily from teams with their own medical support through the WEB-IISS electronic data capturing systems. The total number of illnesses was 511, with an illness incidence rate (IR) of 10.0 per 1000 athlete days (12.4%). The highest IRs were reported for wheelchair fencing (14.9), para swimming (12.6) and wheelchair basketball (12.5) (pParalympic Games; (2) the sports with the highest risk were wheelchair fencing, para swimming and wheelchair basketball; (3) female and older athletes (35-75 years) were at increased risk of illness; and (4) the respiratory system, skin and subcutaneous system and digestive system were most affected by illness. These results allow for comparison at future Games. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  2. Desorption of Reactive Red 198 from activated carbon prepared from walnut shells: effects of temperature, sodium carbonate concentration and organic solvent dose

    Directory of Open Access Journals (Sweden)

    Zohreh Alimohamadi

    2017-04-01

    Full Text Available This study investigated the effect of temperature, different concentrations of sodium carbonate,and the dose of organic solvent on the desorption of Reactive Red 198 dye from dye-saturated activated carbon using batch and continuous systems. The results of the batch desorption test showed 60% acetone in water as the optimum amount. However, when the concentration of sodium carbonate was raised, the dye desorption percentage increased from 26% to 42% due to economic considerations; 15 mg/L of sodium carbonate was selected to continue the processof desorption. Increasing the desorption temperature can improve the dye desorption efficiency.According to the column test results, dye desorption concentration decreased gradually with the passing of time. The column test results showed that desorption efficiency and the percentage of dye adsorbed decreased; however, it seemed to stabilize after three repeated adsorption/desorption cycles. The repeated adsorption–desorption column tests (3 cycles showed that the activated carbon which was prepared from walnut shell was a suitable and economical adsorbent for dye removal.

  3. Genetic variation in codons 167, 198 and 200 of the beta-tubulin gene in whipworms (Trichuris spp.) from a range of domestic animals and wildlife

    DEFF Research Database (Denmark)

    Hansen, Tina Vicky Alstrup; Nejsum, Peter; Olsen, Annette

    2013-01-01

    A recurrent problem in the control of whipworm (Trichuris spp.) infections in many animal species and man is the relatively low efficacy of treatment with a single application of benzimidazoles (BZs). The presence of single nucleotide polymorphisms (SNPs) in codons 167, 198 and 200 in the beta...

  4. Dynamic Study on the Hepatobiliary Diseases with Combination of {sup 131}I-Rose bengal and {sup 198}Au-Colloid Scintiphotography

    Energy Technology Data Exchange (ETDEWEB)

    Rhee, Yong Kok [Seoul National University College of Medicine, Seoul (Korea, Republic of)

    1971-03-15

    The radioactive {sup 131}I-Rose bengal serial scintiphotography was performed in 62 patients with the hepatobiliary diseases and in 20 normal subjects. This approach permitted visualization of the hepatic uptake of {sup 131}I-Rose bengal from the circulation and its excretion into the biliary trees and the intestines. In some of these patients, gallbladder function was examined, using eggs as a gallbladder constrictor. The time of maximum hepatic uptake was well correlated to the conventional biochemical liver function tests. In addition to {sup 131}I-Rose bengal scintiphotography, {sup 198}Au-colloid scintiphotography was also performed to make comparison of these two tests. The results obtained were as follows: 1) In normal subjects, the maximum hepatic uptake of {sup 131}I-Rose bengal occurred at 23+-2.9 minutes, the initial hepatic excretion at 34+-5.1 minutes, the visualization of the gallbladder at 29+-5.7 minutes and the intestinal visualization at 54+-25.8 minutes. The radioactivity in the gallbladder decreased to 10.7+-5.0% one hour after the ingestion of eggs. 2) In the patients with cirrhosis of the liver, there was a delayed and decreased hepatic uptake. The maximum hepatic uptake occurred at 43+-12.9 minutes. The differences in the results of uptake between the cirrhotic and the normal group were statistically significant. The initial hepatic excretion occurred at 60+-18.5 minutes and had tendency of delaying compared with the normal controls. The gallbladder was visualized in 13 of 16 cases (81%) and its visualization occurred at 49+-14.6 minutes with a tendency to be delayed compared with the normal controls. The intestinal visualization occurred at 63+-15.8 minutes and its delaying tendency was somewhat more prominent. 3) In patients with hepatitis, the maximum hepatic uptake occurred at 59+-21.4 minutes and was significantly delayed. The initial hepatic excretion occurred at 82+-34.3 minutes and the results revealed a delaying tendency. The

  5. High precompetition injury rate dominates the injury profile at the Rio 2016 Summer Paralympic Games: a prospective cohort study of 51 198 athlete days.

    Science.gov (United States)

    Derman, Wayne; Runciman, Phoebe; Schwellnus, Martin; Jordaan, Esme; Blauwet, Cheri; Webborn, Nick; Lexell, Jan; van de Vliet, Peter; Tuakli-Wosornu, Yetsa; Kissick, James; Stomphorst, Jaap

    2018-01-01

    To describe the incidence of injury in the precompetition and competition periods of the Rio 2016 Summer Paralympic Games. A total of 3657 athletes from 78 countries, representing 83.4% of all athletes at the Games, were monitored on the web-based injury and illness surveillance system over 51 198 athlete days during the Rio 2016 Summer Paralympic Games. Injury data were obtained daily from teams with their own medical support. A total of 510 injuries were reported during the 14-day Games period, with an injury incidence rate (IR) of 10.0 injuries per 1000 athlete days (12.1% of all athletes surveyed). The highest IRs were reported for football 5-a-side (22.5), judo (15.5) and football 7-a-side (15.3) compared with other sports (pGames (IR of 5.5). The shoulder was the most common anatomical area affected by injury (IR of 1.8). The data from this study indicate that (1) IRs were lower than those reported for the London 2012 Summer Paralympic Games, (2) the sports of football 5-a-side, judo and football 7-a-side were independent risk factors for injury, (3) precompetition injuries had a higher IR than competition period injuries, (4) injuries to the shoulder were the most common. These results would allow for comparative data to be collected at future editions of the Games and can be used to inform injury prevention programmes. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  6. Comparative genomics of the dairy isolate Streptococcus macedonicus ACA-DC 198 against related members of the Streptococcus bovis/Streptococcus equinus complex.

    Science.gov (United States)

    Papadimitriou, Konstantinos; Anastasiou, Rania; Mavrogonatou, Eleni; Blom, Jochen; Papandreou, Nikos C; Hamodrakas, Stavros J; Ferreira, Stéphanie; Renault, Pierre; Supply, Philip; Pot, Bruno; Tsakalidou, Effie

    2014-04-08

    Within the genus Streptococcus, only Streptococcus thermophilus is used as a starter culture in food fermentations. Streptococcus macedonicus though, which belongs to the Streptococcus bovis/Streptococcus equinus complex (SBSEC), is also frequently isolated from fermented foods mainly of dairy origin. Members of the SBSEC have been implicated in human endocarditis and colon cancer. Here we compare the genome sequence of the dairy isolate S. macedonicus ACA-DC 198 to the other SBSEC genomes in order to assess in silico its potential adaptation to milk and its pathogenicity status. Despite the fact that the SBSEC species were found tightly related based on whole genome phylogeny of streptococci, two distinct patterns of evolution were identified among them. Streptococcus macedonicus, Streptococcus infantarius CJ18 and Streptococcus pasteurianus ATCC 43144 seem to have undergone reductive evolution resulting in significantly diminished genome sizes and increased percentages of potential pseudogenes when compared to Streptococcus gallolyticus subsp. gallolyticus. In addition, the three species seem to have lost genes for catabolizing complex plant carbohydrates and for detoxifying toxic substances previously linked to the ability of S. gallolyticus to survive in the rumen. Analysis of the S. macedonicus genome revealed features that could support adaptation to milk, including an extra gene cluster for lactose and galactose metabolism, a proteolytic system for casein hydrolysis, auxotrophy for several vitamins, an increased ability to resist bacteriophages and horizontal gene transfer events with the dairy Lactococcus lactis and S. thermophilus as potential donors. In addition, S. macedonicus lacks several pathogenicity-related genes found in S. gallolyticus. For example, S. macedonicus has retained only one (i.e. the pil3) of the three pilus gene clusters which may mediate the binding of S. gallolyticus to the extracellular matrix. Unexpectedly, similar findings were

  7. Adjuvant letrozole versus tamoxifen according to centrally-assessed ERBB2 status for postmenopausal women with endocrine-responsive early breast cancer: supplementary results from the BIG 1-98 randomised trial

    DEFF Research Database (Denmark)

    Regan, M.M.; Lykkesfeldt, A.E.; Dell'Orto, P.

    2008-01-01

    Background The Breast International Group (BIG) 1-98 trial (a randomised double-blind phase III trial) has shown that letrozole significantly improves disease-free survival (DFS) compared with tamoxifen in postmenopausal women with endocrine-responsive early breast cancer. Our aim was to establish...... whether the benefit of letrozole versus tamoxifen differs according to the ERBB2 status of tumours. Methods The BIG 1-98 trial consists of four treatment groups that compare 5 years of monotherapy with letrozole or tamoxifen, and sequential administration of one drug for 2 years followed by the other drug...... for 3 years. Our study includes data from the 4922 patients randomly assigned to the two monotherapy treatment groups (letrozole or tamoxifen for 5 years; 51 months median follow-up [range

  8. Study and construction of a {beta}-spectrometer of uniform axial magnetic field fitted with a {beta}-{gamma} coincidence selector. Study of the {beta} spectra of {sup 32}P, {sup 203}Hg, {sup 198}Au. Measurement of the conversion coefficients of {sup 203}Ti and of {sup 198}Hg; Etude et realisation d'un spectrometre-{beta} a champ magnetique axial uniforme, muni d'un selecteur de coincidence {beta}-{gamma}. Etude des spectres {beta} du {sup 32}p, {sup 203}Hg, {sup 198}Au. Mesure des coefficients de conversion du {sup 203}Ti et du {sup 198}Hg

    Energy Technology Data Exchange (ETDEWEB)

    Parsignault, D [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1964-06-01

    In the first part is given the principle of the beta spectrometer with uniform axial field using systematically the idea of caustics. The apparatus is described and its properties compared to those deduced from trajectory calculations. The {beta}-ray and {gamma}-ray detectors and the device for selecting coincidences with a 2 {tau} resolution of 5 nanoseconds are also presented. In the second part, the spectrometer is used for studying reference elements and the most accurate results are confirmed. The {beta} spectrum of {sup 60}Co has a statistical form with an accuracy of 1 per cent; the maximum energy E{sub 0} is 316.5 {+-} 1.5 keV. That of the 7/2 + {yields} 11/2 transition for {sup 137}Cs has a unique form, once forbidden. E{sub 0}= 522 {+-} 3 keV. Conversion coefficients {alpha}{sub k} = 96 {+-} 1 X 10{sup -3} {alpha}L + M + N = 20.9 {+-} 0.5 X 10{sup -3}. The two {beta} spectra of {sup 59}Fe, separated by coincidence with the gamma, have the statistical form E{sub 0} = 462 {+-} 2 keV (55.1 + 0,3 per cent) and E{sub 1} = 275 {+-} 4 keV (44.9 {+-} 0.3 per cent). It is then verified whether the l selection rule is apparent in the shape of the phosphorus 32 beta spectrum. It is found in fact that it is not of statistical shape and its shape coefficient is determined. For a theoretical interpretation it is necessary to have better approximations than those generally used and this interpretation will not be unique. This work has also made it possible to show that the source contains a small proportion of {sup 33}P. The study of the {sup 203}Hg {beta} spectrum followed by the 279 keV gamma spectrum is designed to determine the conversion coefficients. The interior spectrum of gold 198 is not of statistical shape either. The form coefficient is determined together with the conversion coefficients which are in slight disagreement with those calculated by Rose or Sliv. An interpretation of the spectrum is put forward which proposes an imperfect compensation for the

  9. Study and construction of a {beta}-spectrometer of uniform axial magnetic field fitted with a {beta}-{gamma} coincidence selector. Study of the {beta} spectra of {sup 32}P, {sup 203}Hg, {sup 198}Au. Measurement of the conversion coefficients of {sup 203}Ti and of {sup 198}Hg; Etude et realisation d'un spectrometre-{beta} a champ magnetique axial uniforme, muni d'un selecteur de coincidence {beta}-{gamma}. Etude des spectres {beta} du {sup 32}p, {sup 203}Hg, {sup 198}Au. Mesure des coefficients de conversion du {sup 203}Ti et du {sup 198}Hg

    Energy Technology Data Exchange (ETDEWEB)

    Parsignault, D. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1964-06-01

    In the first part is given the principle of the beta spectrometer with uniform axial field using systematically the idea of caustics. The apparatus is described and its properties compared to those deduced from trajectory calculations. The {beta}-ray and {gamma}-ray detectors and the device for selecting coincidences with a 2 {tau} resolution of 5 nanoseconds are also presented. In the second part, the spectrometer is used for studying reference elements and the most accurate results are confirmed. The {beta} spectrum of {sup 60}Co has a statistical form with an accuracy of 1 per cent; the maximum energy E{sub 0} is 316.5 {+-} 1.5 keV. That of the 7/2 + {yields} 11/2 transition for {sup 137}Cs has a unique form, once forbidden. E{sub 0}= 522 {+-} 3 keV. Conversion coefficients {alpha}{sub k} = 96 {+-} 1 X 10{sup -3} {alpha}L + M + N = 20.9 {+-} 0.5 X 10{sup -3}. The two {beta} spectra of {sup 59}Fe, separated by coincidence with the gamma, have the statistical form E{sub 0} = 462 {+-} 2 keV (55.1 + 0,3 per cent) and E{sub 1} = 275 {+-} 4 keV (44.9 {+-} 0.3 per cent). It is then verified whether the l selection rule is apparent in the shape of the phosphorus 32 beta spectrum. It is found in fact that it is not of statistical shape and its shape coefficient is determined. For a theoretical interpretation it is necessary to have better approximations than those generally used and this interpretation will not be unique. This work has also made it possible to show that the source contains a small proportion of {sup 33}P. The study of the {sup 203}Hg {beta} spectrum followed by the 279 keV gamma spectrum is designed to determine the conversion coefficients. The interior spectrum of gold 198 is not of statistical shape either. The form coefficient is determined together with the conversion coefficients which are in slight disagreement with those calculated by Rose or Sliv. An interpretation of the spectrum is put forward which proposes an imperfect compensation for the

  10. Development of a tetra-primer ARMS-PCR for detecting the E198A SNP in the isotype-1 β-tubulin gene of Haemonchus contortus populations in China.

    Science.gov (United States)

    Zongze, Zhang; Xin, Yang; Awais, Ali Ahmad; Weiqiang, Lei; Chunqun, Wang; Di, Wenda; Yanqin, Zhou; Junlong, Zhao; Rui, Fang; Min, Hu

    2018-03-15

    The tetra-primer ARMS-PCR is a rapid, simple and low cost method for single nucleotide polymorphism (SNP) genotyping and has been used to detect SNPs associated with diseases and drug resistance. E198A in the isotype-1 β-tubulin gene is one of the three SNPs associated with benzimidazole resistance in parasitic nematode Haemonchus contortus. However, up to now, only PCR-RFLP method was used to test E198A in H. contortus. In the present study, we developed a tetra-primer ARMS-PCR to detect E198A in H. contortus and the accuracy of the results was compared with that of PCR-coupled sequencing. The results showed that optimization of PCR reaction system, especially the proportion of the amount of inner and outer primers, could achieve desirable amplification effect. Three different profiles displaying three distinct genotypes could be identified clearly and intuitively on the agarose gel where the samples with amplified PCR products containing two bands of 433 bp and 200 bp in size indicated susceptible homozygous (SS), those with PCR products containing two bands of 433 bp and 284 bp in length indicated resistant homozygous (RR) and the samples with amplified PCR products containing three bands of 433 bp, 284 bp and 200 bp in size indicated heterozygous (RS). The results showed that the established method can be successfully applied to the detection of E198A in H. contortus, which has high accuracy and is easy to perform. Copyright © 2018 Elsevier B.V. All rights reserved.

  11. Prognostic and predictive role of ESR1 status for postmenopausal patients with endocrine-responsive early breast cancer in the Danish cohort of the BIG 1-98 trial

    DEFF Research Database (Denmark)

    Ejlertsen, B; Aldridge, J; Nielsen, K V

    2012-01-01

    postmenopausal Danish women with early breast cancer randomly assigned to receive 5 years of letrozole, tamoxifen or a sequence of these agents in the Breast International Group 1-98 trial and who had ER ≥1% after central review. RESULTS: By FISH, 13.6% of patients had an ESR1-to-Centromere-6 (CEN-6) ratio ≥2...... (amplified), and 4.2% had ESR1-to-CEN-6 ratio...

  12. Measurement of {sup 197}Au(n,γ){sup 198g}Au reaction cross-section at the neutron energies of 1.12, 2.12, 3.12 and 4.12 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Vansola, Vibha [M.S. Univ., Baroda (India). Dept. of Physics; Ghosh, Reetuparna; Badwar, Sylvia [North Eastern Hill Univ., Meghalaya (India). Dept. of Physics; and others

    2015-07-01

    The {sup 197}Au(n,γ){sup 198}Au reaction cross-sections at the neutron energies of 1.12, 2.12, 3.12 and 4.12 MeV were determined by using activation and off-line γ-ray spectrometric technique. The mono-energetic neutron energies of 1.12-4.12 MeV were generated from the {sup 7}Li(p,n) reaction by using the proton energies of 3 and 4 MeV from the folded tandem ion beam accelerator (FOTIA) at BARC as well as 5 and 6 MeV from the Pelletron facility at TIFR, Mumbai. The {sup 115}In(n,γ){sup 116m}In reaction cross-section was used as the neutron flux monitor. The {sup 197}Au(n,γ){sup 198}Au reaction cross-section at the neutron energies of 3.12 and 4.12 MeV are reported for the first time. The {sup 197}Au(n,γ){sup 198}Au reaction cross-sections at 1.12 and 2.12 MeV are close to the literature data of in between neutron energies. The {sup 197}Au(n,γ){sup 198}Au cross-section was also calculated theoretically by using the computer code TALYS 1.6 and found to be higher than the experimental data of present work and literature data within the neutron energies of 0.8 to 4 MeV.

  13. Contribution to the study of {beta} disintegration and of nuclear structure using experiments on certain {beta}-{gamma} cascades: 198{sub Au}, 86{sub Rb}, 170{sub Tm}; Contribution a l'etude de la desintegration beta et a l'etude de la structure nucleaire a l'aide d'experiences sur certaines cascades beta-gamma: 198{sub Au}, 86{sub Rb}, 170{sub Tm}

    Energy Technology Data Exchange (ETDEWEB)

    Lachkar, J. [Commissariat a l' Energie Atomique, Bruyeres-le-Chatel (France). Centre d' Etudes; Paris-11 Univ., fabulte des Sciences 91 - Orsay (France)

    1969-07-01

    {beta}{gamma} directional angular correlations and shapes of inner beta spectra leading to the first excited level of the final nucleus enable one to determine the nuclear matrix elements typical of the {beta} transition. In the three observed first forbidden cases: {sup 170}Tm, {sup 86}Rb, {sup 198}Au, these matrix elements do not confirm the independent shell model theory. Other hypotheses are then suggested and discussed. (author) [French] Les experiences de correlation angulaire {beta}{gamma} et l'etude du spectre {beta} conduisant au premier niveau excite du noyau final permettent de determiner les elements de matrices nucleaires caracteristiques de cette transition. Dans les trois cas etudies (transitions une fois interdites): {sup 170}Tm, {sup 86}Rb, {sup 198}Au, ces elements de matrices ne peuvent etre retrouves a l'aide du modele en couches et a particules independantes. D'autres hypotheses sont alors emises et discutees. (auteur)

  14. Contribution to the study of {beta} disintegration and of nuclear structure using experiments on certain {beta}-{gamma} cascades: 198{sub Au}, 86{sub Rb}, 170{sub Tm}; Contribution a l'etude de la desintegration beta et a l'etude de la structure nucleaire a l'aide d'experiences sur certaines cascades beta-gamma: 198{sub Au}, 86{sub Rb}, 170{sub Tm}

    Energy Technology Data Exchange (ETDEWEB)

    Lachkar, J [Commissariat a l' Energie Atomique, Bruyeres-le-Chatel (France). Centre d' Etudes; Paris-11 Univ., fabulte des Sciences 91 - Orsay (France)

    1969-07-01

    {beta}{gamma} directional angular correlations and shapes of inner beta spectra leading to the first excited level of the final nucleus enable one to determine the nuclear matrix elements typical of the {beta} transition. In the three observed first forbidden cases: {sup 170}Tm, {sup 86}Rb, {sup 198}Au, these matrix elements do not confirm the independent shell model theory. Other hypotheses are then suggested and discussed. (author) [French] Les experiences de correlation angulaire {beta}{gamma} et l'etude du spectre {beta} conduisant au premier niveau excite du noyau final permettent de determiner les elements de matrices nucleaires caracteristiques de cette transition. Dans les trois cas etudies (transitions une fois interdites): {sup 170}Tm, {sup 86}Rb, {sup 198}Au, ces elements de matrices ne peuvent etre retrouves a l'aide du modele en couches et a particules independantes. D'autres hypotheses sont alors emises et discutees. (auteur)

  15. Sr{sub 1.98}Eu{sub 0.02}SiO{sub 4} luminescence whisker based on vapor-phase deposition: Facile synthesis, uniform morphology and enhanced luminescence properties

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Jian, E-mail: xujian@stu.xmu.edu.cn [Department of Materials Science and Engineering, Xiamen University, Xiamen 361005 (China); Hassan, Dhia A. [Department of Materials Science and Engineering, Xiamen University, Xiamen 361005 (China); Department of Chemistry, College of Education for Pure Science, University of Basrah, 61004 (Iraq); Zeng, Renjie; Peng, Dongliang [Department of Materials Science and Engineering, Xiamen University, Xiamen 361005 (China); Fujian Key Lab of Advanced Special Material, Xiamen University, Xiamen 361005 (China); Key Laboratory of High Performance Ceramic Fibers, Ministry of Education, Xiamen 361005 (China)

    2015-11-15

    Highlights: • For the first time, it is possible to obtain Sr{sub 1.98}Eu{sub 0.02}SiO{sub 4} whisker. • The whiskers are smooth and uniform with L/D ratio over 50. • Durability and thermal stability of the whisker are enhanced. - Abstract: A high performance strontium silicate phosphor has been successfully synthesized though a facile vapor-phase deposition method. The product consists of single crystal whiskers which are smooth and uniform, and with a sectional equivalent diameter of around 5 μm; the aspect ratio is over 50 and no agglomeration can be observed. X-ray diffraction result confirmed that the crystal structure of the whisker was α’-Sr{sub 2}SiO{sub 4}. The exact chemical composition was Sr{sub 1.98}Eu{sub 0.02}SiO{sub 4} which was analyzed by energy dispersive spectrometer and inductively coupled plasma-mass spectrometer. The whisker shows broad green emission with peak at 523 nm ranging from 470 to 600 nm (excited at 370 nm). Compared with traditional Sr{sub 2}SiO{sub 4}:Eu phosphor, durability (at 85% humidity and 85 °C) and thermal stability of the whisker are obviously improved. Moreover, growth mechanism of the Sr{sub 1.98}Eu{sub 0.02}SiO{sub 4} whiskers is Vapor–Liquid–Solid. On a macro-scale, the product is still powder which makes it suitable for the current packaging process of WLEDs.

  16. Validation of absolute axial neutron flux distribution calculations with MCNP with 197Au(n,γ)198Au reaction rate distribution measurements at the JSI TRIGA Mark II reactor.

    Science.gov (United States)

    Radulović, Vladimir; Štancar, Žiga; Snoj, Luka; Trkov, Andrej

    2014-02-01

    The calculation of axial neutron flux distributions with the MCNP code at the JSI TRIGA Mark II reactor has been validated with experimental measurements of the (197)Au(n,γ)(198)Au reaction rate. The calculated absolute reaction rate values, scaled according to the reactor power and corrected for the flux redistribution effect, are in good agreement with the experimental results. The effect of different cross-section libraries on the calculations has been investigated and shown to be minor. Copyright © 2013 Elsevier Ltd. All rights reserved.

  17. Features of the structural and magnetic properties of Pb(TixZr1–xO3-NiFe1.98Co0.02O4 in the polarized state

    Directory of Open Access Journals (Sweden)

    Baev Vadim

    2017-06-01

    Full Text Available Composites with a 90%Pb(TixZr1-xO3-10%NiFe1.98Co0.02O4 composition have been synthesized. It has been established that the polarization of samples resulting from exposure to an electric field for 1 hour of 4 kV/mm in strength at a temperature of 400 K leads to crystal structure deformation. The compression of elementary crystal cells in some areas during polarization of the sample creates conditions suitable for the enhancement of magnetic exchange interactions. It has been found that the polarization process of such compositions leads to increases in specific magnetization and magnetic susceptibility. The analysis of Mössbauer spectra has shown that the polarization of the 90%Pb(TixZr1-xO3-10%NiFe1.98Co0.02O4 composite leads to significant changes in the effective magnetic fields of iron subspectra in various positions.

  18. Structure of 19O from measurement and R-matrix analysis of sigma(theta) for 18O(n,n)18O and 18O(n,n')18Osup(*) (1.98 MeV)

    International Nuclear Information System (INIS)

    Koehler, P.E.; Knox, H.D.; Resler, D.A.; Lane, R.O.

    1986-01-01

    Differential cross sections for neutrons elastically scattered from 18 O and inelastically scattered to the first excited state 18 Osup(*) (1.98 MeV) have been measured at forty-two incident energies for 5.0 19 O of 8.7 to 11.1 MeV. The cross sections were measured at eleven laboratory angles per energy from 20 0 to 160 0 and show considerable resonance structure. These new elastic and inelastic 1.98 MeV level data have been analyzed together with previously published cross sections for 0 19 O. The new assignments are compared to previous work where possible. Several previous assignments for resonances in the 0 19 F for the newly assigned levels in 19 O. On the basis of spin, parity, excitation energy and a comparison of reduced neutron widths in 19 O with reduced proton widths in 19 F, six previously-identified T=3/2 analogs were verified and eight new T=3/2 analogs were tentatively assigned. Comparisons with existing theoretical work are discussed. (orig.)

  19. Basic residues in the 74-83 and 191-198 segments of protein kinase CK2 catalytic subunit are implicated in negative but not in positive regulation by the beta-subunit

    DEFF Research Database (Denmark)

    Sarno, S; Vaglio, P; Marin, O

    1997-01-01

    by the beta-subunit many fold more than that of alpha wild type, while extrastimulation by beta mutant D55L56E57A, observable with alpha wild type, is abolished with these mutants. These data support the conclusion that down regulation by the acidic residues clustered in the N-terminal moiety of beta...... is mediated by basic residues in the 74-83 and in the 191-198 sequences of the alpha-subunit. These are also implicated in substrate recognition consistent with the concept that the N-terminal acidic region of the beta subunit operates as a pseudosubstrate. In contrast, another CK2alpha mutant, V66A, is more...

  20. Thermal neutron calibration of a tritium extraction facility using the 6Li(n,t)4He/197Au(n,γ)198Au cross section ratio for standardization

    International Nuclear Information System (INIS)

    Bretscher, M.M.; Smith, D.L.

    1980-08-01

    Absolute tritium activities in a neutron-activated metallic lithium samples have been measured by liquid scintillation methods to provide data needed for the determination of capture-to-fission ratios in fast breeder reactor spectra and for recent measurements of the 7 Li(n,n't) 4 He cross section. The tritium extraction facility used for all these experiments has now been calibrated by measuring the 6 Li(n,t) 4 He/ 197 Au/n,γ) 198 Au activity ratio for thermal neutrons and comparing the result with the well-known cross sections. The calculated-to-measured activity ratio was found to be 1.033 +- 0.018. 2 figures, 20 tables

  1. Reference: 198 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available etion of either RIC4 or RIC3 causes tip growth defects that are rescued by overproduction or depletion...C4. RIC4 promotes F-actin assembly, whereas RIC3 activates Ca(2+) signaling that leads to F-actin disassembly. Overproduction or depl

  2. Page | 198 POLICE CORRUPTION AND ADMINISTRATION OF ...

    African Journals Online (AJOL)

    Fr. Ikenga

    2017-08-07

    Aug 7, 2017 ... government to finance and embark on policies that will develop this .... sometimes acted upon instruction of the superior police officer or officers. .... to Chief Magistrate Court by the Police then require the advice of the Director ...

  3. Publications | Page 198 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Access to water, time allocation and income in rural India (restricted access) ... in fetching water by both men and women, which in turn will lead to a reallocation of the ... Exploring inequalities in access to and use of maternal health services in ...

  4. 21 CFR 558.198 - Diclazuril.

    Science.gov (United States)

    2010-04-01

    ... health of birds challenged with E. maxima. Feed continuously. Not for use in hens producing eggs for... not feed to breeding turkeys. Not for use in hens producing eggs for human consumption. 016592 (ii) 0... FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS, FEEDS...

  5. Page | 198 POLICE CORRUPTION AND ADMINISTRATION OF ...

    African Journals Online (AJOL)

    Fr. Ikenga

    2017-08-07

    Aug 7, 2017 ... to be abused due to the influence of social evils such as corruption, favouritism, dishonesty, fraud, tribalism, ethnicity and even villagism. These social problems are not peculiar to the Nigeria Police alone. They are ..... At this stage, the suspect sometimes through his lawyer has to negotiate with the Police ...

  6. Publications | Page 198 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Access to water, time allocation and income in rural India (restricted access). In this paper we show that investments to improve the supply and management of water reduce the time spent in fetching water by both men and women, which in turn will lead to a reallocation of the time saved to productive activities, and result in ...

  7. Publications | Page 198 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Multi-faceted approach to promote knowledge translation platforms in eastern Mediterranean countries: climate for evidence-informed policy (open access). Objectives: Limited work has been done to promote knowledge translation (KT) in the Eastern Mediterranean Region (EMR). The objectives of this study are to: ...

  8. Preparation of radioactive colloidal gold 198Au

    International Nuclear Information System (INIS)

    Cammarosano, S.A.

    1979-01-01

    The preparation with simple equipment of radioactive colloidal gold of particle size about approximately 300 A from seed colloid stabilized by gelatine is described. Some physico-chemical parameters which can affect the process of formation of these colloidal particles are analysed; particle size has been meassured with an electron microscope. The colloid stability has been studied as a function of dilution, age and pH. Nucleation and growth of radioactive colloidal gold have been studied using spectrophotometry. Absorption spectra of the two ones are presented and compared. Quality control of the production process is verified through measurement of parameters, such as radioactive and radiochemical purity and biological distribution in laboratorial animals. This distribution was evalusted for rats injected endovenously with the gold colloidal solution.(Author) [pt

  9. Dietary carotenoid-rich oil supplementation improves exercise-induced anisocytosis in runners: influences of haptoglobin, MnSOD (Val9Ala), CAT (21A/T) and GPX1 (Pro198Leu) gene polymorphisms in dilutional pseudoanemia (sports anemia).

    Science.gov (United States)

    Miranda-Vilela, Ana L; Akimoto, Arthur K; Alves, Penha C Z; Pereira, Luiz C S; Klautau-Guimarães, Maria N; Grisolia, Cesar K

    2010-04-01

    Physical training induces beneficial adaptation, whereas exhaustive exercises increase reactive oxygen-species generation, thereby causing oxidative damage in plasma and erythrocytes, fractions susceptible to lipid peroxidation. Pequi (Caryocar brasiliense Camb.) is a Brazilian Cerrado fruit containing a carotenoid-rich oil. The aim was to investigate the effects of pequi-oil on exercise-induced oxidative damage in plasma and erythrocytes, after running in the same environment and undergoing weekly training under the same conditions as to type, intensity and length. Evaluations were accomplished after outdoor running on flat land before and after ingestion of 400 mg pequi-oil capsules for 14 days. Blood samples were taken after running and submitted to TBARS assay and erythrogram analysis. Haptoglobin, MnSOD (Val9Ala), CAT (21A/T) and GPX1 (Pro198Leu) gene polymorphisms were priorly investigated, so as to estimate genetic influence The reduction in erythrocytes, hemoglobin and hematocrit after pequi-oil treatment was notably associated with higher plasma expansion. Except for MCHC (mean corpuscular hemoglobin concentration) and RDW (red cell distribution width), the results were influenced by the polymorphisms studied. The best response to pequi-oil was presented by MnSOD Val/Val, CAT AA or AT genotypes and the GPX1 Pro allele. The significantly lower RDW and higher MHCH values were related to pequi-oil protective effects. Pequi oil, besides possessing other nutritional properties, showed protective blood effects.

  10. Dietary carotenoid-rich oil supplementation improves exercise-induced anisocytosis in runners: influences of haptoglobin, MnSOD (Val9Ala, CAT (21A/T and GPX1 (Pro198Leu gene polymorphisms in dilutional pseudoanemia ("sports anemia"

    Directory of Open Access Journals (Sweden)

    Ana L. Miranda-Vilela

    2010-01-01

    Full Text Available Physical training induces beneficial adaptation, whereas exhaustive exercises increase reactive oxygen-species generation, thereby causing oxidative damage in plasma and erythrocytes, fractions susceptible to lipid peroxidation. Pequi (Caryocar brasiliense Camb. is a Brazilian Cerrado fruit containing a carotenoid-rich oil. The aim was to investigate the effects of pequi-oil on exercise-induced oxidative damage in plasma and erythrocytes, after running in the same environment and undergoing weekly training under the same conditions as to type, intensity and length. Evaluations were accomplished after outdoor running on flat land before and after ingestion of 400 mg pequi-oil capsules for 14 days. Blood samples were taken after running and submitted to TBARS assay and erythrogram analysis. Haptoglobin, MnSOD (Val9Ala, CAT (21A/T and GPX1 (Pro198Leu gene polymorphisms were priorly investigated, so as to estimate genetic influence The reduction in erythrocytes, hemoglobin and hematocrit after pequi-oil treatment was notably associated with higher plasma expansion. Except for MCHC (mean corpuscular hemoglobin concentration and RDW (red cell distribution width, the results were influenced by the polymorphisms studied. The best response to pequi-oil was presented by MnSOD Val/Val, CAT AA or AT genotypes and the GPX1 Pro allele. The significantly lower RDW and higher MHCH values were related to pequi-oil protective effects. Pequi oil, besides possessing other nutritional properties, showed protective blood effects.

  11. Study of the potentiometric response of the doped spinel Li1.05Al0.02Mn1.98O4 for the optimization of a selective lithium ion sensor

    International Nuclear Information System (INIS)

    Freitas, Bruno H.; Amaral, Fabio A.; Bocchi, Nerilso; Teixeira, Marcos F.S.

    2010-01-01

    In this paper, we studied the development of a selective lithium ion sensor constituted of a carbon paste electrode modified (CPEM) with an aluminum-doped spinel-type manganese oxide (Li 1.05 Al 0.02 Mn 1.98 O 4 ) for investigating the influence of a doping ion in the sensor response. Experimental parameters, such as influence of the lithium concentration in the activation of the sensor by cyclic voltammetry, pH of the carrier solution and selectivity for Li + against other alkali and alkaline-earth ions were investigated. The sensor response to lithium ions was linear in the concentration range 5.62 x 10 -5 to 1.62 x 10 -3 mol L -1 with a slope 100.1 mV/decade over a wide pH 10 (Tris buffer) and detection limit of 2.75 x 10 -5 mol L -1 , without interference of other alkali and alkaline-earth metals, demonstrating that the Al 3+ doping increases the structure stability and improves the potentiometric response and sensitivity of the sensor. The super-Nernstian response of the sensor in pH 10 can be explained by mixed potential arising from two equilibria (redox and ion-exchange) in the spinel-type manganese oxide.

  12. Systematic continuum-discretized coupled-channels calculations of total fusion for 6Li with targets 28Si, 59Co, 96Zr, 198Pt, and 209Bi: Effect of resonance states

    Science.gov (United States)

    Gómez Camacho, A.; Wang, Bing; Zhang, H. Q.

    2018-05-01

    Continuum discretized coupled-channel (CDCC) calculations of total fusion cross sections for reactions induced by the weakly bound nucleus 6Li with targets 28Si, 59Co, 96Zr, 198Pt, and 209Bi at energies around the Coulomb barrier are presented. In the cluster structure frame of 6Li→α +d , short-range absorption potentials are considered for the interactions between the α and d fragments with the targets. The effect of resonance (l =2 , Jπ=3+,2+,1+ ) and nonresonance states of 6Li on fusion is studied by using two approaches: (1) by omitting the resonance states from the full discretized CDCC breakup space and (2) by considering only the resonance subspace. A systematic analysis of the effect on fusion from resonance breakup couplings is carried out from light to heavy mass targets. Among other things, it is found that resonance breakup states produce strong repulsive polarization potentials that lead to fusion suppression. Couplings from nonresonance states give place to weak repulsive potentials at high energies; however, these become attractive for the heavier targets at low energies.

  13. A compact sup 3 H(p,gamma) sup 4 He 19.8 MeV gamma-ray source for energy calibration at the Sudbury Neutrino Observatory

    CERN Document Server

    Poon, A W P; Waltham, C E; Browne, M C; Robertson, R G H; Kherani, N P; Mak, H B

    2000-01-01

    The Sudbury Neutrino Observatory (SNO) is a new 1000-t D sub 2 O Cherenkov solar neutrino detector. A high-energy gamma-ray source is needed to calibrate SNO beyond the sup 8 B solar neutrino endpoint of 15 MeV. This paper describes the design and construction of a source that generates 19.8 MeV gamma rays using the sup 3 H(p,gamma) sup 4 He reaction (''pT''), and demonstrates that the source meets all the physical, operational and lifetime requirements for calibrating SNO. An ion source was built into this unit to generate and to accelerate protons up to 30 keV, and a high-purity scandium tritide target with a scandium-tritium atomic ratio of 1 : 2.0+-0.2 was included. This pT source is the first self-contained, compact, and portable high-energy gamma-ray source (E subgamma>10 MeV). (authors)

  14. Study of the potentiometric properties of spinel-type manganese oxide doped with gallium and anions Ga0.02Mn1.98O3.98X0.02 (X = S2− and F−) as selective sensor for lithium ion

    International Nuclear Information System (INIS)

    David-Parra, Diego N.; Bocchi, Nerilso; Teixeira, Marcos F.S.

    2015-01-01

    Highlights: • Investigated the influence of doping agents on the potentiometric response • Reduction of the unit cell size affected directly in the potentiometric performance of the electrode • Sensor performance increased in the order: Ga 0.02 Mn 1.98 O 4 > Ga 0.02 Mn 1.98 O 3.98 S 0.02 > Ga 0.02 Mn 1.98 O 3.98 F 0.02 . - Abstract: This paper describes the development of a selective lithium ion sensor based on spinel-type manganese oxide doped with gallium and anions (Ga 0.02 Mn 1.98 O 3.98 X 0.02 , where X = S 2− and F − ). Investigation was made of the influence of cationic and/or anionic doping agents on the potentiometric response of the sensor. Experimental parameters evaluated included the effect of the lithium concentration on activation of the sensor by cyclic voltammetry, the pH of the electrolyte solution, and the selectivity towards Li + compared to other alkali and alkaline-earth metal ions. There was an important influence of the unit cell size of the material on the linear range, detection limit, and selectivity of the sensor. Reduction in the size of the tunnel for insertion of the lithium in the porous structure of the oxide directly affected the potentiometric performance of the electrode. Sensor performance increased in the order: Ga 0.02 Mn 1.98 O 4 > Ga 0.02 Mn 1.98 O 3.98 S 0.02 > Ga 0.02 Mn 1.98 O 3.98 F 0.02 . The observed super-Nernstian response could be explained by a mixed potential arising from two equilibria (redox and ion exchange) in the spinel-type manganese oxide. Sensitivity and the influence of pH on the electrode response were directly related to the doping agents present in the oxide structure

  15. Assessment of letrozole and tamoxifen alone and in sequence for postmenopausal women with steroid hormone receptor-positive breast cancer: the BIG 1-98 randomised clinical trial at 8·1 years median follow-up.

    Science.gov (United States)

    Regan, Meredith M; Neven, Patrick; Giobbie-Hurder, Anita; Goldhirsch, Aron; Ejlertsen, Bent; Mauriac, Louis; Forbes, John F; Smith, Ian; Láng, István; Wardley, Andrew; Rabaglio, Manuela; Price, Karen N; Gelber, Richard D; Coates, Alan S; Thürlimann, Beat

    2011-11-01

    Postmenopausal women with hormone receptor-positive early breast cancer have persistent, long-term risk of breast-cancer recurrence and death. Therefore, trials assessing endocrine therapies for this patient population need extended follow-up. We present an update of efficacy outcomes in the Breast International Group (BIG) 1-98 study at 8·1 years median follow-up. BIG 1-98 is a randomised, phase 3, double-blind trial of postmenopausal women with hormone receptor-positive early breast cancer that compares 5 years of tamoxifen or letrozole monotherapy, or sequential treatment with 2 years of one of these drugs followed by 3 years of the other. Randomisation was done with permuted blocks, and stratified according to the two-arm or four-arm randomisation option, participating institution, and chemotherapy use. Patients, investigators, data managers, and medical reviewers were masked. The primary efficacy endpoint was disease-free survival (events were invasive breast cancer relapse, second primaries [contralateral breast and non-breast], or death without previous cancer event). Secondary endpoints were overall survival, distant recurrence-free interval (DRFI), and breast cancer-free interval (BCFI). The monotherapy comparison included patients randomly assigned to tamoxifen or letrozole for 5 years. In 2005, after a significant disease-free survival benefit was reported for letrozole as compared with tamoxifen, a protocol amendment facilitated the crossover to letrozole of patients who were still receiving tamoxifen alone; Cox models and Kaplan-Meier estimates with inverse probability of censoring weighting (IPCW) are used to account for selective crossover to letrozole of patients (n=619) in the tamoxifen arm. Comparison of sequential treatments to letrozole monotherapy included patients enrolled and randomly assigned to letrozole for 5 years, letrozole for 2 years followed by tamoxifen for 3 years, or tamoxifen for 2 years followed by letrozole for 3 years

  16. HER2 status predicts for upfront AI benefit: A TRANS-AIOG meta-analysis of 12,129 patients from ATAC, BIG 1-98 and TEAM with centrally determined HER2.

    Science.gov (United States)

    Bartlett, John M S; Ahmed, Ikhlaaq; Regan, Meredith M; Sestak, Ivana; Mallon, Elizabeth A; Dell'Orto, Patrizia; Thürlimann, Beat; Seynaeve, Caroline; Putter, Hein; Van de Velde, Cornelis J H; Brookes, Cassandra L; Forbes, John F; Viale, Giuseppe; Cuzick, Jack; Dowsett, Mitchell; Rea, Daniel W

    2017-07-01

    A meta-analysis of the effects of HER2 status, specifically within the first 2-3 years of adjuvant endocrine therapy, has the potential to inform patient selection for upfront aromatase inhibitor (AI) therapy or switching strategy tamoxifen followed by AI. The pre-existing standardisation of methodology for HER2 (immunohistochemistry/fluorescence in situ hybridization) facilitates analysis of existing data for this key marker. Following a prospectively designed statistical analysis plan, patient data from 3 phase III trials Arimidex, Tamoxifen, Alone or in Combination Trial (ATAC), Breast International Group (BIG) 1-98 and Tamoxifen Exemestane Adjuvant Multicentre Trial (TEAM)] comparing an AI to tamoxifen during the first 2-3 years of adjuvant endocrine treatment were collected and a treatment-by-marker analysis of distant recurrence-free interval-censored at 2-3 years treatment - for HER2 status × AI versus tamoxifen treatment was performed to address the clinical question relating to efficacy of 'upfront' versus 'switch' strategies for AIs. A prospectively planned, patient-level data meta-analysis across 3 trials demonstrated a significant treatment (AI versus tamoxifen) by marker (HER2) interaction in a multivariate analysis; (interaction hazard ratio [HR] = 1.61, 95% CI 1.01-2.57; p data meta-analysis demonstrated a significant interaction between HER2 status and treatment with AI versus tamoxifen in the first 2-3 years of adjuvant endocrine therapy. Patients with HER2-ve cancers experienced improved outcomes (distant relapse) when treated with upfront AI rather than tamoxifen, whilst patients with HER2+ve cancers fared no better or slightly worse in the first 2-3 years. However, the small number of HER2+ve cancers/events may explain a large degree of heterogeneity in the HER2+ve groups across all 3 trials. Other causes, perhaps related to subtle differences between AIs, cannot be excluded and warrant further exploration. Copyright © 2017 Elsevier Ltd

  17. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  18. Reaction of aromatic diazonium salts with carrier-free radioiodine and astatine, evidence for complex formation

    International Nuclear Information System (INIS)

    Meyer, G.J.; Roessler, K.; Stoecklin, G.

    1979-01-01

    Systematic studies of the astatodiazoniation reaction and a comparison with iododediazoniation under comparable conditions are reported. The yields for all astatohalobenzenes and -toluenes were nearly constant and unaffected by the nature of the diazonium compound, its isomeric form, and the number of isomers used at the same time. Only astatofluorobenzenes were obtained at higher yields. An electron-transfer mechanism is proposed for dediazoniation at these low halide concentration levels. At sufficient thermal excitation levels the electron transfer leads to the dissociation of nitrogen, while the phenyl and halogen radicals recombine. The isomer distribution found for some of the derivatives from dediazoniation may also be due to steric effects

  19. Astatine-211-labeled biotin conjugates resistant to biotinidase for use in pretargeted radioimmunotherapy

    International Nuclear Information System (INIS)

    Foulon, Catherine F.; Alston, Kevin L.; Zalutsky, Michael R.

    1998-01-01

    We report herein the preparation and biological evaluation of two radioastatinated biotin conjugates, (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide. Both conjugates were stable in the presence of human serum and cerebrospinal fluid as well as murine serum, indicating a resistance to degradation to biotinidase. The normal tissue clearance of (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide was rapid, as observed previously with their iodo analogues. Also reported are the first syntheses of N-succinimidyl 5-[ 211 At]astato-3-pyridinecarboxylate and 3-[ 211 At]astatoaniline, two reagents of potential utility for labeling proteins and peptides with 211 At

  20. Microdosimetry of astatine-211 and comparison with that of iodine-125

    International Nuclear Information System (INIS)

    Unak, T.

    2001-01-01

    211 At is an alpha and Auger emitter radionuclide and has been frequently used for labeling of different kind of chemical agents. 125 I is also known as an effective Auger emitter. The radionuclides which emit short range and high LET radiations such as alpha particles and Auger electrons have high radiotoxic effectiveness on the living systems. The microdosimetric data are suitable to clarify the real radiotoxic effectiveness and to get the detail of diagnostic and therapeutic application principles of these radionuclides. In this study, the energy and dose absorptions by cell nucleus from alpha particles and Auger electrons emitted by 211 At have been calculated using a Monte Carlo calculation program (code: UNMOC). For these calculations two different model corresponding to the cell nucleus have been used and the data obtained were compared with the data earlier obtained for 125 I. As a result, the radiotoxicity of 211 At is in the competition with 125 I. In the case of a specific agent labelled with 211 At or 125 I is incorporated into the cell or cell nucleus, but non-bound to DNA or not found very close to it, 211 At should considerably be much more radiotoxic than 125 I, but in the case of the labelled agent is bound to DNA or take a place very close to it, the radiotoxicity of 125 I should considerably be higher than 211 At. (author)

  1. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-211 Isolation

    International Nuclear Information System (INIS)

    Wilbur, Daniel Scott

    2016-01-01

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O'Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211 At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211 At capture (>95%) from 8M HCl solutions and release with conc. NH 4 OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211 At when loading [ 211 At]astatate appeared to be similar to that of [ 211 At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211 At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO 3 , but higher capture rates (e.g. 99%) can be obtained when 10M HNO 3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211 At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211 At isolation studies have been conducted with full-scale target dissolution and 211 At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO 3 was used (rather than HCl) for loading the 211 At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211 At separation from bismuth, which allow use of HNO 3 /HCl mixtures for loading and NaOH for eluting 211 At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  2. The potential of 211Astatine for NIS-mediated radionuclide therapy in prostate cancer

    International Nuclear Information System (INIS)

    Willhauck, Michael J.; Sharif Samani, Bibi-Rana; Goeke, Burkhard; Wolf, Ingo; Senekowitsch-Schmidtke, Reingard; Stark, Hans-Juergen; Meyer, Geerd J.; Knapp, Wolfram H.; Morris, John C.; Spitzweg, Christine

    2008-01-01

    We reported recently the induction of selective iodide uptake in prostate cancer cells (LNCaP) by prostate-specific antigen (PSA) promoter-directed sodium iodide symporter (NIS) expression that allowed a significant therapeutic effect of 131 I. In the current study, we studied the potential of the high-energy alpha-emitter 211 At, also transported by NIS, as an alternative radionuclide after NIS gene transfer in tumors with limited therapeutic efficacy of 131 I due to rapid iodide efflux. We investigated uptake and therapeutic efficacy of 211 At in LNCaP cells stably expressing NIS under the control of the PSA promoter (NP-1) in vitro and in vivo. NP-1 cells concentrated 211 At in a perchlorate-sensitive manner, which allowed a dramatic therapeutic effect in vitro. After intrapertoneal injection of 211 At (1 MBq), NP-1 tumors accumulated approximately 16% ID/g 211 At (effective half-life 4.6 h), which resulted in a tumor-absorbed dose of 1,580 ± 345 mGy/MBq and a significant tumor volume reduction of up to 82 ± 19%, while control tumors continued their growth exponentially. A significant therapeutic effect of 211 At has been demonstrated in prostate cancer after PSA promoter-directed NIS gene transfer in vitro and in vivo suggesting a potential role for 211 At as an attractive alternative radioisotope for NIS-targeted radionuclide therapy, in particular in smaller tumors with limited radionuclide retention time. (orig.)

  3. Sci-Thur AM: YIS – 01: New technologies for astatine-211 targeted alpha therapy research

    Energy Technology Data Exchange (ETDEWEB)

    Crawford, Jason; Yang, Hua; Schaffer, Paul; Ruth, Thomas [University of Victoria, Victoria, BC (Canada); TRIUMF, Vancouver, BC (Canada)

    2016-08-15

    Purpose: The short-range, densely ionizing α-particles emitted by {sup 211}At (t{sub 1/2}=7.2h) are well suited for the treatment of diffuse microscopic disease, using cancer targeting biomolecules. {sup 211}At availability is limited by the rarity of α-cyclotrons required for standard production. Image-based dosimetry is also limited for {sup 211}At, which emits low intensity X-rays. Our goal was to leverage state-of-the-art infrastructure at TRIUMF to produce and evaluate two related isotopes, {sup 211}Rn (t{sub 1/2}=14.6h, 73% decay to {sup 211}At) as a generator for {sup 211}At, and {sup 209}At (t{sub 1/2}=5.4h, X-ray/gamma-ray emitter) as a novel 211At surrogate for preclinical imaging studies. Methods: Produced by spallation of uranium with 480 MeV protons, mass separated ion beams of short-lived francium isotopes were implanted into NaCl targets where {sup 211}Rn or {sup 209}At were produced by radioactive decay, in situ. {sup 211}Rn was transferred to dodecane from which {sup 211}At was efficiently extracted and evaluated for clinical applicability. High energy SPECT/CT was evaluated for measuring {sup 209}At activity distributions in mice and phantoms. Results: Our small scale {sup 211}Rn/{sup 211}At generator system provided high purity {sup 211}At samples. The methods are immediately scalable to the level of radioactivity required for in vivo experiments with {sup 211}At. {sup 209}At-based high energy SPECT imaging was determined suitable for pursuing image-based dosimetry in mouse tumour models. In the future, we will utilize quantitative {sup 209}At-SPECT for image-based dose calculations. Conclusion: These early studies provided a foundation for future endeavours with {sup 211}At-based α-therapy. Canada is now significantly closer to clinical targeted α-therapy of cancer.

  4. Targeted radionuclide therapy with astatine-211: Oxidative dehalogenation of astatobenzoate conjugates.

    Science.gov (United States)

    Teze, David; Sergentu, Dumitru-Claudiu; Kalichuk, Valentina; Barbet, Jacques; Deniaud, David; Galland, Nicolas; Maurice, Rémi; Montavon, Gilles

    2017-05-31

    211 At is a most promising radionuclide for targeted alpha therapy. However, its limited availability and poorly known basic chemistry hamper its use. Based on the analogy with iodine, labelling is performed via astatobenzoate conjugates, but in vivo deastatination occurs, particularly when the conjugates are internalized in cells. Actually, the chemical or biological mechanism responsible for deastatination is unknown. In this work, we show that the C-At "organometalloid" bond can be cleaved by oxidative dehalogenation induced by oxidants such as permanganates, peroxides or hydroxyl radicals. Quantum mechanical calculations demonstrate that astatobenzoates are more sensitive to oxidation than iodobenzoates, and the oxidative deastatination rate is estimated to be about 6 × 10 6 faster at 37 °C than the oxidative deiodination one. Therefore, we attribute the "internal" deastatination mechanism to oxidative dehalogenation in biological compartments, in particular lysosomes.

  5. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  6. Use of interhalogen exchange for preparation of astatine-benzene and iodo-benzene

    International Nuclear Information System (INIS)

    Kolachkovski, A.; Khalkin, V.A.

    1976-01-01

    Experimental testing of interhalogen exchange between the solid and liquid phases has been carried out at 155 deg C with particular reference to a NaOH-Na 131 I-BrPh system. Iodine transition rate is dependent on the process duration and alkali amount. The relative amounts of 131 IPh resultant from the reaction of interhalogen exchange is evaluated by paper chromatography. The results obtained may be considered as those which provide experimental support for the assumed efficiency of the production of 131 IPh based on the reaction of interhalogen exchange to yield 70-80% 131 IPh

  7. Preparation and evaluation of an astatine-211-labeled sigma receptor ligand for alpha radionuclide therapy

    International Nuclear Information System (INIS)

    Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira

    2015-01-01

    Introduction: Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated 131 I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[ 131 I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[ 131 I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[ 211 At]pAtV, an 211 At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. Methods: The radiolabeled sigma receptor ligand (+)-[ 211 At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[ 211 At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. Results: The lipophilicity of (+)-[ 211 At]pAtV was similar to that of (+)-[ 125 I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1 h post-injection were also similar between (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV. Namely, (+)-[ 211 At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. Conclusion: These results indicate that (+)-[ 211 At]pAtV could function as an new agent for alpha-radionuclide receptor therapy.

  8. Preparation and evaluation of an astatine-211-labeled sigma receptor ligand for alpha radionuclide therapy.

    Science.gov (United States)

    Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira

    2015-11-01

    Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated (131)I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[(131)I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[(131)I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[(211)At]pAtV, an (211)At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. The radiolabeled sigma receptor ligand (+)-[(211)At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[(211)At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[(211)At]pAtV and (+)-[(125)I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. The lipophilicity of (+)-[(211)At]pAtV was similar to that of (+)-[(125)I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1h post-injection were also similar between (+)-[(211)At]pAtV and (+)-[(125)I]pIV. Namely, (+)-[(211)At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. These results indicate that (+)-[(211)At]pAtV could function as an new agent for alpha-radionuclide receptor therapy. Copyright © 2015 Elsevier Inc. All rights reserved.

  9. Suppression of hepatic hematopoiesis with radioactive gold (198Au)

    International Nuclear Information System (INIS)

    Turner, A.R.; Gummerman, L.W.; Boggs, D.R.

    1985-01-01

    A patient with idiopathic myelofibrosis of some 20 yr duration developed esophageal varices and ascites. No explanation for increased portal pressure other than hepatic hematopoiesis was found. Consequently, a trial of cobalt irradiation to the liver was undertaken with definite but transient decrease in ascites. Subsequently, two courses of radioactive colloidal gold were given, again with definite but transient beneficial effects on the degree of ascites. This latter benefit occurred without suppression of marrow function

  10. Southern Forests: a Journal of Forest Science - Vol 198 (2003)

    African Journals Online (AJOL)

    Reverting urban exotic pine forests to Macchia and indigenous forest vegetation, using cable-yarders on the slopes of Table Mountain, South Africa: management paper · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Pierre Ackerman, Bruce Talbot, 35-44 ...

  11. Results of 198Au-colloid radiosynovectomy in rheumatoid arthritis

    International Nuclear Information System (INIS)

    Drozdovski, B.Ya.; Ikonnikov, A.I.

    1989-01-01

    260 patients with rheumatoid arthritis received injections of colloidal radiogold into their affected joints. The findings of radiosynoviorthesis were analysed in 210 patients. The therapeutic effect developed gradually. The best clinical results were found to occur after 12th month. At the end of the 2nd year 47% of the patients revealed a significant improvement, 38% an improvement and 15% of the patients involved showed no therapeutic effect. Good results were obtained with patients of the roentgenological stage I and II and the disease (70%). (author)

  12. 38 CFR 21.198 - “Discontinued” status.

    Science.gov (United States)

    2010-07-01

    ... discontinued status following assignment to interrupted status as provided in § 21.197 for reasons including... acceptable reason for his or her failure to do so following assignment to interrupted status, the veteran's... staff are unable to estimate an approximate date by which the veteran will be able to begin or return to...

  13. 30 CFR 250.198 - Documents incorporated by reference.

    Science.gov (United States)

    2010-07-01

    ... Gravity), or API Gravity of Crude Petroleum and Liquid Petroleum Products by Hydrometer Method, Second... Density or Relative Density of Light Hydrocarbons by Pressure Hydrometer, Second Edition, March 2003...

  14. 19 CFR 10.198 - Evidence of country of origin.

    Science.gov (United States)

    2010-04-01

    ... the growth, product, or manufacture of a beneficiary country—(i) Declaration. In a case involving an article covered by a formal entry which is not wholly the growth, product, or manufacture of a single... for good cause shown. Failure to submit the declaration in a timely fashion will result in a denial of...

  15. 198 A Critical Analysis of Dramaturgy and Theatricality in Okwe ...

    African Journals Online (AJOL)

    RESOURCE CENTRE

    having the stage and theatre audience in mind. Consequently .... observed that some scholars use formalism and new criticism ..... could be seen in the work under review, he or she can conclude that ... A character may be a person or an animal in a book, play, or film .... Literature, New York: Norton & Company. Dobie, A. B. ...

  16. South Asia | Page 198 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The stories presented in Success Stories in Asian Aquaculture reflect the unique nature of Asian aquaculture, providing first-time insight into how and why it has become so successful. Overall, the book demonstrates how the resiliency, adaptability, and innovation of small-scale aquaculture farmers have been crucial to this ...

  17. 33_198 - 203 -Nas et al.,_PHYTOCHEMICAL SCREENING

    African Journals Online (AJOL)

    user pc

    2017-12-02

    Dec 2, 2017 ... alkaloids, tannins, saponins, phenolic compoun. (Cowan, 1999). ... actericidal Concentration (MBC) of the extracts ranges from 12.5 cts. ... l activity, Garcinia kola, Methicillin Resistant Staphylococcus aure lants lie in ..... antioxidant, antiviral, antidiabetic and anti-hepatotoxic activities ... beer brewing. World.

  18. 14 CFR 198.5 - Types of insurance coverage available.

    Science.gov (United States)

    2010-01-01

    ... transported, on the aircraft referred to in paragraph (a) of this section. (e) Statutory or contractual obligations, or any other liability, of the aircraft referred to in paragraph (a) of this section or of its...

  19. All projects related to | Page 198 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: LATIN AMERICA, POLICY MAKING, AFRICA SOUTH OF SAHARA, SOCIAL INEQUALITY, ASIA, Poverty alleviation. Region: North and Central America, South America, Chile. Program: Agriculture and Food Security. Total Funding: CA$ 5,065,900.00. RIMISP: Core Support for Rural Development Research Phase 2.

  20. 211 At-labeled agents for alpha-immunotherapy: On the in vivo stability of astatine-agent bonds

    OpenAIRE

    Ayed , Tahra ,; Pilmé , Julien; Tézé , David; Bassal , Fadel ,; Barbet , Jacques ,; Chérel , Michel; Champion , Julie ,; Maurice , Rémi; Montavon , Gilles ,; Galland , Nicolas ,

    2016-01-01

    International audience; The application of 211 At to targeted cancer therapy is currently hindered by the rapid deastatination that occurs in vivo. As the deastatination mechanism is unknown, we tackled this issue from the viewpoint of the intrinsic properties of At-involving chemical bonds. An apparent correlation has been evidenced between in vivo stability of 211 At-labeled compounds and the AtÀR (R ¼ C, B) bond enthalpies obtained from relativistic quantum mechanical calculations. Further...

  1. Preparation and biological evaluation of an astatine-211 labeled biotin conjugate: Biotinyl-3-[211At]astatoanilide

    International Nuclear Information System (INIS)

    Foulon, Catherine F.; Schoultz, Bent W.; Zalutsky, Michael R.

    1997-01-01

    Biotinyl-3-[ 211 At]astatoanilide ([ 211 At]AtBA) was prepared in more than 80% yield by destannylation. In vitro, [ 211 At]AtBA exhibited a high affinity for streptavidin, and was stable after incubation in human serum, cerebrospinal fluid and distilled water, whereas it was rapidly degraded in mouse serum. HPLC analysis showed that the main degradation pathway in mouse serum was the cleavage of [ 211 At]astatoaniline. In mice, [ 211 At]AtBA and its 125 I-labeled analogue cleared rapidly from most tissues; however, there was some evidence for dehalogenation of both tracers

  2. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  3. Inactivation of human osteosarcoma cells in vitro by 211At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    International Nuclear Information System (INIS)

    Larsen, R.H.; Bruland, O.S.; Hoff, P.; Alstad, J.; Lindmo, T.; Rofstad, E.K.

    1994-01-01

    The potential usefulness of α-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) 211 At-TP-3 of different specific activities, (b) 211 At-labeled bovine serum albumin (BSA), (c) free 211 At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, 211 At-BSA or free 211 At. The D o 's were lower for free 211 At than for 211 At-BSA. The survival curves for 211 At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to 211 At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to 211 At-TP-3 treatment was the antigen expression. Cell inactivation after 211 At-TP-3 treatment increased substantially with increasing specific activity of the 211 At-TP-3. At high specific activities, the cytotoxic effect of 211 At-TP-3 was significantly higher than that of 211 At-BSA. In conclusion, 211 At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs

  4. People and things. CERN Courier, Nov 1979, v. 19(8)

    International Nuclear Information System (INIS)

    Anon.

    1979-01-01

    The article covers the celebration of the 'Journée du Personnel' (Staff Day), where over 3000 CERN staff turned up to enjoy various attractions like games, sports, sideshows, competitions, films, music and entertainment, and dancing that went on into the small hours. One highlight was the playing of 'Happy Birthday, CERN — From Fermi lab', recorded at Fermi lab. In other news, the article reports on various people, staff changes within the CERN organization and recent news updates

  5. The M198 Howitzer as a Direct Support Weapon during Amphibious Operations.

    Science.gov (United States)

    1980-06-06

    critical to the success of f:;ture amphibio ..s ot.er-.tions. Purpose of the Study, The purpose of this study is to determine the imrpact of the ,19 ’s...principle amphibio ;- shies lift capatilities and physical characte-istics indic -tcs thir flexibility a ,d speed, or lack tnhreof, in d::>.rking large

  6. FCJ-198 New International Information Order (NIIO Revisited: Global Algorithmic Governance and Neocolonialism

    Directory of Open Access Journals (Sweden)

    Danny Butt

    2016-03-01

    Full Text Available The field of Internet governance has been dominated by Euro-American actors and has largely resisted consideration of a holistic and integrative rights-based agenda, confining itself to narrow discussions on the technical stability of Internet Protocol resources and debates about nation-state involvement in multistakeholder governance of those resources. In light of the work of Edward Snowden documenting the close relationship between government security agencies and dominant social media platforms, this paper revisits the relevance of the New International Information Order (NIIO, a conceptualisation of the global politics of information described at the 1973 Fourth Summit Conference of the Non-Aligned Movement of nations in Algiers. This paper argues that critical analysis of the oligopolistic structure of “platforms” and their algorithmic forms of governance can build a more inclusive movement toward social justice by extending the NIIO framework’s emphasis on decolonisation, collective ownership of strategic information resources, and documentation of powerful transnational entities.

  7. Leonurine (SCM-198) improves cardiac recovery in rat during chronic infarction.

    Science.gov (United States)

    Liu, XinHua; Pan, LiLong; Gong, QiHai; Zhu, YiZhun

    2010-12-15

    Leonurine, an alkaloid typically found in Herba leonuri, is known to have both antioxidant and cardioprotective properties. In the present study, we investigated the cardioprotective mechanism of leonurine the in vivo rat model of chronic myocardial ischemia and in vitro H9c2 cardiac myocyte model of oxidative stress. Myocardial ischemia was induced by ligating the left anterior descending coronary artery. Rats were divided into sham, myocardial ischemia+saline, and myocardial ischemia+leonurine (15 mg/kg/day). Cardiac function was recorded by catheterization. Apoptosis-related factor vascular endothelial growth factor (VEGF), survivin, Bcl-2 and Bax and pro-survival signaling pathways Akt, hypoxia inducible factor (HIF)-1α were measured by Western blotting or RT-PCR. Our results showed leonurine significantly improved myocardial function as evidenced by the decreased left ventricle end-diastolic pressure and the increased +dP/dt. Interestingly, leonurine increased the phosphorylation of Akt, the protein and gene expression of Bcl-2, but it reduced the protein and gene expression of Bax in vivo. Meanwhile leonurine significantly increased Akt phosphorylation in a concentration-dependent manner in H9c2 cardiac myocyte induced by oxidative stress in vitro, which was abolished by a phosphoinositide 3-kinase (PI3K) inhibitor, LY294002. Furthermore, leonurine not only increased the expression of HIF-1α but also the expression of survivin and VEGF. The results of present study demonstrated, for the first time that leonurine has potent anti-apoptotic effects after chronic myocardial ischemia mediated by activating the PI3K/Akt signaling pathway. Angiogenic mechanisms may be partially responsible for such an effect, which needs to be studied further. Copyright © 2010 Elsevier B.V. All rights reserved.

  8. Leonurine (SCM-198) attenuates myocardial fibrotic response via inhibition of NADPH oxidase 4.

    Science.gov (United States)

    Liu, Xin-Hua; Pan, Li-Long; Deng, Hai-Yan; Xiong, Qing-Hui; Wu, Dan; Huang, Guo-Ying; Gong, Qi-Hai; Zhu, Yi-Zhun

    2013-01-01

    In our previous studies, we have reported that leonurine, a plant phenolic alkaloid in Herba leonuri, exerted cardioprotective properties in a number of preclinical experiments. Herein, we investigated the roles and the possible mechanisms of leonurine for reducing fibrotic responses in angiotensin II (Ang II)-stimulated primary neonatal rat cardiac fibroblasts and post-myocardial infarction (MI) rats. In in vitro experiments performed in neonatal rat cardiac fibroblasts, leonurine (10-20 μM) pretreatment attenuated Ang II-induced activation of extracellular signal-regulated kinase 1/2, production of intracellular reactive oxygen species (ROS), expression and activity of matrix metalloproteinase (MMP)-2/9, and expression of α-smooth muscle actin and types I and III collagen. A small interfering RNA-mediated knockdown strategy for NADPH oxidase 4 (Nox4) revealed that Nox4 was required for Ang II-induced activation of cardiac fibroblasts. In vivo studies using a post-MI model in rats indicated that administration of leonurine inhibited myocardial fibrosis while reducing cardiac Nox4 expression, ROS production, NF-κB activation, and plasma MMP-2 activity. In conclusion, our results provide the first evidence that leonurine could prevent cardiac fibrosis and the activation of cardiac fibroblasts partly through modulation of a Nox4-ROS pathway. Copyright © 2012 Elsevier Inc. All rights reserved.

  9. 198 "Viviendas dinámicas sin deuda" en Valdivia, X Región, Chile

    Directory of Open Access Journals (Sweden)

    Bonet Miró, Ana

    2007-06-01

    Full Text Available The purpose of the competition as well as the project developed in response to the social, constructive and climate specific conditions of Valdivia, X Region, Chile, is the design and construction of experimental social housing, whose cost, including land and services, would not exceed 7,500 $ per unit. The housing units should be designed in order to grow and to be adapted by owners and should allow for achieving higher urban density as average so to reduce the burden of costs derived from land acquisition and services. The project adopts a three-storey compact typology such as a “big house”, with 2 units on ground floor and 4 duplex on upper floors. The local wood construction tradition and the good level of acceptance of it within the context of Valdivia, bring us to develop a mixed construction system, concrete and wood, which not only is suitable to the geotechnical and seismic conditions of the ground, but also to the economical restrictions and to the requirements of spatial flexibility so necessary when designing a minimal housing unit.El objetivo del concurso y del proyecto desarrollado posteriormente, adaptado a los condicionantes sociales, constructivos y climatológicos de Valdivia, X Región, Chile, es el diseño y construcción de unas viviendas sociales experimentales, cuyo coste, incluida la repercusión del suelo no exceda de 7.500 $ por unidad. Dichas viviendas tienen que ser aptas para su crecimiento y adaptación posterior y lograr una mayor densidad que las habitualmente conseguidas en estos programas con el fin de abaratar los costos derivados de la compra del terreno. Se adopta una tipología compacta de “casa grande”, de tres alturas, con 2 viviendas en planta baja y 4 dúplex en las plantas superiores. La tradición constructiva local en madera y la buena aceptación que la misma tiene en el contexto de Valdivia han llevado a proponer un sistema mixto, hormigón y madera que no sólo responde bien a los condicionantes geotécnicos y sísmicos del solar y a las limitaciones económicas sino también a la flexibilidad espacial necesaria en un proyecto de vivienda mínima.

  10. All Equal: Article 198 of the Objective of Civil Procedure Code

    Directory of Open Access Journals (Sweden)

    Luciane Mara Correa Gomes

    2016-10-01

    Full Text Available The implementation of the electronic process in Brazil was made to be a way to minimize the slowness in dealing with cases. Created the first barrier of inequality, because there was not the adequacy of the system to people with special needs. The Civil Procedure Code calls for equal treatment by imposing the Judiciary duty purpose of access, spreading the installation charge of treatment rooms with technical support and personnel to jurisdictional, disabled and elderly. In the absence of physical space, allows the law to practice through physical, creating imbalance in parity procedural weapons.

  11. Is macromastia a risk factor for breast cancer? A study on 198 patients.

    Science.gov (United States)

    Talghini, Shahla

    2013-11-01

    Macromastia, or breast hypertrophy, is a very common finding and a frequent cause of reduction mammaplasty all over the world. This study aims to examine the breast tissue specimens obtained by reduction mammaplasty in patients with macromastia in terms of the frequency of histopathological abnormalities (malignant and non-malignant lesions). In this cross-sectional, retrospective study, paraffin-embedded specimens of breast tissue after reduction mammaplasty were histopathologically reviewed in Tabriz Imam Reza Teaching Hospital in three years (2010-2013). All the specimens were sectioned, stained and examined by an adroit pathologist. One hundred ninety eight out of 271 primary specimens were eligible for this study. The mean age of the patients was 37.09 +/- 8.98 (range: 20-59) years, with mean body mass index of 27.44 +/- 3.85 (range: 21-35) kg m(-2). Based on the findings of microscopic examination, normal tissue was present in 98 cases (49.5%), all with increased content of fat. Fibrocystic change was the prominent benign entity, which was reported in 47.5% of the cases. Intraductal papilloma was detected 2 cases (1%). There were 4 cases with malignant lesions (2%), including 2 cases (1%) with invasive ductal carcinoma (age: 22 and 31 years old) and 2 cases (1%) with lobular carcinoma in situ (age: 21 and 35 years old). Considering the intraductal papilloma as a premalignant condition, the total rate of non-benign lesions reached to 3%. Based on the results of the present study, macromastia may be considered as a risk factor of breast malignancy. Thorough histopathological examination of the breast specimens after reduction mammaplasty, as well as strict screening of the women with nonsurgical macromastia is highly recommended.

  12. SU-F-T-198: Dosimetric Comparison of Carbon and Proton Radiotherapy for Recurrent Nasopharynx Carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Sheng, Y; Zhao, J; Wang, W; Lin, L; Liu, X; Shahnazi, K [Shanghai Proton and Heavy Ion Center, Shanghai (China)

    2016-06-15

    Purpose: Various radiotherapy planning methods for locally recurrent nasopharynx carcinoma (R-NPC) have been proposed. The purpose of this study was to compare carbon and proton therapy for the treatment of R-NPC in terms of dose coverage for target volume and sparing for organs at risk (OARs). Methods: Six patients who were suffering from R-NPC and treated using carbon therapy were selected for this study. Treatment plans with a total dose of 57.5Gy (RBE) in 23 fractions were made using SIEMENS Syngo V11. An intensity-modulated radiotherapy optimization method was chosen for carbon plans (IMCT) while for proton plans both intensity-modulated radiotherapy (IMPT) and single beam optimization (proton-SBO) methods were chosen. Dose distributions, dose volume parameters, and selected dosimetric indices for target volumes and OARs were compared for all treatment plans. Results: All plans provided comparable PTV coverage. The volume covered by 95% of the prescribed dose was comparable for all three plans. The average values were 96.11%, 96.24% and 96.11% for IMCT, IMPT, and proton-SBO respectively. A significant reduction of the 80% and 50% dose volumes were observed for the IMCT plans compared to the IMPT and proton-SBO plans. Critical organs lateral to the target such as brain stem and spinal cord were better spared by IMPT than by proton-SBO, while IMCT spared those organs best. For organs in the beam path, such as parotid glands, the mean dose results were similar for all three plans. Conclusion: Carbon plans yielded better dose conformity than proton plans. They provided similar or better target coverage while significantly lowering the dose for normal tissues. Dose sparing for critical organs in IMPT plans was better than proton-SBO, however, IMPT is known to be more sensitive to range uncertainties. For proton plans it is essential to find a balance between the two optimization methods.

  13. Sexospécificités | Page 198 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The Indigenous peoples who live there depend on this forest for food, medicine, building materials and much more. But parts of the rainforest are being cut by outsiders, the pressure on natural resources is increasing, and the livelihoods of the Indigenous peoples are threatened. Read more about Conserving biodiversity, ...

  14. Treatment of Synthetic Wastewater Containing Reactive Red 198 by Electrocoagulation Process

    OpenAIRE

    N.M Mahmoodi; A Ameri; M Gholami; A Jonidi jafari; A Dalvand

    2011-01-01

    "nBackground and Objectives: Discharge of textile colored wastewater industries without providing enough treatment in water bodies, is harmful for human and aquatic organisms and poses serious damages to the environment. Most of conventional wastewater treatment methods don't have enough efficiency to remove textile dyes from colored wastewater; thus in this research the efficiency of electrocoagulation treatment process with aluminum electrodes for treatment of a synthetic wastewater co...

  15. 42 CFR 413.198 - Recordkeeping and cost reporting requirements for outpatient maintenance dialysis.

    Science.gov (United States)

    2010-10-01

    ...) Section 413.157, Return on equity capital of proprietary providers; (ii) Section 413.200, Reimbursement of... providers, and §§ 413.13, 413.30, 413.35, 413.40, 413.74, and §§ 415.55 through 415.70, § 415.162, and § 415...

  16. : tous les projets | Page 198 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    End Date: 19 mars 2015. Sujet: NUTRITION, Disease control, RESEARCH, CHILDREN, TELEVISION, FOOD CONSUMPTION, PERU. Région: Peru, South America, North and Central America. Programme: Alimentation, environnement et santé. Financement total : CA$ 215,000.00. Examen des liens entre la télévision et les ...

  17. Sex Education and Sex Stereotypes: Theory and Practice. Working Paper No. 198.

    Science.gov (United States)

    Stubbs, Margaret L.

    This paper presents an explanation of practitioners' reactions to sex equitable sex education. Several constraints can prohibit practitioners from engaging in sex equitable sex education: (1) lack of community support; (2) lack of expertise in human sexuality education; (3) vagueness of school committee views; and (4) lack of answers to logistical…

  18. Scintigraphic aspect of liver in hepatitis. [/sup 198/Au-radiocolloid

    Energy Technology Data Exchange (ETDEWEB)

    Silva, W M; Medeiros, M [Hospital dos Servidores do Estado, Rio de Janeiro (Brazil). Servico de Medicina Nuclear

    1976-01-01

    A series of scintigraphs was made in a group of 15 patients with viral hepatitis, and compared with biochemical tests. Although in some patients the last biochemical tests were only slightly elevated, and in others entirely normal, they all continued to show abnormal scintigraphs with a mottled aspect and splenic uptake. It is supposed that some sequellae remain in the hepatic tissue even though the patient responds well in clinical and laboratory tests.

  19. People and things. CERN Courier, Nov 1979, v. 19(8)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1979-11-15

    The article covers the celebration of the 'Journée du Personnel' (Staff Day), where over 3000 CERN staff turned up to enjoy various attractions like games, sports, sideshows, competitions, films, music and entertainment, and dancing that went on into the small hours. One highlight was the playing of 'Happy Birthday, CERN — From Fermi lab', recorded at Fermi lab. In other news, the article reports on various people, staff changes within the CERN organization and recent news updates.

  20. Slim 198gold-grain implanter loaded with standard royal marsden 14-grain magazines

    International Nuclear Information System (INIS)

    Delclos, L.; Moore, E.B.

    1979-01-01

    We designed a slim gold-grain implanter with adaptable lengths to implant areas accessible only through long, narrow, examining instruments, such as a suspension laryngoscope. The implanter is loaded with the same 14-grain magazine designed for and supplied with the Royal Marsden gun. The simplicity of the loading mechanism with a minimum of moving parts makes the instrument practically trouble free. Although it is designed to be used along narrow examining instruments, it can also be used in any situation in which a permanent implant is required, for instance, prostatic cancer and pelvic recurrences in cancer of the uterine cervix previously treated by external and intracavitary irradiation

  1. Asie du sud | Page 198 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The stories presented in Success Stories in Asian Aquaculture reflect the unique nature of Asian aquaculture, providing first-time insight into how and why it has become so successful. Overall, the book demonstrates how the resiliency, adaptability, and innovation of small-scale aquaculture farmers have been crucial to this ...

  2. Infrared studies of H II regions: the Sharpless regions S148, 184, 198, 206 and 269

    International Nuclear Information System (INIS)

    Pismis, Paris

    1991-01-01

    We present the results of a combined near-infrared and IRAS mapping study of five H II regions for which fairly complete information at optical and radio wavelengths previously existed. The near-infrared observations, carried out with the 2.1-m telescope at Observatorio de San Pedro Martir (Mexico), allowed us to study the the stellar content at the core of each nebula, while an analysis of extended near-infrared emission zones showed these to arise mainly from ionized gas (S148 and S206) or through scattering and thermal emission from dust grains surrounding a massive young star (S269-IRS2). The analysis of IRAS data, on the other hand, suggests that two different populations of grains contribute to the observed 12- to 100-μm fluxes. (author)

  3. International Spread of an Epidemic Population of Salmonella enterica Serotype Kentucky ST198 Resistant to Ciprofloxacin

    DEFF Research Database (Denmark)

    Le Hello, Simon; Hendriksen, Rene S.; Doublet, Benoit

    2011-01-01

    National Salmonella surveillance systems from France, England and Wales, Denmark, and the United States identified the recent emergence of multidrug-resistant isolates of Salmonella enterica serotype Kentucky displaying high-level resistance to ciprofloxacin. A total of 489 human cases were ident...

  4. Sylvie Chaperon, La médecine du sexe et les femmes, Paris, La Musardine, 2008, 198 p.

    Directory of Open Access Journals (Sweden)

    Grégory Quin

    2010-07-01

    Full Text Available Après un travail fouillé sur les origines de la sexologie, Sylvie Chaperon, historienne spécialiste d’histoire des femmes et du genre, maîtresse de conférences à l’Université de Toulouse 2, propose dans son nouveau livre une anthologie de textes que des médecins du XIXe siècle ont produits sur la sexualité féminine et ses diverses pathologies. L’ouvrage est construit autour d’une cinquantaine de cas de quelques-unes de ces pathologies associées à la sexualité des femmes : l’onanisme, la nymph...

  5. The global establishment of a highly-fluoroquinolone resistant Salmonella enterica serotype Kentucky ST198 strain

    DEFF Research Database (Denmark)

    Le Hello, Simon; Bekhit, Amany; Granier, Sophie A.

    2013-01-01

    While the spread of Salmonella enterica serotype Kentucky resistant to ciprofloxacin across Africa and the Middle-East has been described recently, the presence of this strain in humans, food, various animal species (livestock, pets, and wildlife) and in environment is suspected in other countrie...

  6. Sylvie Chaperon, La médecine du sexe et les femmes, Paris, La Musardine, 2008, 198 p.

    OpenAIRE

    Quin, Grégory

    2010-01-01

    Après un travail fouillé sur les origines de la sexologie, Sylvie Chaperon, historienne spécialiste d’histoire des femmes et du genre, maîtresse de conférences à l’Université de Toulouse 2, propose dans son nouveau livre une anthologie de textes que des médecins du XIXe siècle ont produits sur la sexualité féminine et ses diverses pathologies. L’ouvrage est construit autour d’une cinquantaine de cas de quelques-unes de ces pathologies associées à la sexualité des femmes : l’onanisme, la nymph...

  7. Occupational irradiation by external radiation sources. Analysis of the control system data covering the period 1972 - 198a

    International Nuclear Information System (INIS)

    Karadzhov, A.; Velikov, V.

    1982-01-01

    Occupational irradiation data, made available by the system of individual dosimetric control, are analyzed. It is demonstrated that the annual dose distribution is in accordance with the logarithm of normal distribution. The obtained values of the average dose in industry, medicine, science and educatuin during the period 1972 through 1980 are respectively 3.7 mSv, 1.0 mSv and 0.45 mSv. In some lines the average annual dose considerably exceeds the average annual dose for the respective branch, e.g. for workers in gamma defectoscopy it amounts to 9.1 mSv, while for medical personnel of deep and curi therapy - 2.1 mSv. (author)

  8. 198 Contribution à l'étude de la salinisation de la nappe côtière de ...

    African Journals Online (AJOL)

    MB Pro

    La nappe côtière de Foum EL Oued est la principale unité hydrogéologique de la ..... évaporites (NaCl = halite) soit par une contamination à partir d'un biseau salé .... A. HANI and J. MANIA,Tecnología De La Intrusión De Agua De Mar En.

  9. 198 “Viviendas dinámicas sin deuda” en Valdivia, X Región, Chile

    OpenAIRE

    Bonet Miró, Ana; Brunelli, Luca

    2007-01-01

    The purpose of the competition as well as the project developed in response to the social, constructive and climate specific conditions of Valdivia, X Region, Chile, is the design and construction of experimental social housing, whose cost, including land and services, would not exceed 7,500 $ per unit. The housing units should be designed in order to grow and to be adapted by owners and should allow for achieving higher urban density as average so to reduce the burden of costs derived from l...

  10. Study of the seasonal variation in the exchanges of food labelled with 198Au from a worker bee to a queen (Apis mellifica ligustica S.)

    International Nuclear Information System (INIS)

    Pain, Janine; Roger, Bernard; Douault, Philippe

    1975-01-01

    Food exchanges from a worker giver to a queen receiver were quantified throughout the year. 4 days old workers distribute great amounts of food to queens, about 74% in average, but variations are low. On the other hand workers of unknown age distribute amounts that are less high and varying in terms of the season. A parallelism exists between percentage variations of food shared by workers of unknown age and the seasonal cycle of the 9-oxodec-2-enoic acid content of queens [fr

  11. Performance Characteristics of Automotive Engines in the United States : Second Series - Report No. 6 - 1976 Nissan Diesel 198 CID (3.2 Liters), F.I.

    Science.gov (United States)

    1978-05-01

    Experimental data were obtained in dynamometer tests of a 1976 Nissan diesel engine, Model SD-33 CN6-33, to determine fuel consumption and emissions (hydrocarbon, carbon monoxide, oxides of nitrogen) at steady-state engine-operating modes. The object...

  12. Comments on "Weed Recognition using Image Blur Information" by Peng, Z. & Jun, C., Biosystems Engineering 110 (2), p. 198-205”

    Czech Academy of Sciences Publication Activity Database

    Flusser, Jan; Suk, Tomáš; Zitová, Barbara

    2014-01-01

    Roč. 2014, č. 126 (2014), s. 104-108 ISSN 1537-5110 R&D Projects: GA ČR GAP103/11/1552 Keywords : Weed recognition * Blur * Moment Invariants * Blur Invariants Subject RIV: JD - Computer Applications, Robotics Impact factor: 1.619, year: 2014 http://library.utia.cas.cz/separaty/2014/ZOI/flusser-0431031.pdf

  13. CYP19A1 polymorphisms and clinical outcomes in postmenopausal women with hormone receptor-positive breast cancer in the BIG 1-98 trial

    DEFF Research Database (Denmark)

    Leyland-Jones, Brian; Gray, Kathryn P; Abramovitz, Mark

    2015-01-01

    To determine whether CYP19A1 polymorphisms are associated with abnormal activity of aromatase and with musculoskeletal and bone side effects of aromatase inhibitors. DNA was isolated from tumor specimens of 4861 postmenopausal women with hormone receptor-positive breast cancer enrolled in the BIG 1...

  14. The treatment of rheumatoid arthritis, osteoarthritis, and non-specific synovitis by intra-articular injection of radioactive colloidal gold (198Au)

    International Nuclear Information System (INIS)

    Kim, S.J.

    1981-01-01

    In this study, thirty-nine knee and three ankle effusions and pains unresponsive to the usual methods of therapy were treated by intra-articular injection of radioactive colloidal gold from November 1964 to January 1979 and followed up. Thirteen cases had classical rheumatoid arthritis: fifteen non-specific synovitis: two pigmented villonodular synovitis: one post-synovectomy, and one tuberculous arthritis. The results were as follows: 1) In eleven cases (84.6 %) of rheumatoid arthritis fourteen cases (93.3 %) of non-specific synovitis, and five cases (50.0 %) of osteoarthritis, the effusion disappeared. 2) In twelve cases (92.3 %) of rheumatoid arthritis, thirteen cases (86.7 %) of non-specific synovitis, and only two cases (20.0 %) of oseoarthritis, the pain disappeared. 3) As a whole, in thirty-three cases (78.6 %), the effusion disappeared and in twenty-eight cases (66.7 %) the pain disappeared. (author)

  15. Characterization of metabolites of leonurine (SCM-198) in rats after oral administration by liquid chromatography/tandem mass spectrometry and NMR spectrometry.

    Science.gov (United States)

    Zhu, Qing; Zhang, Jinlian; Yang, Ping; Tan, Bo; Liu, Xinhua; Zheng, Yuanting; Cai, Weimin; Zhu, Yizhun

    2014-01-01

    Leonurine, a major bioactive component from Herba Leonuri, shows therapeutic potential for cardiovascular disease and stroke prevention in some preclinical experiments. The aim of this study is to characterize metabolites of leonurine in rats using high performance liquid chromatography coupled with tandem mass spectrometry (HPLC/MS/MS). The chromatographic separation was performed on an Agilent ZORBAX SB-C18 column using a gradient elution with acetonitrile/ammonium acetate buffer (10 mM, pH 4.0) solvent system. An information dependent acquisition (IDA) method was developed for screening and identifying metabolites of leonurine under positive ion mode. Compared with control, the interesting compound in the extracted ion chromatogram (XIC) of the in vivo samples was chosen and further identified by analyzing their retention times, changes in observed mass (Δm/z), and spectral patterns of product ion utilizing advanced software tool. For the first time, a total of three metabolites were identified, including two phase II metabolites generated by glucuronidation (M1) and sulfation (M2) and one phase I metabolite formed by O-demethylation (M3). Finally, the lead metabolite M1 was isolated from urine and its structure was characterized as leonurine-10-O- β-D-glucuronide by NMR spectroscopy (¹H, ¹³C, HMBC, and HSQC).

  16. 4-Guanidino-n-butyl syringate (Leonurine, SCM 198) protects H9c2 rat ventricular cells from hypoxia-induced apoptosis.

    Science.gov (United States)

    Liu, Xin-hua; Chen, Pei-fang; Pan, Li-long; Silva, Ranil De; Zhu, Yi-zhun

    2009-11-01

    In the present study, we examined the ability of a chemically synthesized compound based on the structure of leonurine, a phytochemical component of Herba leonuri, to protect H9c2 rat ventricular cells from apoptosis induced by hypoxia and serum deprivation, as a model of ischemia. The results revealed a concentration-dependent increase in cell viability associated with leonurine treatment, accompanied by a consistent decline in lactate dehydrogenase leakage into the culture medium. The fraction of annexin V-fluorescein isothiocyanate-positive cells was increased by hypoxia but reduced by leonurine. These changes were associated with increased expression of the antiapoptotic gene, Bcl-2, and reduced expression of the proapoptotic gene, Bax. Leonurine also reduced the cytosolic Ca overload induced by hypoxia. These results suggest that leonurine elicits potent cardioprotective effects in H9c2 cells, and these effects may be mediated by inhibition of intracellular Ca overload and apoptosis during hypoxia.

  17. Analyses adjusting for selective crossover show improved overall survival with adjuvant letrozole compared with tamoxifen in the BIG 1-98 study

    DEFF Research Database (Denmark)

    Colleoni, Marco; Giobbie-Hurder, Anita; Regan, Meredith M

    2011-01-01

    Among postmenopausal women with endocrine-responsive breast cancer, the aromatase inhibitor letrozole, when compared with tamoxifen, has been shown to significantly improve disease-free survival (DFS) and time to distant recurrence (TDR). We investigated whether letrozole monotherapy prolonged ov...

  18. SU-E-J-198: Out-Of-Field Dose and Surface Dose Measurements of MRI-Guided Cobalt-60 Radiotherapy

    International Nuclear Information System (INIS)

    Lamb, J; Agazaryan, N; Cao, M; Low, D; Thomas, D; Yang, Y

    2015-01-01

    Purpose: To measure quantities of dosimetric interest in an MRI-guided cobalt radiotherapy machine that was recently introduced to clinical use. Methods: Out-of-field dose due to photon scatter and leakage was measured using an ion chamber and solid water slabs mimicking a human body. Surface dose was measured by irradiating stacks of radiochromic film and extrapolating to zero thickness. Electron out-of-field dose was characterized using solid water slabs and radiochromic film. Results: For some phantom geometries, up to 50% of Dmax was observed up to 10 cm laterally from the edge of the beam. The maximum penetration was between 1 and 2 mm in solid water, indicating an electron energy not greater than approximately 0.4 MeV. Out-of-field dose from photon scatter measured at 1 cm depth in solid water was found to fall to less than 10% of Dmax at a distance of 1.2 cm from the edge of a 10.5 × 10.5 cm field, and less that 1% of Dmax at a distance of 10 cm from field edge. Surface dose was measured to be 8% of Dmax. Conclusion: Surface dose and out-of-field dose from the MRIguided cobalt radiotherapy machine was measured and found to be within acceptable limits. Electron out-of-field dose, an effect unique to MRI-guided radiotherapy and presumed to arise from low-energy electrons trapped by the Lorentz force, was quantified. Dr. Low is a member of the scientific advisory board of ViewRay, Inc

  19. SU-E-T-198: Hippocampal-Sparing Radiotherapy (HSRT) for Patients with Head and Neck Cancer (HNC) Using Intensity-Modulated Radiation Therapy (IMRT)

    International Nuclear Information System (INIS)

    Dunlop, A; Welsh, L; Nutting, C; Harrington, K; Bhide, S; Newbold, K

    2014-01-01

    Purpose: There is increasing evidence that decline in cognitive function following brain radiotherapy (RT) is related to the radiation dose delivered to the hippocampi. In this work we evaluate the feasibility of using IMRT to generate HSRT plans in HNC. Methods: A planning study was undertaken for ten representative patients with HNC previously treated with radical (chemo)-RT using standard IMRT techniques. The hippocampi were delineated according to the RTOG hippocampal contouring atlas, on a T1w- MRI scan that was registered with the RT planning CT. LINAC-based, clinically acceptable, HSRT plans were generated and assessed using the Pinnacle3 treatment planning system. Results: Using a VMAT technique, a reduction in hippocampal dose was achievable in six cases. For these cases, the EQD2-D40% of the bilateral hippocampi was significantly reduced by HSRT (p = 0.006) from a median of 18.8Gy (range 14.4–34.6) to 6.5 Gy (4.2–9.5) for the delivered and HSRT plans respectively. Plans were also generated using a fixed-field IMRT technique with non-coplanar beams that were designed to avoid the bilateral hippocampi, resulting in a median EQD2-D40% of 11.2Gy (8.0–14.5). Both HSRT techniques also resulted in lower doses to the whole brain, brain stem, and cerebellum. The HSRT plans resulted in higher doses to some regions of non-contoured normaltissue, but the magnitude of these dose differences is unlikely to be of clinical significance in terms of acute and late toxicity. Conclusion: This study has demonstrated that it is possible, in many cases, to adapt treatment plans for HNC to significantly reduce dose to the hippocampi. This reduction in dose would be predicted to Resultin a significant reduction in the probability of subsequent decline in cognitive function following RT. Our results point towards the need for the collection of prospective data on cognitive outcomes for the HNC patient population treated with radical (chemo)-RT

  20. T198. A SCHIZOPHRENIA-LIKE BIRTH SEASONALITY AMONG MATHEMATICIANS AND AN OPPOSITE SEASONALITY AMONG BIOLOGISTS: MORE EVIDENCE IMPLICATING BIMODAL RHYTHMS OF GENERAL BIRTHS

    Science.gov (United States)

    Marzullo, Giovanni

    2018-01-01

    Abstract Background Based on early-20th century births, a pre-electric illumination time of comparatively normal human exposure to sunlight, studies of schizophrenia (SCZ) found a birth seasonality with two opposite effects: a SCZ-liability peak among subjects born around late-February and an equally significant SCZ-resistance peak among those born six months later, around late-August. We previously investigated this rhythm in connection with a sunlight-dependent bimodal rhythm of general births that, prior to the full advent of electric lighting (but not later), occurred ubiquitously in non-equatorial parts of the world. We found that the SCZ-liability peak coincided with a first, Feb-Mar peak of general-population births (the GP1) while the SCZ-resistance peak coincided with a second, Aug-Sep peak of those births (the GP2). Moreover, in a study of hand and visual-field preferences among professional baseball players, we found the SCZ-liability, GP1-coincident seasonality among players with preferences denoting cerebral asymmetry “deficits” (CADs) and the SCZ-resistance, GP2-coincident seasonality among those with preferences denoting cerebral asymmetry “excesses.” Also, in a study suggested by associations of CADs with artistic abilities, we found the SCZ-liability, GP1-coincident seasonality among groups representing visual, performing and literary art “creators” (VPL-Artists) and the SCZ-resistance, GP2-coincident seasonality among groups representing art critics, historians, curators and other art “observers” (Para-Artists). Together, these findings suggested, as one possibility (but see later), that the SCZ-liability, CAD effects and artistic abilities could all three represent traits genetically or otherwise selected into the GP1 excess population of newborns and out of the GP2 population. The present study of “scientists” was initially aimed at the purported arts/science antithesis. Methods Birth seasonalities were examined among early-20th century born American scientists and among yet earlier European biologists and mathematicians. Results A group representing 1,925 American scientists showed the SCZ-resistance, GP2-coincident seasonality. However, this effect proved to be mostly due to biologists because biochemists, chemists, and physicists showed gradually less seasonality while mathematicians suggested an altogether artist-like, GP1-coincident seasonality. This intimation of a biologist-mathematician antithesis was pursued with an investigation of most major figures in the history of the two sciences from the 15th to the early-20th century. The two groups, numbering 576 mathematicians and 787 biologists, shared the same mean decade of birth, the 1780s, and essentially the same geographic origin in Western Europe. The mathematicians showed a very significant SCZ liability-like, GP1-coincident seasonality while the biologists showed an even more significant SCZ resistance-like, GP2-coincident seasonality. The latter effect was particularly strong among naturalists, anatomists and other groups representing biological “observationalism” as opposed to “experimentalism.” Discussion The findings are discussed in light of a) new evidence that the annual photoperiod is indeed alone responsible for both peaks of general births, with the GP1 and the GP2 being caused by maternal periconceptional exposure to, respectively, the summer-solstice sunlight maximum and the winter-solstice minimum, and b) an approach/withdrawal theory of lateralization of basic emotions where the left cerebral cortex would handle external stimuli eliciting complacent emotions towards external realities while the right cortex would handle internal stimuli eliciting disdain for those realities.

  1. Study of food transfers in drones (Apis mellifica ligustica S.) by means of a radio-isotope 198Au during the year. Comparison between the three castes

    International Nuclear Information System (INIS)

    Roger, Bernard; Douault, Philippe; Pain, Janine

    1978-01-01

    Food transfers from a radioactive donor worker bee to a receiving drone, of which age is known, were studied all through the year. Results are compared with those of both other castes. Amounts of food shared and homogeneity of food exchanges are different according to the category to which the worker bee belongs. The seasons have an effect only upon the feeding behavior of worker Bees of unknown age. It appears that the drone is an insect whose feeding behavior is situated between that of a queen and that of a worker from the point of view of food exchanges. The interest of winter drones is emphasized [fr

  2. Radionuclide and X-ray diagnosis of metastatic tumors of the gastrointestinal tract. [/sup 198/Au; sup(99m)Tc; sup(113m)In

    Energy Technology Data Exchange (ETDEWEB)

    Makeev, A I; Ostrovtsev, I V; Roshchin, E M [Akademiya Meditsinskikh Nauk SSSR, Moscow. Onkologicheskij Nauchnyj Tsentr

    1982-02-01

    A study was made of the spread of a tumor process in 161 patients with gastric cancer and in 9 patients with colorectal cancer. Diagnostic examinations preceeded treatment. The concentrations of the carcinoembryonic antigen (CEA) and ..cap alpha..- fetoprotein (AFP) in the blood plasma were demonstrated in 170 patients. Liver scanning was done to 122, and computerized tomography to 18 patients. It has been shown that the determination of the CEA level in the blood plasma can serve as an additional parameter to define tumor spread in the gastrointestinal tract. In gastric and colorectal cancer, a hepatic large focal lesion is accompanied by the highest CEA level. The CEA level and the gastric primary tumor mass show direct correlation. No correlation has been found between the AFP level and the degree of spread of a tumor process, both local and metastatic.

  3. Optimizing radiofrequency ablation of paroxysmal and persistent atrial fibrillation by direct catheter force measurement-a case-matched comparison in 198 patients.

    Science.gov (United States)

    Sigmund, Elisabeth; Puererfellner, Helmut; Derndorfer, Michael; Kollias, Georgios; Winter, Siegmund; Aichinger, Josef; Nesser, Hans-Joachim; Martinek, Martin

    2015-02-01

    Sufficient electrode-tissue contact is crucial for adequate lesion formation in radiofrequency catheter ablation (RFCA). We assessed the impact of direct catheter force measurement on acute procedural parameters and outcome of RFCA for paroxysmal and persistent atrial fibrillation (AF). Ninety-nine consecutive patients (70% men) with paroxysmal (63.6%) or persistent AF underwent left atrial RFCA using a 3.5-mm open-irrigated-tip (OIT) catheter with contact force measurement capabilities (group 1). For comparison a case-matched cohort with standard OIT catheters was used (99 patients; group 2). Case matching included gender, type of AF, number or RFCA procedures, and type of procedure. Procedural data showed a significant decline in radiofrequency ablation time from 52 ± 20 to 44 ± 16 minutes (P = 0.003) with a remarkable mean reduction in overall procedure time of 34 minutes (P = 0.0001; 225.8 ± 53.1 vs 191.9 ± 53.3 minutes). In parallel, the total fluoroscopy time could be significantly reduced from 28.5 ± 11.0 to 19.9 ± 9.3 minutes (P = 0.0001) as well as fluoroscopy dose from 74.1 ± 58.0 to 56.7 ± 38.9 Gy/cm(2) (P = 0.016). Periprocedural complications were similar in both groups. The use of contact force sensing technology is able to significantly reduce ablation, procedure, and fluoroscopy times as well as dose in RFCA of AF in a mixed case-matched group of paroxysmal and persistent AF. Energy delivery is substantially reduced by avoiding radiofrequency ablation in positions with insufficient surface contact. Additionally 12-month outcome data showed increased efficacy. Such time saving and equally safe technology may have a relevant impact on laboratory management and increased cost effectiveness. © 2014 Wiley Periodicals, Inc.

  4. Cruise report for a seismic investigation of gas hydrates in the Mississippi Canyon region, northern Gulf of Mexico; cruise M1-98-GM

    Science.gov (United States)

    Cooper, Alan K.; Hart, Patrick E.; Pecher, Ingo

    1998-01-01

    During June 1998, the U.S. Geological Survey (USGS) and the University of Mississippi Marine Minerals Technology Center (MMTC) conducted a 12-day cruise in the Mississippi Canyon region of the Gulf of Mexico (Fig. 1). The R/V Tommy Munro, owned by the Marine Research Institute of the University of Southern Mississippi, was chartered for the cruise. The general objective was to acquire very high resolution seismic-reflection data across of the upper and middle continental slope (200-1200-m water depths) to study the acoustic character, distribution and potential effects of gas hydrates within the shallow subsurface, extending from the sea floor down to the base of the gas-hydrate stability zone. The Gulf of Mexico is well known for hydrocarbon resources that include petroleum and related gases. Areas of the Gulf that lie in waters deeper than about 250 m potentially have conditions (e.g., pressure, temperature, near-surface gas content, etc.) that are right for the shallow-subsurface formation of the ice-like substance (gas and water) known as gas hydrate (Kvenvolden, 1993). Gas hydrates have previously been sampled in sea-floor cores and observed as massive mounds in several parts of the northern Gulf, including the Mississippi Canyon region (e.g., Anderson et al., 1992). Extensive seismic data have been recorded in the Gulf, in support of commercial drilling efforts, but few very high resolution data exist in the public domain to aid in gas-hydrate studies. Studies of long-term interest include those on the resource potential of gas hydrates, the geologic hazards associated with dissociation and formation of hydrates, and the impact, if any, of gas-hydrate dissociation on atmospheric warming (i.e., via release of methane, a "greenhouse" gas). Several very high resolution seismic systems (surface-towed, deep-towed, and sea-floor) were used during the cruise to test the feasibility of using such data for detailed structural (geometric) and stratigraphic (physical property) analyses based on the acoustic data. The cruise was conducted in two regions, on opposite flanks of the Mississippi Canyon, where gas hydrates are known and suspected from prior coring and seismic operations (e.g., Neurauter and Bryant, 1989). The regions are also characterized by thick surficial, relatively young (Pleistocene and younger) sediments. Swath-bathymetry data (Fig. 2) show extensive sea-floor faults, piercement features, and slumps—features whose development could potentially be related to gas hydrates. The specific objectives of the cruise were (a) to image the gas-hydrate stability zone across the continental margin to document bottom-simulating reflections (BSRs) and changes in geometry of the hydrate stability zone; (b) to image known hydrate features (with several seismic systems) to estimate physical properties for hydrate and non-hydrate areas; (c) to outline the shallow structures of the hydrate stability zone to ascertain their potential effects on the formation/distribution of hydrates and on stability of the sea floor; and (d) to estimate, if possible, the amounts of hydrates present in the shallow sub surface.

  5. SU-E-T-198: Hippocampal-Sparing Radiotherapy (HSRT) for Patients with Head and Neck Cancer (HNC) Using Intensity-Modulated Radiation Therapy (IMRT)

    Energy Technology Data Exchange (ETDEWEB)

    Dunlop, A; Welsh, L; Nutting, C; Harrington, K; Bhide, S; Newbold, K

    2014-06-01

    Purpose: There is increasing evidence that decline in cognitive function following brain radiotherapy (RT) is related to the radiation dose delivered to the hippocampi. In this work we evaluate the feasibility of using IMRT to generate HSRT plans in HNC. Methods: A planning study was undertaken for ten representative patients with HNC previously treated with radical (chemo)-RT using standard IMRT techniques. The hippocampi were delineated according to the RTOG hippocampal contouring atlas, on a T1w- MRI scan that was registered with the RT planning CT. LINAC-based, clinically acceptable, HSRT plans were generated and assessed using the Pinnacle3 treatment planning system. Results: Using a VMAT technique, a reduction in hippocampal dose was achievable in six cases. For these cases, the EQD2-D40% of the bilateral hippocampi was significantly reduced by HSRT (p = 0.006) from a median of 18.8Gy (range 14.4–34.6) to 6.5 Gy (4.2–9.5) for the delivered and HSRT plans respectively. Plans were also generated using a fixed-field IMRT technique with non-coplanar beams that were designed to avoid the bilateral hippocampi, resulting in a median EQD2-D40% of 11.2Gy (8.0–14.5). Both HSRT techniques also resulted in lower doses to the whole brain, brain stem, and cerebellum. The HSRT plans resulted in higher doses to some regions of non-contoured normaltissue, but the magnitude of these dose differences is unlikely to be of clinical significance in terms of acute and late toxicity. Conclusion: This study has demonstrated that it is possible, in many cases, to adapt treatment plans for HNC to significantly reduce dose to the hippocampi. This reduction in dose would be predicted to Resultin a significant reduction in the probability of subsequent decline in cognitive function following RT. Our results point towards the need for the collection of prospective data on cognitive outcomes for the HNC patient population treated with radical (chemo)-RT.

  6. 198: THE EFFECT OF INSTRUCTING PELVIC FLOOR MUSCLE TRAINING FOR CONTROLLING URINARY INCONTINENCE AND ITS RESULTING STRESS, ANXIETY AND DEPRESSION IN PATIENTS WITH MULTIPLE SCLEROSIS

    Science.gov (United States)

    Shareinia, Habib; Rafii, Forough; Sarraf, Payam; Seyedalshohahadaee, Mahnaz

    2017-01-01

    Background and aims Urinary disorders are common problems in patients with multiple sclerosis (MS). Urinary incontinence largely affects the physical, social, and emotional characteristics and activities of these patients. The aim of this study was to identify the effect of pelvic floor muscle Training on urinary incontinence and its resulting stress, anxiety and depression in MS patients. Methods The present clinical trial with a pre-post design was conducted on 50 MS patients presenting to the MS clinic of Imam Khomeini Hospital in Tehran (Iran) who had been selected by convenience sampling method. Participants received instructions on pelvic floor muscle exercises and then practiced them for three consecutive months. The International Consultation on Incontinence Questionnaire – Urinary Incontinence Short Form (ICIQ-UI SF) was used to measure participants' urinary incontinence and the 21-item Depression, Anxiety and Stress Scale (DASS-21) then used to measure their depression, anxiety and stress, both before the intervention and at the end of the third month of exercising. The data obtained were analyzed in SPSS16 using descriptive statistics and the dependent t test. Results About 45 (90%) participants practiced pelvic floor muscle exercises up until the end of the third month. The frequency and amount of urine leakage and the effect of urinary incontinence on the quality of life differed significantly in the patients after the instructions compared to before (P<0.001). The mean score of stress (P<0.001), anxiety (P=0.04) and depression (P=0.003) decreased significantly after the intervention. Conclusion According to the findings, instructing pelvic floor muscle exercises is effective in reducing urinary incontinence and its resulting stress, anxiety and depression in MS patients. These exercises are therefore recommended as a non-pharmacological, non-invasive and cost-effective method for controlling urinary incontinence in MS patients.

  7. Duhamel, Jérémie (2016. Les Vertus de la liberté. Machiavel et la critique de la domination. Paris, Francia: Classiques Garnier. 198 pp.

    Directory of Open Access Journals (Sweden)

    Diego Vernazza

    2017-06-01

    Full Text Available Los golpes de la historia parecieran, en los últimos tiempos, endurecerse. O es quizá la manera insistente que tienen de amontonarse, uno tras otro, la que los vuelve más agudos. Entretanto, hay respiros, y preguntas. Sobre cómo actuar políticamente en este contexto, sobre cómo sostener la apuesta por la igualdad democrática en un mundo que frente al caos se debate entre la restauración y el conformismo.En eso y mucho más pensé al leer el libro de Jérémie Duhamel, Les vertus de la liberté. Machiavel et la critique de la domination, publicado recientemente en París, en Classiques Garnier. No pretendo dar aquí una lectura exhaustiva de la obra, tampoco proponer un ejercicio crítico. Intento, simplemente, articular una breve reflexión, lateral, aunque comprometida, sobre aquello que el Maquiavelo de Jérémie Duhamel puede aportarnos para pensar (en la situación actual...

  8. The Genome sequences of four non-human/non-clinical Salmonella enterica serovar Kentucky ST198 isolates recovered between 1972 and 1973

    Science.gov (United States)

    Salmonella Kentucky is a polyphyletic member of S. enterica subclade A1 with multiple sequence types that often colonize the same hosts but in different frequencies on different continents. To evaluate the genomic features involved in S. Kentucky host specificity we sequenced the genomes of four iso...

  9. Variabilidade intra-avaliador e inter-avaliadores de medidas antropométricas - DOI: 10.4025/actascihealthsci.v29i1.98 Intra-observer and inter-observers variability of anthropometric measures- DOI: 10.4025/actascihealthsci.v29i1.98

    Directory of Open Access Journals (Sweden)

    Edna Regina de Oliveira

    2007-12-01

    Full Text Available O objetivo do estudo foi avaliar a variabilidade intra e inter-avaliadores de medidas antropométricas realizadas por três antropometristas considerados experientes mediante o cálculo dos erros técnicos de medida (ETM. Para esse fim, foi selecionada uma amostra de 21 voluntários (25,7 ± 7,5 anos, sendo 12 homens e 9 mulheres. Foram consideradas as medidas de peso corporal (kg, estatura (cm, circunferências (cm do braço direito relaxado, abdômen, quadril e coxa, e da espessura das dobras cutâneas (mm tricipital, subescapular, suprailíaca, abdômen, coxa e panturrilha medial. As medidas foram realizadas em 2 dias consecutivos, sempre no período da tarde, envolvendo os mesmos equipamentos e os mesmos voluntários. Os resultados apontaram a ocorrência de ETMs acima dos recomendados para aceitabilidade, tanto a variabilidade intra-avaliador como inter-avaliadores, sugerindo, portanto, a importância e a necessidade de treinamento específico dos antropometristas.The aim of this study was to evaluate the intra and inter-observer reliability in the anthropometric measures of three expert observers through the technical error of measure (TEM. For this end, 21 healthy volunteers (25.7 ± 7.5 years took part in the study, being 12 males and 9 females. The following aspects were analyzed: body weigh (kg, stature (cm, circumferences (cm of relaxed right arm, abdomen, hip and thigh, and skinfold thickness (mm of triceps, subescapular, supra-iliac, abdomen, thigh and calf medial. The measures were made in 2 different days, always in the afternoon, with the same equipments and in the same volunteers. The results pointed the occurrence of TEMs out of the recommended patterns, in both intra-observer and inter-observers variability. This fact showed the importance and need of specific training of the observers.

  10. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    International Nuclear Information System (INIS)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons

  11. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  12. Negative Ion Source Development and Photodetachment Studies at ISOLDE

    CERN Document Server

    AUTHOR|(CDS)2254068; Hanstorp, Dag; Rothe, Sebastian

    Astatine is one of the rarest elements on earth. The small amount of existing astatine is either created in decay chains of heavier elements or artificially. One of its longer lived isotopes, 211At, is of interest for targeted alpha therapy, a method of treating cancer by using the alpha decay of radioactive elements directly at the location of a tumor. However, its chemical properties are yet to be determined due to the short life time of astatine. A milestone towards the determination of the electronegativity of astatine was the measurement of its ionization potential (IP) at CERN-ISOLDE. However, its electron affinity (EA, the binding energy of the additional electron in a negative ion), is still to be measured. In order to determine the EA of radioisotopes by laser photodetachment spectroscopy, the Gothenburg ANion Detector for Affinity measurements by Laser Photodetachment (GANDALPH) has been built in recent years. As a proof-of-principle, the EA of the 128I negative ion, produced at the CERN-ISOLDE rad...

  13. An Expert System for Managing Storage Space Constraints Aboard United States Naval Vessels

    Science.gov (United States)

    1991-12-01

    d. solvents, thinners, primers, cmpounds, varnishes , and lacquers i e. alcohol, acetone, ether, and naphtha; f. greases * nd pastes Except for...suffocation. Malocarbon liquids are compounds of carbon containing any of the halogen elements ( fluorine , chlorine, bromine, iodine, or astatine. (Examples are

  14. Workshop on selected aspects of radiochemistry

    International Nuclear Information System (INIS)

    1991-11-01

    The aspects chosen for the workshop are: isotope preparation, separation methods; radiochemical methods and analyses; environmental protection and radiochemistry; the chemistry of the fifth halogen, astatine. From the 28 contributions presented at the workshop, 24 are of relevance in the INIS and EDB scope and are separately retrievable from the database. (BBR) [de

  15. Development and therapeutic application of internally emitting radiopharmaceuticals

    International Nuclear Information System (INIS)

    Adelstein, S.J.; Bloomer, W.D.

    1980-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Among the available α-emitters, astatine-211 appears most promising for testing the efficacy of α-emitters for therapeutic applications because: (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides; (2) it has a half life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells; and (3) α-emission is associated with 100% of its decays. If appropriate biological carriers can be labeled with an alpha emitter such as 211 At, they could be of great utility in several areas of therapeutic medicine where elimination of specific cell populations is desired. While previous attempts to astatinate proteins using standard iodination techniques have been unsuccessful, effective labeling of proteins with astatine by first synthesizing an aryl astatide and then coupling this compound to the protein via an acylation has been achieved. Undergoing current investigation are several different aryl astatide-followed-by-acylation approaches including an astatinated Bolton-Hunter type reagent using concanavalin A (ConA) and melanocyte stimulating hormone (MSH) as model compounds

  16. Assessment of letrozole and tamoxifen alone and in sequence for postmenopausal women with steroid hormone receptor-positive breast cancer: the BIG 1-98 randomised clinical trial at 8·1 years median follow-up

    DEFF Research Database (Denmark)

    Regan, Meredith M; Neven, Patrick; Giobbie-Hurder, Anita

    2011-01-01

    Postmenopausal women with hormone receptor-positive early breast cancer have persistent, long-term risk of breast-cancer recurrence and death. Therefore, trials assessing endocrine therapies for this patient population need extended follow-up. We present an update of efficacy outcomes in the Breast...

  17. Amplification of the discharge current density of lithium-ion batteries with spinel phase Li(PtAu)0.02Mn1.98O4 nano-materials

    CSIR Research Space (South Africa)

    Ross, N

    2014-05-01

    Full Text Available -ion batteries (LIB) was synthesized by incorporation of the Pt-Au (1:1) nanoparticles onto the spinel phase LiMn(sub2)O(sub4). Ultra-low scan rate (0.01 mV (sups-1)) cyclic voltammetry of the cathode material in 1 M LiPF(sub6) (in 1:1 EC:DMC), showed four sets...

  18. CTD Data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT189-198 during 2007 (NODC Accession 0048725)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  19. Land cover and forest formation distributions for St. Kitts, Nevis, St. Eustatius, Grenada and Barbados from decision tree classification of cloud-cleared satellite imagery. Caribbean Journal of Science. 44(2):175-198.

    Science.gov (United States)

    E.H. Helmer; T.A. Kennaway; D.H. Pedreros; M.L. Clark; H. Marcano-Vega; L.L. Tieszen; S.R. Schill; C.M.S. Carrington

    2008-01-01

    Satellite image-based mapping of tropical forests is vital to conservation planning. Standard methods for automated image classification, however, limit classification detail in complex tropical landscapes. In this study, we test an approach to Landsat image interpretation on four islands of the Lesser Antilles, including Grenada and St. Kitts, Nevis and St. Eustatius...

  20. Excitation functions for 197Au (d, p)198Au, 197Au(d, 2n)197mHg, 197Au(d, 2n)197Hg and 197Au(d, p2n)196Au

    International Nuclear Information System (INIS)

    Long Xianguan; Peng Xiufeng; He Fuqing

    1987-01-01

    By using activation method and stack-foil technique, the excitation functions for d + 197 Au reaction in 6.6-13.1 MeV energy range are measured. The measured values are compared with previous results and theoretical calculations

  1. Who, What and How? Commentary on Cheney, F. N. (1963) the Teaching of Reference in American Library Schools. (Journal of Education for Librarianship, 3(3), 188-198)

    Science.gov (United States)

    Smith, Linda C.

    2015-01-01

    Cheney's paper was the first major article on the subject of teaching reference in American library schools. In the article, she addressed three questions: (1) Who is teaching reference?; (2) What is being taught?; and (3) How is it being taught? In this article, Linda Smith discusses how the teaching of reference has changed in the more than 50…

  2. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  3. A simple method for labelling proteins with 211At via diazotized aromatic diamine

    International Nuclear Information System (INIS)

    Wunderlich, G.; Franke, W.-G.; Fischer, S.; Dreyer, R.

    1987-01-01

    A simple and rapid method for labelling proteins with 211 At by means of a 1,4-diaminobenzene link is described. This link is transformed into the diazonium salt and subsequently reactions of both 211 At and proteins with the diazonium salt take place simultaneously. For possibly high yields of astatized protein an appropriate temperature of 273 K was found. The results demonstrate the difference between the reaction mechanisms of iodine and astatine with proteins. (author)

  4. The Installation Restoration Program Toxicology Guide. Volume 2

    Science.gov (United States)

    1987-05-01

    Periodic Table: fluorine , chlorine, bromine, iodine, and astatine. Fluorine is the most active of all chemical elements. 5/87 LIST OF ABBREVIATIONS...fire- retardant varnishes and as an aminizing agent for cotton fabric (901). 37.2 ENVIRONMENTAL FATE A1D EXPOSURE PATHWAYS 37.2.1 Transport in Soil...subject to packaging and labeling regulations. Directive on Paints, Varnishes . Printing Inks. Adhesives and Similar Product; (1334) Pentachlorophenol

  5. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    International Nuclear Information System (INIS)

    Koziorowski, J.

    1998-01-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211 At and 124 I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[ 211 At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[ 211 At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [ 124 I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[ 124 I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of

  6. Synthesis, characterization and comparison of Li{sub 1,05}M{sub 0,02}Mn{sub 1,98}O{sub 4} (M = Al{sup 3+} or + Ga{sup 3+}) obtained by calcination in muffle and microwave; Sintese, caracterizacao e comparacao dos Li{sub 1,05}Mn{sub 1,98}M{sub 0,02}O{sub 4} (M= Al{sup 3+} ou GA{sup 3+}) obtidos por calcinacao em mufla e microondas

    Energy Technology Data Exchange (ETDEWEB)

    Santana, L.K.; Canobre, S.C.; Amaral, F.A., E-mail: fabioamaral@yahoo.com.br [Universidade Federal de Uberlandia (UFU), MG (Brazil). Instituto de Quimica. Laboratorio de Armazenamento de Energia e Tratamento de Efluentes

    2014-07-01

    Due to the economic and environmental importance of using LiMn{sub 2}O{sub 4} as cathode batteries, the goal of this work was to synthesize LiMn{sub 2}O{sub 4} doped and undoped, comparing methods of calcination kiln and microwave. The precursors were obtained by Pechini method. The resulting samples were structurally characterized by XRD, morphology by SEM and area by B.E.T. XRD results were compared to card JCPDS 35-0782 regarding the pure LiMn{sub 2}O{sub 4}. The DRX results indicate that the calcination furnace was more efficient for obtaining doped oxides. However, the use of microwave was effective for rapid attainment of non-doped spinel close to those found for the pure spinel structural features. The surface area values confirm the existence of clusters and particles with nanometric features. Oxides synthesized in both procedures showed small, organized and highly crystalline particles, demonstrating the efficiency of the methodology and Pechini methods of calcination compared. (author)

  7. Assédio moral: o caso dos funcionários terceirizados de manutenção da Universidade Federal de Uberlândia http://dx.doi.org/10.15601/1983-7631/rt.v8n15p184-198

    Directory of Open Access Journals (Sweden)

    Filipe Fagundes

    2015-12-01

    Full Text Available Com um ambiente de trabalho cheio de pressão, a violência entre os trabalhadores vê seu desenvolvimento em resultados crescentes. O assédio moral, forma mais sutil de violência no trabalho, toma forma, ocasionando diversos danos ao indivíduo e à organização. O objetivo deste trabalho foi realizar um estudo sobre a presença do assédio moral no trabalho dos funcionários terceirizados, responsáveis pela limpeza e manutenção da Universidade Federal de Uberlândia, buscando descobrir a ocorrência desses assédios de acordo com o gênero, para verificar possíveis relações. A coleta dos dados foi realizada por meio de um questionário, aplicado com 40 funcionários. Foi possível verificar que mais de 50% dos funcionários questionados sofrem assédio moral em algum grau, sendo a maioria do sexo feminino. Em relação aos agentes agressores, verificou-se que os alunos eram os principais agressores, tendo atitudes de indiferença, humilhação pública e até violência. Já os outros agressores identificados foram os supervisores e os professores. Há a necessidade de educar todos dentro da instituição no sentido do conhecimento do que é o assédio moral, investigar os problemas e intensificar a divulgação de normas e valores sociais que regem as boas maneiras. Palavras-chave: assédio moral; saúde do trabalhador; gestão de recursos humanos.

  8. El controvertido desarrollo del deporte durante la transición democrática española (1975-1982. una aproximación a sus limitaciones y principales condicionantes = The controversial development of sport during the spanish democratic transition (1975-198

    Directory of Open Access Journals (Sweden)

    Sixte Abadía i Naudí

    2013-03-01

    Full Text Available Tras un periodo como el de la dictadura franquista (1939-1975, en el cual la actuación gubernamental en relación al fenómeno deportivo había sido, como mínimo, controvertida, la transición democrática (1975-1982 estableció un nuevo marco de actuación de los poderes públicos que posibilitaría, conjuntamente con la acción de los movimientos asociativos, la definitiva emergencia de un proceso de generalización del deporte entre la ciudadanía. Este desarrollo del deporte se contagió de la coyuntura social, política y económica característica de la transición democrática. De este modo, su evolución puede explicarse tanto a partir de los avances, acuerdos e iniciativas fruto de las políticas deportivas implementadas, como por la falta de consenso, críticas y limitaciones que constataron los movimientos asociativos y los medios de comunicación, y que explican una expansión no lineal del deporte español durante este periodo.--------------------------------------------------------------------------------After the period of Franco’s dictatorship (1939-1975, during which government action in relation to sports was to say controversial at least, democratic transition (1975-1982 established a new framework for the public authorities which allowed, in collaboration with the action of associations, the final appearance of a process of bringing sports to the masses. The development of sports was conditioned by the social, political and economical situation characteristic of the democratic transition. Thus, its evolution can be explained from the result of the sports policies implemented and from the lack of consensus, criticism and limitations found by associations and the media, and which explain a nonlinear and difficult sports development during this period.

  9. Didáctica Geográfica nº 17-2016. ISSN: 0210-492-X 277 SCOFFHAM, S. (EDITOR (2013 Teaching Geography Creatively. Learning to teach in the Primary School series. 198 pp. ISBN: 978-0-415-50819-3

    Directory of Open Access Journals (Sweden)

    ADELA TORRES MARTÍNEZ

    2016-12-01

    Full Text Available  El libro Teaching Geography Creatively, editado por Stephen Scoffham, supone una fuente de recursos y orientaciones didácticas fundamentadas en investigaciones recientes de gran interés para aquellos docentes de Infantil y Primaria que hayan decidido apostar por la creatividad en sus aulas. Estas orientaciones no solo buscan la motivación del alumnado sino que, en la línea del constructivismo, defienden la necesidad de fomentar un pensamiento crítico en ellos para construir aprendizajes con sentido y conectados realmente con su mundo. Se pretende así acabar con la idea que asocia la enseñanza de la geografía con el aprendizaje memorístico y pasivo, dentro de cuatro paredes. Tal y como hacen otros títulos de la serie en la que se integra, Learning to Teach in the Primary School, esta monografía defiende también una comunicación bidireccional en la transmisión del conocimiento (alumno-profesor, alumno-alumno y un currículo flexible que permita un aprendizaje creativo, donde el centro de atención sea el proceso de enseñanza-aprendizaje y no los resultados. 

  10. Charge radii and electromagnetic moments of At-211195

    Science.gov (United States)

    Cubiss, J. G.; Barzakh, A. E.; Seliverstov, M. D.; Andreyev, A. N.; Andel, B.; Antalic, S.; Ascher, P.; Atanasov, D.; Beck, D.; Bieroń, J.; Blaum, K.; Borgmann, Ch.; Breitenfeldt, M.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Derkx, X.; De Witte, H.; Elseviers, J.; Fedorov, D. V.; Fedosseev, V. N.; Fritzsche, S.; Gaffney, L. P.; George, S.; Ghys, L.; Heßberger, F. P.; Huyse, M.; Imai, N.; Kalaninová, Z.; Kisler, D.; Köster, U.; Kowalska, M.; Kreim, S.; Lane, J. F. W.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Marsh, B. A.; Mitsuoka, S.; Molkanov, P. L.; Nagame, Y.; Neidherr, D.; Nishio, K.; Ota, S.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Revill, J. P.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Sandhu, K.; Schweikhard, L.; Sels, S.; Truesdale, V. L.; Van Beveren, C.; Van den Bergh, P.; Wakabayashi, Y.; Van Duppen, P.; Wendt, K. D. A.; Wienholtz, F.; Whitmore, B. W.; Wilson, G. L.; Wolf, R. N.; Zuber, K.

    2018-05-01

    Hyperfine-structure parameters and isotope shifts of At-211195 have been measured for the first time at CERN-ISOLDE, using the in-source resonance-ionization spectroscopy method. The hyperfine structures of isotopes were recorded using a triad of experimental techniques for monitoring the photo-ion current. The Multi-Reflection Time-of-Flight Mass Spectrometer, in connection with a high-resolution electron multiplier, was used as an ion-counting setup for isotopes that either were affected by strong isobaric contamination or possessed a long half-life; the ISOLDE Faraday cups were used for cases with high-intensity beams; and the Windmill decay station was used for short-lived, predominantly α -decaying nuclei. The electromagnetic moments and changes in the mean-square charge radii of the astatine nuclei have been extracted from the measured hyperfine-structure constants and isotope shifts. This was only made possible by dedicated state-of-the-art large-scale atomic computations of the electronic factors and the specific mass shift of atomic transitions in astatine that are needed for these extractions. By comparison with systematics, it was possible to assess the reliability of the results of these calculations and their ascribed uncertainties. A strong deviation in the ground-state mean-square charge radii of the lightest astatine isotopes, from the trend of the (spherical) lead isotopes, is interpreted as the result of an onset of deformation. This behavior bears a resemblance to the deviation observed in the isotonic polonium isotopes. Cases for shape coexistence have been identified in At,199197, for which a significant difference in the charge radii for ground (9 /2- ) and isomeric (1 /2+ ) states has been observed.

  11. Human radiation studies: Remembering the early years: Oral history of Dr. Patricia Wallace Durbin, Ph.D., conducted November 11, 1994

    International Nuclear Information System (INIS)

    1995-07-01

    This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches

  12. ORF Alignment: NC_003063 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 231 ... Query: 198 LDAALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVELL 257 ... LDA...ALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVELL Sbjct: 9 ... LDAALRGAEITQKRATELQAKDVGTVAASDNAQVALDQARANVVAGEAAISSAKANVEL

  13. ORF Alignment: NC_006841 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 4] ... Length = 122 ... Query: 139 SHKHPHILIVEDDAIQSKLLQAYLKSNFSITATTNGREALQFLQHNTVDLIISDIQMPEM 198 ... SHKHPHILIVEDDA...IQSKLLQAYLKSNFSITATTNGREALQFLQHNTVDLIISDIQMPEM Sbjct: 1 ... SHKHPHILIVEDDA

  14. ORF Alignment: NC_004113 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VLYSLQTRLRFEDVDLPLLAKRPVKTV 60 ... Query: 139 YSGLEQIPSASEAGQIASELLSLFLSETVDRVELIYTKFVSLISSKPVVQTLLPLDPQGL 198 ... YSGLEQIPSAS...EAGQIASELLSLFLSETVDRVELIYTKFVSLISSKPVVQTLLPLDPQGL Sbjct: 121 YSGLEQIPSASEAGQIASELLSLFLSETVDRVELIYTKFVSLISSKPVVQTLLPLDPQGL 180 ...

  15. ORF Alignment: NC_004557 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available INKDIIKRRSGYNIEIKKVLVKDINKKRDLKIPEDLITTDVDEILEDPSIDIVVE 75 ... Query: 139 IHGLTESLTANKINEVIGIINGTTNYILTKMTLDGLSFEEALKEAQQKGYAEADPTSD...IE 198 ... IHGLTESLTANKINEVIGIINGTTNYILTKMTLDGLSFEEALKEAQQKGYAEADPTSDIE Sbjct: 136 IHGLTESLTANKINEVIGIINGTTNYILTKMTLDGLSFEEALKEAQQKGYAEADPTSDIE 195 ...

  16. 42 CFR 81.23 - Guidelines for cancers for which primary site is unknown.

    Science.gov (United States)

    2010-10-01

    ...), 189 (M). Brain and spinal cord (198.3) 162, 172 (M), 174 (F). Other parts of nervous system (198.4) 162, 172 (M), 174 (F), 185 (M), 202. Bone and bone marrow (198.5) 162, 174 (F), 185 (M). Ovary (198.6...

  17. Report on the behalf of the Commission for Foreign Affairs, Defence and Armed Forces on the bill project authorizing the ratification of the association agreement between the European Union and the European Atomic Energy Community and their member States, on the one hand, and the Republic of Moldova, on the other hand (accelerated procedure) - Nr 283. Bill project - Nr 198. Law nr 2015-472 of the 27 April 2015

    International Nuclear Information System (INIS)

    Durrieu, Josette; Valls, Manuel; Fabius, Laurent; Hollande, Francois

    2015-01-01

    In its first part, this report presents Moldova as a State marked by the influence of powerful neighbours: a young State marked by a conflict since its birth, a Moldovan identity with several minorities, a fragile economy. It describes the rapprochement process with the European Union (within the frame of a re-balancing of East-West relationships, and with a confirmed European orientation). It outlines the privileged relationships with France (France is one of the main investors). The second part discusses the association agreement as a new chapter of the relationships between the EU and Moldova. This agreement is presented as a result of a long rapprochement process, and is discussed as an agreement of political association and economic integration including cooperation aspects and deep and comprehensive free trade, and also as a strengthened framework for dialogue. The expected effects for the EU as well as for Moldova are reviewed. A sheet of data and facts and maps are provided in appendix. The rest of this huge document reports the Commission's discussion, the motivations for this agreement, the report of the impact study, the large text of the agreement, and the text of the bill project authorizing the ratification of the agreement

  18. Un cas d’infection à Dracunculoidea en Polynésie française

    Czech Academy of Sciences Publication Activity Database

    Bercion, R.; Heaulme, M.; Viant, E.; Moravec, František; Bain, O.

    2010-01-01

    Roč. 70, č. 2 (2010), s. 198-198 ISSN 0025-682X Institutional research plan: CEZ:AV0Z60220518 Keywords : Dracunculoidea * acute arthritis * French Polynesia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine

  19. 10 CFR Appendix L to Part 110 - Illustrative List of Byproduct Materials Under NRC Export/Import Licensing Authority a

    Science.gov (United States)

    2010-01-01

    ... material produced, extracted, or converted for use for a commercial, medical, or research activity...) Gallium 72 (Ga 72) Germanium 68 (Ge 68) Germanium 71 (Ge 71) Gold 198 (Au 198) Gold 199 (Au 199) Hafnium...

  20. Glomerular filtration rate after alpha-radioimmunotherapy with 211At-MX35-F(ab')2: a long-term study of renal function in nude mice

    DEFF Research Database (Denmark)

    Back, T.; Haraldsson, B.; Hultborn, R

    2009-01-01

    of the glomerular filtration rate (GFR). The renal toxicity was evaluated at levels close to the dose limit for the bone marrow and well within the range for therapeutic efficacy on tumors. Astatinated MX35-F(ab')(2) monoclonal antibodies were administered intravenously to nude mice. Both non-tumor-bearing animals...... manifested late. Examination of the kidney sections showed histologic changes that were overall subdued. Following alpha-RIT with (211)At-MX35-F(ab')(2) at levels close to the dose limit of severe myelotoxicity, the effects found on renal function were relatively small, with only minor to moderate reductions...... in GFR. These results suggest that a mean absorbed dose to the kidneys of approximately 10 Gy is acceptable, and that the kidneys would not be the primary dose-limiting organ in systemic alpha-RIT when using (211)At-MX35-F(ab')(2) Udgivelsesdato: 2009/12...

  1. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  2. Chemical concentration of a new natural spontaneously fissionable nuclide from solutions with low salt background

    International Nuclear Information System (INIS)

    Korotkin, Yu.S.; Ter-Akop'yan, G.M.; Popeko, A.G.; Drobina, T.P.; Zhuravleva, E.L.

    1982-01-01

    The results of experiments on further concentration of a new natural spontaneously fissionable nuclide, the concentrates of which form the Cheleken geothermal brines have been obtained, are presented. The conclusions are drown about the chemical nature of a new spontaneously fissionable nuclide. It is a chalcophile element which copreipitates with sulphides of copper, lead, arsenic and mercury from weakly acid solutions. The behaviour of the new nuclide in sulphide systems in many respects is similar to the behaviour of polonium, astatine and probably of bismuth. The most probable stable valence of the new nuclide varies from +1 up to +3. The data available on the chemical behaviour of the new nuclide as well as the analysis over contamination by spontaneously fissionable isotopes permit to state that the new natural spontaneously fissionable nuclide does not relate to the known isotopes

  3. Is Electronegativity a Useful Descriptor for the 'Pseudo-Alkali-Metal' NH4?

    International Nuclear Information System (INIS)

    Whiteside, Alexander; Xantheas, Sotiris S.; Gutowski, Maciej S.

    2011-01-01

    Molecular ions in the form of 'pseudo-atoms' are common structural motifs in chemistry, with properties that are transferrable between different compounds. We have determined the electronegativity of the 'pseudo-alkali metal' ammonium (NH4) and evaluated its reliability as a descriptor in comparison to the electronegativities of the alkali metals. The computed properties of its binary complexes with astatine and of selected borohydrides confirm the similarity of NH4 to the alkali metal atoms, although the electronegativity of NH4 is relatively large in comparison to its cationic radius. We paid particular attention to the molecular properties of ammonium (angular anisotropy, geometric relaxation, and reactivity), which can cause deviations from the behaviour expected of a conceptual 'true alkali metal' with this electronegativity. These deviations allow for the discrimination of effects associated with the polyatomic nature of NH4.

  4. Boiling points of the superheavy elements 117 and 118

    International Nuclear Information System (INIS)

    Takahashi, N.

    2001-01-01

    It has been shown that the relativistic effect on the electrons reveal in the heavy element region. What kind of changes will appear in the heavy elements because of the relativistic effects? Can we observe the changes? We observed that the boiling points of astatine and radon are lower than that extrapolated values from lighter elements in the same groups. Systematic behavior of the elements on the boiling point was examined and a new method for the estimation of the boiling points of the superheavy elements in the halogen and rare gases has been found. The estimated values of the elements 117 and 118 are 618 and 247 K, respectively which are considerably lower than those obtained until now. If these values are correct the production of the superheavy elements with heavy ions reaction may be affected. Further, the chemical properties may be fairly different from the lighter elements. (author)

  5. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...... and much less is known of high-LET irradiation. In this paper we investigated the DNA damage response and biological consequences to photons from Cobolt-60 ((60)Co) and alpha particles from (211)At in normal primary thyrocytes of different cell cycle status. For both radiation qualities the intensity...

  6. ORF Alignment: NC_004461 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ion ... SMC protein, putative [Staphylococcus epidermidis RP62A] ... Length = 198 ... Query: 3 ... YLKSIDAIGFKSFADHT...NVQFDKGVTAIVGPNGSGKSNITDAIKWVLGEQSAKSLRGAKM 62 ... YLKSIDAIGFKSFADHT...NVQFDKGVTAIVGPNGSGKSNITDAIKWVLGEQSAKSLRGAKM Sbjct: 1 ... YLKSIDAIGFKSFADHTNVQFDKGVTAIVGPNGSGKSNITDA

  7. ORF Alignment: NC_004557 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Clostridium tetani E88] ... Length = 226 ... Query: 78 ... IKLAVILAAGLGSRLNSVTEDNIPKGMLEIEGKSLVERSINNLFENGIE...RIIIVTGHLNN 137 ... IKLAVILAAGLGSRLNSVTEDNIPKGMLEIEGKSLVERSINNLFENGIE...RIIIVTGHLNN Sbjct: 1 ... IKLAVILAAGLGSRLNSVTEDNIPKGMLEIEGKSLVERSINNLFENGIERIIIVTGHLNN 60 ... Query: 198 DKKDCVLL

  8. ORF Alignment: NC_002935 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available tein ... [Corynebacterium diphtheriae] ... Length = 153 ... Query: 139 PAIPDDGPEIIVMTHPLDNVSEIDDV...HAEFLDQPDDDWLELYHFRGKALPRHALELLRTT 198 ... PAIPDDGPEIIVMTHPLDNVSEIDDVHAEFL...DQPDDDWLELYHFRGKALPRHALELLRTT Sbjct: 1 ... PAIPDDGPEIIVMTHPLDNVSEIDDVHAEFLDQPDDDWLELYHFRGKALPRHALELLRTT 60 ... Qu

  9. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available erase ... family [Azoarcus sp. EbN1] ... Length = 198 ... Query: 102 HGCGQDXXXXXXXXXXXXXXXXXXXXVLLPEQASEAN...PNRCWNWFGREPVVAMEAAILKA 161 ... HGCGQD ... VLLPEQASEAN...PNRCWNWFGREPVVAMEAAILKA Sbjct: 23 ... HGCGQDSASFAATTRAAANARAGGYAVLLPEQASEANPNRCWNWFGREPVVAMEAAILKA 82 ... Quer

  10. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ding ... response regulator [Azoarcus sp. EbN1] ... Length = 243 ... Query: 139 GRSRAMQDLYQKVLRVAASEAN...VLITGESGVGKELVARALHDNSTRAKGPYVAVHCASLP 198 ... GRSRAMQDLYQKVLRVAASEAN...VLITGESGVGKELVARALHDNSTRAKGPYVAVHCASLP Sbjct: 1 ... GRSRAMQDLYQKVLRVAASEANVLITGESGVGKELVARALHDNSTRAKGPYVAVHCAS

  11. ORF Alignment: NC_006361 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available nsporter ... [Nocardia farcinica IFM 10152] ... Length = 119 ... Query: 139 AGQYMTPEVVALPSDLTVAEA...LATVRAKGAHAETVYTLPVVDSGRRLTGIVELRELVLAR 198 ... AGQYMTPEVVALPSDLTVAEALATVR...AKGAHAETVYTLPVVDSGRRLTGIVELRELVLAR Sbjct: 1 ... AGQYMTPEVVALPSDLTVAEALATVRAKGAHAETVYTLPVVDSGRRLTGIVELRELVLAR 60 ...

  12. ORF Alignment: NC_005955 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... quintana str. Toulouse] ... Length = 198 ... Query: 11 ... ALRAFERGEILVVTDDNDRENEGDLTVAAVHCTEEKMAFIIRHTTGIVCAPM...LKEEAQRF 70 ... ALRAFERGEILVVTDDNDRENEGDLTVAAVHCTEEKMAFIIRHTTGIVCAPM...LKEEAQRF Sbjct: 1 ... ALRAFERGEILVVTDDNDRENEGDLTVAAVHCTEEKMAFIIRHTTGIVCAPMLKEEAQRF 60 ... Query: 131 PLIAHEGG

  13. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ADACRLLGDRAYRLCLTDMRLPDGDGIELVAHIQTQQPGLPVAVV 78 ... Query: 150 AALAQLRVQVEKLARNQAPVFIHGESGTGKEVTARLIHELGPRAAGPFVPV...NCGAISPEL 209 ... AALAQLRVQVEKLARNQAPVFIHGESGTGKEVTARLIHELGPRAAGPFVPVNCGAISPEL Sbjct: 139 AALAQLR...VQVEKLARNQAPVFIHGESGTGKEVTARLIHELGPRAAGPFVPVNCGAISPEL 198 ... Query: 270 GAHAEESVDVR

  14. Resonance – Journal of Science Education | News

    Indian Academy of Sciences (India)

    Science Academies' Refresher Course in Statistical Physics · More Details Fulltext PDF. pp 197-197 Information and Announcements. Science Academies' Refresher Course on Modern Biiotechnology: Concepts and Practice · More Details Fulltext PDF. pp 198-198 Information and Announcements. Forty Ninth Refresher ...

  15. Epimedium koreanum Nakai Water Extract Exhibits Antiviral Activity against Porcine Epidermic Diarrhea Virus In Vitro and In Vivo

    Directory of Open Access Journals (Sweden)

    Won-Kyung Cho

    2012-01-01

    Full Text Available Porcine epidemic diarrhea virus (PEDV causes diarrhea of pigs age-independently and death of young piglets, resulting in economic loss of porcine industry. We have screened 333 natural oriental herbal medicines to search for new antiviral candidates against PEDV. We found that two herbal extracts, KIOM 198 and KIOM 124, contain significant anti-PED viral effect. KIOM 198 and KIOM 124 were identified as Epimedium koreanum Nakai and Lonicera japonica Thunberg, respectively. The further plaque and CPE inhibition assay in vitro showed that KIOM 198 has much stronger antiviral activity than KIOM 124. Additionally, KIOM 198 exhibited a similar extent of antiviral effect against other subtypes of Corona virus such as sm98 and TGE viruses. Cytotoxicity results showed that KIOM 198 is nontoxic on the cells and suggest that it can be delivered safely for therapy. Furthermore, when we orally administered KIOM 198 to piglets and then infected them with PEDV, the piglets did not show any disease symptoms like diarrhea and biopsy results showed clean intestine, whereas control pigs without KIOM 198 treatment exhibited PED-related severe symptoms. These results imply that KIOM 198 contains strong antiviral activity and has a potential to be developed as an antiviral phytomedicine to treat PEDV-related diseases in pigs.

  16. Is parental age related to the risk of Alzheimer's disease

    NARCIS (Netherlands)

    C.M. van Duijn (Cornelia); W. Schulte (Wim); T.A. Tanja (Teun); R. Haaxma (Rob); A.J. Lameris; R.J. Saan; A. Hofman (Albert)

    1990-01-01

    textabstractAdvanced maternal and paternal age were investigated as putative risk factors for AD in 198 clinically diagnosed Alzheimer patients and in 198 randomly selected healthy controls. No significant differences in average age of fathers and of mothers at birth of the subject were observed.

  17. 76 FR 45879 - West, a Thomson Reuters Business, Thomson Reuters Legal, Including On-Site Leased Workers From...

    Science.gov (United States)

    2011-08-01

    ... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-73,198] West, a Thomson Reuters Business, Thomson Reuters Legal, Including On-Site Leased Workers From Adecco, Including a Teleworker...-W-73,198 is hereby issued as follows: All workers of West, A Thomson Reuters Business, Thomson...

  18. Transgenní miniprasata pro Huntingtonovu nemoc

    Czech Academy of Sciences Publication Activity Database

    Hodanová, J.; Juhásová, Jana; Valeková, Ivona; Rausová, Petra; Jozefovičová, M.; Juhás, Štefan

    2015-01-01

    Roč. 198, č. 3 (2015), s. 198-205 ISSN 0506-8231 R&D Projects: GA MŠk ED2.1.00/03.0124; GA MŠk(CZ) 7F14308; GA TA ČR(CZ) TA01011466 Institutional support: RVO:67985904 Keywords : Huntington´s disease Subject RIV: EB - Genetic s ; Molecular Biology

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 198 of 198 ... Issue, Title ... scheme for QoS and energy conservation in cloud computing, Abstract PDF ... Vol 9, No 1 (2013), Performance and Security Evaluation of ... Vol 18, No 1 (2017), Reducing capital flight through local cloud ...

  20. The Impact of Locus of Control on Language Achievement

    Science.gov (United States)

    Nodoushan, Mohammad Ali Salmani

    2012-01-01

    This study hypothesized that students' loci of control affected their language achievement. 198 (N = 198) EFL students took the Rotter's (1966) locus of control test and were classified as locus-internal (ni = 78), and locus-external (ne = 120). They then took their ordinary courses and at the end of the semester, they were given their exams.…

  1. A journey through the stylistics of poetry

    DEFF Research Database (Denmark)

    Jensen, Kim Ebensgaard

    2015-01-01

    Review of Peter Verdonk, The Stylistics of Poetry: Context, Cognition, Discourse, History. (Series: Advances in Stylistics). London: Bloomsbury, 2013, xi + 198 pp., ISBN 978-1-4411-5878-9.......Review of Peter Verdonk, The Stylistics of Poetry: Context, Cognition, Discourse, History. (Series: Advances in Stylistics). London: Bloomsbury, 2013, xi + 198 pp., ISBN 978-1-4411-5878-9....

  2. Impact of galactic and intergalactic dust on the stellar EBL

    Czech Academy of Sciences Publication Activity Database

    Vavryčuk, Václav

    2016-01-01

    Roč. 361, č. 6 (2016), 198/1-198/8 ISSN 0004-640X Institutional support: RVO:67985530 Keywords : cosmic background radiation * interstellar dust * light extinction * universe opacity Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.622, year: 2016

  3. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 198 of 198 ... Vol 5, No 1 (2007), Strategic violence-prevention partnerships in a peri-urban ... patriarchal and racist past in addressing post-apartheid sexual violence ... in the public space: reconstruction of a train fire in India, Abstract.

  4. Draft Genome Sequences of 64 Salmonella enterica subsp. enterica Enteritidis Isolates from Mice in US

    Science.gov (United States)

    A ciprofloxacin resistant (CipR) Salmonella enterica subsp. enterica serovar Kentucky ST198 has rapidly and extensively disseminated globally to become a major food-safety and public health concern. Here, we report a complete genome sequence of a CipR S. Kentucky ST198 strain PU131 isolated from a ...

  5. A critical analysis of the new equal pay provisions relating to atypical ...

    African Journals Online (AJOL)

    Keywords: Equal pay; Labour Relations Act; equal pay for atypical employees; atypical employment; sections 198A-198D of the Labour Relations Act; Agency Workers Regulations 2010; Fixed-term Employees (Prevention of Less Favourable Treatment) Regulations 2002; Part-time Workers (Prevention of Less Favourable ...

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 198 of 198 ... Vol 2, No 5 (2008), Simple heterochromia Iridis: a case report, Abstract. CO Omolase. Vol 5, No 6 (2010), Smoking Habit and Self Reported Periodontal ... The Clinical Pattern and Complications of Severe Malaria in Parts ...

  7. On the theory of time dilation in chemical kinetics

    Science.gov (United States)

    Baig, Mirza Wasif

    2017-10-01

    The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

  8. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    Energy Technology Data Exchange (ETDEWEB)

    Nestor, Marika, E-mail: marika.nestor@bms.uu.s [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden); Sundstroem, Magnus [Unit of Molecular Pathology, Department of Genetics and Pathology, Uppsala University (Sweden); Anniko, Matti [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden)

    2011-01-15

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ({sup 211}At-cMAb U36). Effects on {sup 211}At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with {sup 211}At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced {sup 211}At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  9. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  10. Development and radiotherapeutic application of 211At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    International Nuclear Information System (INIS)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131 I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211 At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211 At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated

  11. Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

  12. Alpha particle emitters in medicine

    International Nuclear Information System (INIS)

    Fisher, D.R.

    1989-09-01

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ( 211 At) and natural bismuth-212 ( 212 Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ( 223 Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs

  13. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  14. The radiolabeled monoclonal antibodies in immunoscintigraphy and radioimmunotherapy: current state and perspectives

    International Nuclear Information System (INIS)

    Chatal, J. F.

    2000-01-01

    The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)

  15. Nuclear and chemical data for life sciences

    International Nuclear Information System (INIS)

    Moumita Maiti; Indian Institute of Technology Roorkee, Roorkee, Uttarakhand

    2013-01-01

    Use of reactor produced radionuclides is popular in life sciences. However, cyclotron production of proton rich radionuclides are being more focused in recent times. These radionuclides have already gained attention in various fields, including life sciences, provided they are obtained in pure form. This article is a representative brief of our contributions in generating nuclear data for the production of proton rich radionuclides of terbium, astatine, technetium, ruthenium, cadmium, niobium, zirconium, rhenium, etc., which may have application in clinical, biological, agriculture studies or in basic research. The chemical data required to separate the product isotopes from the corresponding target matrix have been presented along with a few propositions of radiopharmaceuticals. It also emphasizes on the development of simple empirical technique, based on the nuclear reaction model analysis, to generate reliable nuclear data for the estimation of yield and angular distribution of emitted neutrons and light charged particles from light as well as heavy ion induced reactions on thick stopping targets. These data bear utmost important in radiation dosimetry. (author)

  16. Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

    Energy Technology Data Exchange (ETDEWEB)

    Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se

    2005-08-01

    Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

  17. The in vivo fate of a 211At labelled monoclonal antibody with known specificity in a murine system

    International Nuclear Information System (INIS)

    Vaughan, A.T.M.; Bateman, W.J.; Fisher, D.R.

    1982-01-01

    A monoclonal antibody reactive against the human transferrin receptor has been labelled with the alpha and X ray emitting isotope Astatine 211. The labelling procedure does not affect the ability of the product to bind to the transferrin receptor on the human leukemic cell line HL60. Using a direct binding assay, 211 At labelled antibody can be specifically inhibited from binding to its target cells by excess unlabelled antibody. Furthermore, the binding inhibition demonstrated in this system correlates to enhanced clonogenic survival of these cells, indicating that very few atoms of 211 At/cell are required for cell death. Data obtained from labelled antibody injected into mice show that the labelled product in serum retains the ability to bind to HL60 cells in vitro, although tissue distributions of the injected activity implies that some of the radiolabel is lost from the protein. Despite this loss of label, preliminary experiments on the localization of labelled antibody to HL60 cells growing s/c in nude mice show that tumor tissue has a higher specific activity than all other tissues, other than blood, after 12 hours. This suggests that further work on the nature of label degradation in vivo is warranted in the context of potential therapeutic and diagnostic studies

  18. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    International Nuclear Information System (INIS)

    Nestor, Marika; Sundstroem, Magnus; Anniko, Matti; Tolmachev, Vladimir

    2011-01-01

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ( 211 At-cMAb U36). Effects on 211 At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211 At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211 At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  19. Biological toxicity of intracellular radionuclide decay. Part of a coordinated programme on radiation biology of Auger emitters and their therapeutic applications

    International Nuclear Information System (INIS)

    Hofer, K.G.

    1980-06-01

    Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125 I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125 I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125 I-labelled Synkavit would be desirable for clinical application

  20. 211At-labelling of polymer particles for radiotherapy: synthesis, purification and stability

    International Nuclear Information System (INIS)

    Larsen, R.H.; Hassfjell, S.P.; Hoff, P.; Alstad, J.; Bjoergum, J.

    1993-01-01

    Cyclotron-produced 211 At was distilled from a Bi metal target and coupled to N-succinimidyl-3-(trimethylstannyl)benzoate. The resulting N-succinimidyl-3-( 211 At)astatobenzoate was thereafter coupled to aminated monosized polymer particles with a diameter of 1.8 μm. The total time elapsed from the end of the cyclotron irradiation until the final product was prepared was about 2.5 hours. From 23 to 51% of the target activity at the end of bombardment was measured in the final conjugate. Solid-liquid extraction purification of the astatinated intermediate, using Sep-pak columns (Waters), gave more reproducible yields in the final conjugation step. The 211 At-labelled particles were incubated with fetal calf serum, human serum and human full blood at room temperature. The 211 At activity on the particles was measured before and after three times washing at 4, 24 and 48 hours. The stability was not significantly different from 100% for all media and for all time points. This indicates that 211 At-labelled particles can be stable under in vivo conditions, and may thereby be a promising agent for intracavitary radiotherapy on free-floating cancer cells or surface fixed cells. (Author)

  1. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  2. Development of Reagents for Application of At-211 to Targeted Radionuclide Therapy of Cancer

    International Nuclear Information System (INIS)

    Wilbur, D. Scott

    2011-01-01

    This grant covered only a period of 4 months as the major portion of the award was returned to DOE due to an award of funding from NIH that covered the same research objectives. A letter regarding the termination of the research is attached as the last page of the Final Report. The research conducted was limited due to the short period of this grant, but the results obtained in that period are outlined in the Final Report. The studies addressed in the research effort were directed at a problem that is of critical importance to the in vivo application of the alpha-particle emitting radionuclide At-211. That problem, low in vivo stability of many astatinated molecules, severely limits the use of At-211 in therapeutic applications. The advances sought in the studies were expected to expand the types of biomolecules that can be used as carriers of At-211, and provide improved in vivo targeting of the radiation dose compared with the dose delivered to normal tissue.

  3. Proceedings of transuranium elements

    International Nuclear Information System (INIS)

    Anon.

    1992-01-01

    The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium

  4. Novel Therapeutic Effects of Leonurine On Ischemic Stroke: New Mechanisms of BBB Integrity

    Directory of Open Access Journals (Sweden)

    Qiu-Yan Zhang

    2017-01-01

    Full Text Available Stroke is a leading cause of morbidity and mortality globally. Leonurine (also named SCM-198, a compound extracted from Herba leonuri, was effective on the prevention of various cardiovascular and brain diseases. The purpose of this study was to explore the possible therapeutic potential of SCM-198 against ischemia reperfusion injury and underlying mechanisms. In the in vivo transient middle cerebral artery occlusion (tMCAO rat model, we found that treatment with SCM-198 could decrease infarct volume and improve neurological deficit by protecting against blood-brain barrier (BBB breakdown. In the in vitro model of cell oxygen-glucose deprivation and reoxygenation (OGD/R, consistent results were obtained with decreased reactive oxygen species (ROS production and maintained the BBB integrity. Further study demonstrated that SCM-198 increased the expression of histone deacetylase- (HDAC- 4 which could inhibit NADPH oxidase- (NOX- 4 and matrix metalloproteinase- (MMP- 9 expression, resulting in the elevation of tight junction proteins, including claudin-5, occludin, and zonula occluden- (ZO- 1. These results indicated SCM-198 protected BBB integrity by regulating the HDAC4/NOX4/MMP-9 tight junction pathway. Our findings provided novel insights into the protective effects and mechanisms of SCM-198 on ischemic stroke, indicating SCM-198 as a new class of potential drug against acute onset of ischemic stroke.

  5. Investigation of the Transcriptome of Prairie Cord Grass, a New Cellulosic Biomass Crop

    KAUST Repository

    Gedye, Kristene; Gonzalez-Hernandez, Jose; Ban, Yuguang; Ge, Xijin; Thimmapuram, Jyothi; Sun, Fengjie; Wright, Chris; Ali, Shahjahan; Boe, Arvid; Owens, Vance

    2010-01-01

    in this paper describes the first investigation of the transcriptome of prairie cordgrass via Next Generation Sequencing Technology, 454 GS FLX. A total of 556,198 expressed sequence tags (ESTs) were produced from four prairie cordgrass tissues: roots, rhizomes

  6. Variation in leaf anatomy within the Elytrigia intermedia – E. ×mucronata – E. repens (Poaceae) hybrid complex

    Czech Academy of Sciences Publication Activity Database

    Paštová, Ladislava

    2017-01-01

    Roč. 23, č. 2 (2017), s. 187-198 ISSN 1310-7771 Institutional support: RVO:67985939 Keywords : hybrid * leaf blade selection * micromorphology Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany

  7. Kunstivaldkonna tähtsus : seos avalike eesmärkidega / Alberta Arthurs, Frank Hodsoll ; tõlk. Johanna Ross

    Index Scriptorium Estoniae

    Arthurs, Alberta

    2008-01-01

    Originaali pealkiri: The importance of the arts sector : how it relates to the public purpose // The Journal of Arts Management, Law and Society. Vol. 28, nr. 2, lk. 102-108. Lühidalt autoritest lk. 198

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 198 ... African Safety Promotion: A Journal of Injury and Violence Prevention. ... for domestic violence management and prevention in Emergency Care, Abstract PDF ... E de Beer, K Groenewald, S Nkosi, E van Niekerk, L Vermaak.

  9. Is the motivation to become a teacher related to pre-service teachers' intentions to remain in the profession?

    NARCIS (Netherlands)

    Bruinsma, Marjon; Jansen, Ellen P. W. A.

    2010-01-01

    This study investigated 198 pre-service teachers' intrinsic and extrinsic motivation for becoming teachers and focused on the distinction between adaptive motives, which promote lasting and effective engagement, and maladaptive motives, which promote superficial engagement. We examined the

  10. The HP 9825 A program for the determination of an isotope half-life

    International Nuclear Information System (INIS)

    Jujuratisbela, Uju.

    1980-01-01

    Determination of half life of gold 198, indium 116, manganese 56, copper 64 are presented, using least squares method in HP 9825 A. This method is more accurate and needs less time than graphic method. (author tr.)

  11. Gender, vulnerability, and violence in urban Pakistan | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2016-09-30

    Sep 30, 2016 ... SERIES: IMPACT STORIES | SAFE AND INCLUSIVE CITIES ... and violence in urban Pakistan (PDF, 198KB) and about the Safe and Inclusive Cities initiative. ... Economic growth is driving population growth in Indian cities, ...

  12. Martinez-Romero et al., Afr J Tradit Complement Altern Med. (2016 ...

    African Journals Online (AJOL)

    acer

    198 ... Conclusion: It was possible to know and discuss the variety of applications of the Neem tree, including the bark, leaves, fruit, flowers, and roots, each with very favorable ... antifungal, dermatological, and dental agent. This oil has been ...

  13. Antifouling Compounds from Marine Invertebrates.

    Science.gov (United States)

    Qi, Shu-Hua; Ma, Xuan

    2017-08-28

    In this review, a comprehensive overview about the antifouling compounds from marine invertebrates is described. In total, more than 198 antifouling compounds have been obtained from marine invertebrates, specifically, sponges, gorgonian and soft corals.

  14. Radiation protection in brachytherapy

    International Nuclear Information System (INIS)

    Benitez, Manuel

    1996-02-01

    It covers technical procedures in medical applications for cancer treatment. Radiation protection principles in brachytherapy. Medical uses in therapy for Sr-90, Cs-137, Co-60, Ra-226, Ir-192, Au-198, Bi-214, Pb-214. (The author)

  15. Preventing Catastrophe: U.S. Policy Options for the Management of Nuclear Weapons in South Asia

    National Research Council Canada - National Science Library

    Wojtyaiak, Martin

    2001-01-01

    The "peaceful nuclear explosion" of an Indian device in 1974 was a watershed event that called upon the U,S to focus its nonproliferation policy in South Asia, During the mid-198Os, Pakistan developed...

  16. Antifouling Compounds from Marine Invertebrates

    OpenAIRE

    Qi, Shu-Hua; Ma, Xuan

    2017-01-01

    In this review, a comprehensive overview about the antifouling compounds from marine invertebrates is described. In total, more than 198 antifouling compounds have been obtained from marine invertebrates, specifically, sponges, gorgonian and soft corals.

  17. The impact of changes in labour broking on an integrated petroleum and chemical company

    Directory of Open Access Journals (Sweden)

    Yvonne T. Joubert

    2017-05-01

    Contribution / value-add: The study represents original research, extending the current body of knowledge on the perceptions of employees in the human resources department regarding the changes to section 198 of the LRA.

  18. Naše první zkušenosti s infekcemi vyvolanými Arthroderma benhamiae (Trichophyton sp.)

    Czech Academy of Sciences Publication Activity Database

    Skořepová, M.; Hubka, Vít; Polášková, S.; Stará, J.; Čmoková, A.

    2014-01-01

    Roč. 89, č. 4 (2014), s. 192-198 ISSN 0009-0514 Grant - others:Universita Karlova(CZ) 1344214 Institutional support: RVO:61388971 Keywords : Arthroderma benhamiae * dermatophytoses * Trichophyton sp. Subject RIV: EE - Microbiology, Virology

  19. African Journal of Traditional, Complementary and Alternative ...

    African Journals Online (AJOL)

    org/10.21010/ajtcam.v13i6.9 .... Muhammad Abuzar Ghaffari, Bashir Ahmed Chaudhary, Muhammad Uzair, Khuram Ashfaq, 194-198 ... Abdelkader Benhelima, Zohra Kaid-Omar, Houari Hemida, Tarek Benmahdi, Ahmed Addou, 204-214.

  20. 杨梅叶水溶性提取物的抗氧化、抗菌活性与防腐应用

    Czech Academy of Sciences Publication Activity Database

    君酸, 杨.; 云酸, 朱.; 清酸, 吴.; 洁酸, 尹.; Langhansová, Lenka; Vaněk, Tomáš; 生酸, 高.

    2014-01-01

    Roč. 28, č. 2 (2014), s. 198-202 ISSN 1006-2513 Institutional support: RVO:61389030 Keywords : Myrica rubra leaf * antioxidation * antisepsis Subject RIV: EF - Botanics http://d.g.wanfangdata.com.cn/Periodical_zgsptjj201402029.aspx

  1. Formation of less-known structurally complex ζb and orthorhombic quasicrystalline approximant εn on solidification of selected Al–Pd–Cr alloys

    Czech Academy of Sciences Publication Activity Database

    Adamech, A.; Černičková, I.; Ďuriška, L.; Kolesár, V.; Drienovský, M.; Bednarčík, J.; Svoboda, Milan; Janovec, J.

    2014-01-01

    Roč. 97, NOV (2014), s. 189-198 ISSN 1044-5803 Institutional support: RVO:68081723 Keywords : complex metallic alloys * aluminium alloys * intermetallics Subject RIV: JG - Metallurgy Impact factor: 1.845, year: 2014

  2. Search Results | Page 9 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 81 - 90 of 198 ... This trend is expected to continue and intensify in developing ... Evaluating New Chilean National Regulations on the Food Supply ... Argentina is one of the world's highest consumers of sugar-sweetened beverages ...

  3. Search Results | Page 3 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 21 - 30 of 198 ... Home · Project; Food, Environment, and Health .... Reducing dietary related risks associated with non-communicable diseases in Bangladesh ... The most direct and effective method for reducing tobacco consumption is ...

  4. Long-lasting imprint of former glassworks on vegetation pattern in an extremely species-rich grassland: A battle of species pools on mesic soils

    Czech Academy of Sciences Publication Activity Database

    Hájek, M.; Dresler, P.; Hájková, Petra; Hettenbergerová, E.; Milo, P.; Plesková, Z.; Pavonič, M.

    2017-01-01

    Roč. 20, č. 7 (2017), s. 1233-1249 ISSN 1432-9840 Institutional support: RVO:67985939 Keywords : biodiversity * phosphorus * soil magnetims * archaeology Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 4.198, year: 2016

  5. Treatment with radioactive drugs

    International Nuclear Information System (INIS)

    McDougall, I.R.

    1978-01-01

    The use of 131 I in the treatment of thyroid diseases is described. The therapeutic possibilities of application for ther radionuklide, e.g. phosphorus 32, gold 198, or yttrium 90 are discussed. (VJ) [de

  6. English in the Czech Republic: Linguists’ perspectives

    Czech Academy of Sciences Publication Activity Database

    Kaderka, Petr; Prošek, Martin

    -, č. 28 (2014), s. 173-198 ISSN 0933-1883 Institutional support: RVO:68378092 Keywords : language situation * English as a global language * attitudes towards English * national language institution * sociolinguistics * Czech Republic Subject RIV: AI - Linguistics

  7. Andalusi sherds from Prague

    Czech Academy of Sciences Publication Activity Database

    Charvát, Petr; Hrdlička, Ladislav; Delery, C.

    2013-01-01

    Roč. 65, č. 1 (2013), s. 198-206 ISSN 0323-1267 Institutional support: RVO:67985912 Keywords : Middle Ages * Prague * commerce * Spain * Almohad empire Subject RIV: AC - Archeology, Anthropology, Ethnology

  8. Temperature Dependence of the Stability of Ion Pair Interactions ...

    Indian Academy of Sciences (India)

    The occurrence of bridging water molecules between the ions ensures that the ions are not ... The structural features that render this thermostability ..... dehydrogenase single site mutant T198I from Thermus thermophilus with PDB ID 1BDM.

  9. Nové velké laserové projekty Evropské unie v ČR

    Czech Academy of Sciences Publication Activity Database

    Rohlena, Karel

    2010-01-01

    Roč. 60, č. 4 (2010), 197-198 ISSN 0009-0700 Institutional research plan: CEZ:AV0Z10100523 Keywords : diode pumped solid state lasers * repetative regime * high average power Subject RIV: BH - Optics, Masers, Lasers

  10. Auf dem Weg zum Portalverbund – das neue Onlinezugangsgesetz (OZG) / Thorsten Siegel

    Index Scriptorium Estoniae

    Siegel, Thorsten

    2018-01-01

    Haldusteenustele liidu ja liidumaade tasandil infotehnoloogilise juurdepääsu tagamisest ühtse portaali loomise ja seadustamisega; põhiseaduse artikli 91 tõlgendamisest. Vt samal teemal ka lk. 193-198

  11. Big Rock Point Nuclear Plant. Semiannual operations report No. 22, January--June 1975

    International Nuclear Information System (INIS)

    1975-01-01

    Net electrical power generated was 50,198.2 MWH(e) with the reactor on line 922.6 hrs. Information is presented concerning power generation, shutdowns, corrective maintenance, chemistry and radiochemistry, occupational radiation exposure, and abnormal occurrences. (FS)

  12. Factors Associated with Unmet Need for Modern Contraception in ...

    African Journals Online (AJOL)

    AJRH Managing Editor

    Study Design. Data for this study .... design based on sampling participants from selected venues. .... Number mentioned**. Injectable / Depo-Provera. 21. Implant. 1. Pill. 38. Male condom. 198 ..... Surveys and ORC Macro, 2006. 25. Gallo MF ...

  13. Aging changes in the breast

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/003999.htm Aging changes in the breast To use the sharing ... chap 198. Walston JD. Common clinical sequelae of aging. In: Goldman L, Schafer AI, eds. Goldman-Cecil ...

  14. 40 CFR 270.305 - What tank information must I keep at my facility?

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) SOLID WASTES (CONTINUED) EPA ADMINISTERED PERMIT PROGRAMS: THE HAZARDOUS WASTE PERMIT PROGRAM... 267.198. (j) For tank systems in which ignitable, reactive, or incompatible wastes are to be stored or...

  15. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 34; Issue 4 ... has a dielectric anomaly of ferroelectric to paraelectric type at 198°C, and exhibits ... that the compound has negative temperature coefficient of resistance (NTCR) behaviour.

  16. ORF Alignment: NC_005788 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available gossypii ATCC 10895] ref|NP_986570.1| AGL097Cp ... [Eremothecium gossypii] ... Length = 198 ... Query: 449 NPRKFESWL...HTATLANIATVFKDSDSKEWRAHGDPTEIAIQVFATRMDHPHHALTTXXXX 508 ... NPRKFESWLHTATLANIATVF...KDSDSKEWRAHGDPTEIAIQVFATRMDHPHHALTT ... Sbjct: 1 ... NPRKFESWLHTATLANIATVFKDSDSKEWR

  17. Annual report 1986 Interfacultary Reactor Institute

    International Nuclear Information System (INIS)

    1987-01-01

    In this annual report of the Dutch Interfacultary Reactor Institute, summary- and detailed reports are presented of Current research during 198? of the departments radiochemistry, radiation chemistry, radiation physics, and reactor physics. (H.W.). refs.; figs.; tabs

  18. Evaluation of an Implementation Model : A National Investigation of VA Residential Programs

    NARCIS (Netherlands)

    Cook, Joan M.; Dinnen, Stephanie; Coyne, James C.; Thompson, Richard; Simiola, Vanessa; Ruzek, Josef; Schnurr, Paula P.

    This national investigation utilizes qualitative data to evaluate an implementation model regarding factors influencing provider use of two evidence-based treatments for posttraumatic stress disorder (PTSD). Semi-structured qualitative interviews with 198 mental health providers from 38 Department

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 198 ... ... seminar on health of Afro-descendant populations, Salvador, Brazil, Abstract ... H El-Sayed, O Zekry, H Abbas, SA Hamid, A Hyder ... in a global quest or an experiment in "Empowered deliberative democracy"?

  20. Čas Kouzelného vrchu

    Czech Academy of Sciences Publication Activity Database

    Dubský, Ivan

    -, č. 72 (2008), s. 87-198 ISSN 1210-2881 Institutional research plan: CEZ:AV0Z90090514 Keywords : Exploration * Magic Mountain * mystery * mystery of time * Thomas Mann Subject RIV: AA - Philosophy ; Religion

  1. Book Reviews Megaherbivores: the influence of very large body size ...

    African Journals Online (AJOL)

    437 pp. Price: OM 198,00. Scholars in the field of soil zoology will welcome this book. .... ontogenetic processes shape and constrain a particular vocal signal draws ... the structure of calls and, therewith, the perceptual capabilities of recipients.

  2. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 198 ... Vol 2, No 1 (2004), Design and Implementation of Child Injury ... bullying in the playground: Football and gender 'policing' at school, Abstract PDF ... for sexual- and genderbased violence research and prevention in South ...

  3. Study on liver scintigram using sup(99m)Tc-Sn colloid

    International Nuclear Information System (INIS)

    Nagase, Katsuya; Maruo, Kuninobu

    1975-01-01

    First of all, the liver scintigram was taken using 198 Au-colloid in cases of liver diseases, especially cases which seemed to have morphological changes in the liver. Of these cases, in cases which were found to have lesions the liver scintigram was subsequently taken using sup(99m)Tc-Sn colloid. In addition, in order to compare the state of lesions in both liver scintigrams with 198 Au-colloid and sup(99m)Tc-Sn colloid, ultrasonic tomogram was taken at each time. The scintigram using sup(99m)Tc-Sn colloid seemed to more clearly reveal the state of lesions and their sizes in the thin liver regions, especially the right border, the lower border and the left lobe in the liver, compared with 198 Au-colloid scintigram. The lesions in the thick liver tissues, especially the central right lobe, sometimes became unclear using sup(99m)Tc-Sn colloid. Therefore, 198 Au-colloid seemed to be available in these lesions. The scintigram using sup(99m)Tc-Sn colloid was found more useful for the diagnosis of lesions of patients with liver, cirrhosis whom the uptake rate of 198 Au-colloid is poor, compared with 198 Au-colloid scintigram. (Namekawa, K.)

  4. Immuno-vectorization of radioelements emitters of alpha particles: a new therapy in cancerology

    International Nuclear Information System (INIS)

    Bourgeois, M.

    2007-05-01

    The radio-immunotherapy is an anti cancerous therapy which consists in vectorising with immuno-specific agents very radio toxic radioelements on tumors or in their environment to destroy them. The first part of this report presents the different characteristics of antibodies as well as their means of production under monoclonal shapes specifically steered against a tumoral antigen of interest. The second part of this report replaces the importance of the immunological vectors in the context of the nuclear medicine. It is notably described that the different methods which allow to radio-label the vector, as well as the different ways of optimization which were envisaged to improve the targeting of radioelements on a tumor. These different developments allow to define the potential place of the alpha radio-immunotherapy in treatments and so re-place the interest of the experimental part. If the radio-immunotherapy, using beta emitters isotopes as the 131 iodine or the 90 yttrium, is today current in anti cancerous therapy, it finds limits because of the disintegration characteristics of the isotopes it uses. Indeed, compared with alpha particles, the beta particles deposit less energy by unit of length in the crossed material.The experimental part of this report aims at studying the feasibility of the coupling between an immunological vector and an alpha emitter isotope.The different tests led on the bismuth 213, the bismuth 212, the lead 212 and the astatine 211 demonstrated that the fixation of these radionuclides was possible. This research theme is strengthened by the construction in Nantes of a cyclotron with high energy ( A.R.R.O.N.A.X.) and the optimization of the obtained promising results should allow a therapeutic use in oncology of the alpha radio-immunotherapy. (N.C.)

  5. Cancer therapy with alpha-emitters labeled peptides.

    Science.gov (United States)

    Dadachova, Ekaterina

    2010-05-01

    Actively targeted alpha-particles offer specific tumor cell killing action with less collateral damage to surrounding normal tissues than beta-emitters. During the last decade, radiolabeled peptides that bind to different receptors on the tumors have been investigated as potential therapeutic agents both in the preclinical and clinical settings. Advantages of radiolabeled peptides over antibodies include relatively straightforward chemical synthesis, versatility, easier radiolabeling, rapid clearance from the circulation, faster penetration and more uniform distribution into tissues, and less immunogenicity. Rapid internalization of the radiolabeled peptides with equally rapid re-expression of the cell surface target is a highly desirable property that enhances the total delivery of these radionuclides into malignant sites. Peptides, such as octreotide, alpha-melanocyte-stimulating hormone analogues, arginine-glycine-aspartic acid-containing peptides, bombesin derivatives, and others may all be feasible for use with alpha-emitters. The on-going preclinical work has primarily concentrated on octreotide and octreotate analogues labeled with Bismuth-213 and Astatine-211. In addition, alpha-melanocyte-stimulating hormone analogue has been labeled with Lead-212/Bismuth-212 in vivo generator and demonstrated the encouraging therapeutic efficacy in treatment of experimental melanoma. Obstacles that continue to obstruct widespread acceptance of alpha-emitter-labeled peptides are primarily the supply of these radionuclides and concerns about potential kidney toxicity. New sources and methods for production of these medically valuable radionuclides and better understanding of mechanisms related to the peptide renal uptake and clearance should speed up the introduction of alpha-emitter-labeled peptides into the clinic. Copyright 2010 Elsevier Inc. All rights reserved.

  6. Selective targeting of tumour neovasculature by a radiohalogenated human antibody fragment specific for the ED-B domain of fibronectin

    International Nuclear Information System (INIS)

    Demartis, S.; Tarli, L.; Neri, D.; Borsi, L.; Zardi, L.

    2001-01-01

    Angiogenesis is a characteristic feature of many aggressive tumours and other disorders. Antibodies capable of binding to new blood vessels, but not to mature vessels, could be used as selective targeting agents for immunoscintigraphic and radioimmunotherapeutic applications. Here we show that scFv(L19), a recombinant human antibody fragment with sub-nanomolar affinity for the ED-B domain of fibronectin, a marker of angiogenesis, can be stably labelled with iodine-125 and astatine-211 with full retention of immunoreactivity, using a trimethyl-stannyl benzoate bifunctional derivative. Biodistribution studies in mice bearing two different types of tumour grafted subcutaneously, followed by ex vivo micro-autoradiographic analysis, revealed that scFv(L19) rapidly localises around tumour blood vessels, but not around normal vessels. Four hours after intravenous injection of the stably radioiodinated scFv(L19), tumour to blood ratios were 6:1 in mice bearing the F9 murine teratocarcinoma and 9:1 in mice bearing an FE8 rat sarcoma. As expected, all other organs (including kidney) contained significantly less radioactivity than the tumour. Since the ED-B domain of fibronectin has an identical sequence in mouse and man, scFv(L19) is a pan-species antibody and the results presented here suggest clinical utility of radiolabelled scFv(L19) for the scintigraphic detection of angiogenesis in vivo. Furthermore, it should now be possible to investigate scFv(L19) for the selective delivery of 211 At to the tumour neovasculature, causing the selective death of tumour endothelial cells and tumour collapse. (orig.)

  7. Preparation and in vivo evaluation of radioiodinated closo-decaborate(2-) derivatives to identify structural components that provide low retention in tissues

    International Nuclear Information System (INIS)

    Wilbur, D. Scott; Chyan, M.-K.; Hamlin, Donald K.; Perry, Matthew A.

    2010-01-01

    Introduction: In vivo deastatination of 211 At-labeled biomolecules can severely limit their use in endoradiotherapy. Our studies have shown that the use of closo-decaborate(2-) moiety for 211 At-labeling of biomolecules provides high in vivo stability towards deastatination. However, data from those studies have also been suggestive that some astatinated closo-decaborate(2-) catabolites may be retained in tissues. In this study, we investigated the in vivo distributions of several structurally simple closo-decaborate(2-) derivatives to gain information on the effects of functional groups if catabolites are released into the blood system from the carrier biomolecule. Methods: Thirteen closo-decaborate(2-) derivatives were synthesized and radioiodinated for evaluation. Tissue concentrations of the radioiodinated compounds were obtained in groups of five mice at 1 and 4 h postinjection (pi). Dual-label ( 125 I and 131 I) experiments permitted evaluation of two compounds in each set of mice. Results: All of the target compounds were readily synthesized. Radioiodination reactions were conducted with chloramine-T and Na[ 125/131 I]I in water to give high yields (75-96%) of the desired compounds. Biodistribution data at 1 and 4 h pi (representing catabolites released into the blood system) showed small differences in tissue concentrations for some compounds, but large differences for others. The results indicate that formal (overall) charge on the compounds could not be used as a predictor of tissue localization or retention. However, derivatives containing carboxylate groups generally had lower tissue concentrations. Acid cleavable hydrazone functionalities appeared to be the best candidates for further study. Conclusions: Further studies incorporating hydrazone functionalities into pendant groups for biomolecule radiohalogenation are warranted.

  8. A Study on Liver Scan using 113mIn Colloid

    International Nuclear Information System (INIS)

    Koh, Chang Soon; Rhee, Chong Hoen; Chang, Kochang; Hong, Chang Gi

    1969-01-01

    There have been reported numberous cases of liver scanning in use of 198 Au colloid by many investigators, however, one in use of 113m In colloid has not been reported as yet in this country. The dose of 113 mIn for high diagnostic value in examination of each organ was determined and the diagnostic interpretability of liver scanning with the use of 113m In was carefully evaluated in comparison with the results of the liver scanning by the conventionally applied radioisotope. The comparative study of both figures of liver scanning with the use of 113m In colloid and 198 Au colloid delivered following results:1) The liver uptake rate and clearance into peripheral blood were accentuated more in case of 113m In colloid than in case of 198 Au colloid. 2) The interpretability of space occupying lesion in liver scanning with 113m In was also superior to one with 198 Au. 3) The figure of liver scanning with 113m In colloid corresponds not always to the figure with 198 Au. This difference can be explained by difference of phagocytic ability of reticuloendothelial system within liver. 4) In the liver scanning with 113m In colloid, the spleen is also visualized even in normal examine. 5) In the cases of disturbed liver function, uptake is more decreased in use of 113m In colloid than in 198 Au, in the spleen, however, the way is contrary. 6) With use of 113m In colloid, the time required for scanning could be shortened in comparison with 198 Au. 7) The filtration of 113m In colloid for scanning prior to human administration gives an expectation for better scanning figure.

  9. Low-dose-rate interstitial brachytherapy preserves good quality of life in buccal mucosa cancer patients

    International Nuclear Information System (INIS)

    Tayier, A.; Hayashi, Keiji; Yoshimura, Ryoichi

    2011-01-01

    The purpose of this study was to determine the results and long-term changes in radiation toxicity of stage I-II buccal mucosa cancer patients treated by low-dose-rate (LDR) brachytherapy with 198 Au grains. A total of 133 stage I-II buccal mucosa carcinomas patients received 198 Au grain implantation brachytherapy between January 1982 and July 2005: 75 of them were treated by 198 Au grain implantation alone and 58 were treated by 198 Au implantation in combination with external irradiation. The average 198 Au-grain dose was 70 Gy in 7 days. Gross tumor areas ranged from 2.4 cm 2 to 9 cm 2 , and the clinical target areas ranged from 6 cm 2 to 15 cm 2 . The follow-up periods ranged from 3 months to 20 years (mean: 5 years 11 months and median: 5 years 1 months). Failure at the site of the primary lesion occurred in 17 patients. Post-treatment mucosal ulceration developed in 15 patients, and all were cured within 25 months by conservative treatment. Osteoradionecrosis was diagnosed in 8 patients, but only one patient required surgical treatment. No severe complications or aggravation of complications developed more than 10 years after treatment. The results of low-dose-rate (LDR)-brachytherapy (BT) alone and LDR-BT in combination with external irradiation at a total dose of 25 Gy were acceptable from the standpoint of cure rate and quality of life (QOL). (author)

  10. A single mutation in the envelope protein modulates flavivirus antigenicity, stability, and pathogenesis.

    Directory of Open Access Journals (Sweden)

    Leslie Goo

    2017-02-01

    Full Text Available The structural flexibility or 'breathing' of the envelope (E protein of flaviviruses allows virions to sample an ensemble of conformations at equilibrium. The molecular basis and functional consequences of virus conformational dynamics are poorly understood. Here, we identified a single mutation at residue 198 (T198F of the West Nile virus (WNV E protein domain I-II hinge that regulates virus breathing. The T198F mutation resulted in a ~70-fold increase in sensitivity to neutralization by a monoclonal antibody targeting a cryptic epitope in the fusion loop. Increased exposure of this otherwise poorly accessible fusion loop epitope was accompanied by reduced virus stability in solution at physiological temperatures. Introduction of a mutation at the analogous residue of dengue virus (DENV, but not Zika virus (ZIKV, E protein also increased accessibility of the cryptic fusion loop epitope and decreased virus stability in solution, suggesting that this residue modulates the structural ensembles sampled by distinct flaviviruses at equilibrium in a context dependent manner. Although the T198F mutation did not substantially impair WNV growth kinetics in vitro, studies in mice revealed attenuation of WNV T198F infection. Overall, our study provides insight into the molecular basis and the in vitro and in vivo consequences of flavivirus breathing.

  11. Parafilimonas rhizosphaerae sp. nov., isolated from the rhizosphere of tomato plant (Solanum lycopersicum L.).

    Science.gov (United States)

    Cho, Hayoung; Ahn, Jae-Hyung; Weon, Hang-Yeon; Joa, Jae-Ho; Hong, Seung-Beom; Seok, Soon-Ja; Kim, Jeong-Seon; Kwon, Soon-Wo; Kim, Soo-Jin

    2017-07-01

    A bacterial strain, designated T16E-198T, was isolated from the rhizosphere of tomato plant collected from a farm on Buyeo-gun, Chungcheongnam-do, South Korea. The strain was aerobic, Gram-stain-negative, rod-shaped, non-flagellated and yellow-pigmented. Strain T16E-198T was mesophilic, catalase- and oxidase-positive and with flexirubin-type pigments. A phylogenetic tree based on 16S rRNA gene sequences showed that strain T16E-198T formed a lineage with Parafilimonas terrae 5GHs7-2T, sharing highest sequence similarity of 98.4 % with it and less than 93 % with all the other validly published species. The major fatty acids were iso-C15 : 0, iso-C17 : 0 3-OH and iso-C15 : 1 G. The predominant menaquinone was MK-7. The polar lipids were phosphatidylethanolamine, one unknown aminophospholipid, five unknown aminolipids and five unknown lipids. The DNA G+C content was 41.2 mol%. On the basis of the phenotypic, phylogenetic and chemotaxonomic data presented, strain T16E-198T is considered to represent a novel species of the genus Parafilimonas, for which the name Parafilimonas rhizosphaerae sp. nov. is proposed; the type strain is T16E-198T (=KACC 18786T=JCM 31601T).

  12. Hg stable isotope analysis by the double-spike method.

    Science.gov (United States)

    Mead, Chris; Johnson, Thomas M

    2010-06-01

    Recent publications suggest great potential for analysis of Hg stable isotope abundances to elucidate sources and/or chemical processes that control the environmental impact of mercury. We have developed a new MC-ICP-MS method for analysis of mercury isotope ratios using the double-spike approach, in which a solution containing enriched (196)Hg and (204)Hg is mixed with samples and provides a means to correct for instrumental mass bias and most isotopic fractionation that may occur during sample preparation and introduction into the instrument. Large amounts of isotopic fractionation induced by sample preparation and introduction into the instrument (e.g., by batch reactors) are corrected for. This may greatly enhance various Hg pre-concentration methods by correcting for minor fractionation that may occur during preparation and removing the need to demonstrate 100% recovery. Current precision, when ratios are normalized to the daily average, is 0.06 per thousand, 0.06 per thousand, 0.05 per thousand, and 0.05 per thousand (2sigma) for (202)Hg/(198)Hg, (201)Hg/(198)Hg, (200)Hg/(198)Hg, and (199)Hg/(198)Hg, respectively. This is slightly better than previously published methods. Additionally, this precision was attained despite the presence of large amounts of other Hg isotopes (e.g., 5.0% atom percent (198)Hg) in the spike solution; substantially better precision could be achieved if purer (196)Hg were used.

  13. Lifetimes of excited states in 196198Pt; application of interacting bason approximation model to even Pt isotopes systematics

    International Nuclear Information System (INIS)

    Bolotin, H.H.; Stuchbery, A.E.; Morrison, I.; Kennedy, D.L.; Ryan, C.G.; Sie, S.H.

    1981-01-01

    The lifetimes and lifetime limits of the low-lying excited states up to and including the 6 1 + levels in 196 198 Pt were determined by the rcoil-distance method (RDM). Gamma-ray angular distributions in 198 Pt were also measured. These states were populated by multiple Coulomb excitation using 220-MeV 58 Ni ion beams and the measurements carried out in coincidence with backscattered projectiles. The measured mean lives of the states and B(E2) values inferred for the transitions between levels are presented. These specific findings, and the observed structure systematics obtained from the combination of the present results and those of prior workers for the even 194 - 198 Pt isotopes, are critically compared with our structure calculations employing the Interacting Boson Approximation (IBA) model incorporating a symmetry-breaking quadrupole force. Evaluative comparisons are also made with Boson Expansion Theory (BET) calculations

  14. Role of apparent diffusion coefficients with diffusion-weighted magnetic resonance imaging in differentiating between benign and malignant bone tumors.

    Science.gov (United States)

    Wang, Tingting; Wu, Xiangru; Cui, Yanfen; Chu, Caiting; Ren, Gang; Li, Wenhua

    2014-11-29

    Benign and malignant bone tumors can present similar imaging features. This study aims to evaluate the significance of apparent diffusion coefficients (ADC) in differentiating between benign and malignant bone tumors. A total of 187 patients with 198 bone masses underwent diffusion-weighted (DW) magnetic resonance (MR) imaging. The ADC values in the solid components of the bone masses were assessed. Statistical differences between the mean ADC values in the different tumor types were determined by Student's t-test. Histological analysis showed that 84/198 (42.4%) of the bone masses were benign and 114/198 (57.6%) were malignant. There was a significant difference between the mean ADC values in the benign and malignant bone lesions (Pbenign and malignant bone tumors.

  15. Dosimetry in intrathecal radiogold therapy. 4

    International Nuclear Information System (INIS)

    Doege, H.; Hliscs, R.; Hennig, K.

    1979-01-01

    The radiation dose absorbed depends on the distribution of the 198 Au colloid, its physical properties and the applied activity as well as on the anatomy of the source and the target. These methodic fundamentals were studied. Assuming a homogeneous distribution on the surface of the source organ the radiopharmaceutical in 24 children suffering from acute leukemia the effective dose was calculated to be (296 +- 137 rads) for the intracranial subarachnoid space, (1648 +- 823 rads) for the spinal cord and (35 +- 26 rads) for the liver following administration of 1.5 - 3 mCi 198 Au colloid. The sources of error caused by the complicated anatomy of the CSF space and by differences in the detailed distribution of the 198 Au colloid are discussed. The advantages of this method - good compatibility and intactness of the nervous tissues - can be explained by the sharp decrease of the dose absorbed. (author)

  16. Radioactive gold nanoparticles with beta energy and auger electron cascades in nanomedicine: green nanotechnology and radiochemical approaches

    International Nuclear Information System (INIS)

    Katti, Kattesh V.

    2016-01-01

    In our continued efforts to apply Green Nanotechnology for the development of therapeutic radioactive gold nanoparticles, we have developed a new generation of 198 Au theranostic probes. Laminin receptors are overexpressed in a large number of human tumors and the high in vivo affinity of EGCG toward Laminin receptors has allowed us to develop Laminin receptor specific radioactive gold nanoparticles to achieve tumor specificity. This lecture will provide: (a) Oncological aspects of Auger electrons through nanomedicine; (b) details on the intervention of nuclear activation analysis and various radioanalytical approaches for the production of tumor specific radioactive gold-198 nanoparticles; and (c) full in vivo investigations on therapeutic properties of EGCG-198-AuNP agent in treating prostate tumors

  17. Recent results on fusion and direct reactions with weakly bound stable nuclei

    International Nuclear Information System (INIS)

    Shrivastava, A.

    2011-01-01

    Recent measurements of fusion and direct reactions in case of weakly bound stable nuclei at extreme sub-barrier energies using a sensitive off beam technique are presented. First section deals with deep sub-barrier fusion cross-section measurement for 67 Li + 198 Pt followed by the study of fragment capture reaction of 7 Li + 198 Pt. Deviation in the slope of the fusion excitation function, as observed in case of medium heavy systems, is absent in the present asymmetric systems at these low energies. This study shows the absence of fusion hindrance, suggesting modifications in models that explain deep sub-barrier fusion data to incorporate weakly bound asymmetric systems

  18. Computationally Efficient Modeling of Hydrocarbon Oxidation Chemistry and Flames Using Constituents and Species

    Science.gov (United States)

    2012-02-10

    Cremer , J-Y Chen, C.K. Westbrook, L.Q. Maurice, J. Propul. Power 18 (1) (2002) 192–198. K. Harstad, J. Bellan / Combustion and Flame 157 (2010) 1594... Cremer , J.-Y. Chen, C.K. Westbrook, L.Q. Maurice, J. Propuls. Power 18 (1) (2002) 192–198. a 10-9 10-7 10-5 10-3 10-1 101 N oh (m ol /m 3 ) T0 = 800...Caltech by the Army Research Office under the direction of Drs. David Mann, Kevin McNesby and Ralph Anthenien. References 1U. C. Müeller, N. Peters, A

  19. Encyclopedia of Explosives and Related Items. Volume 10

    Science.gov (United States)

    1983-01-01

    SBR 75 Nylon 130 Polyvinyl Chloride 85 Polyethylene 80 160 Polyvinyl Acetate 75 Teflon FEP, TFE 160 160 Furan Resin 75 Phenolic Resin ___75. Kel-F 300...0 6706>Zo> 1372 pp ’np/W1/3 (s/kg1/3 ) 1.499 -5/6 0 4267>Z 0 >198 Tbpp/Wi/(s/kg1/ 3 ) 0.532 -5/6 0 1372>Z 0>198 bpp /W"/(s/kg/ 3) 0.099 -3/5 0 6706>Z0

  20. Bifunctional chelates of Rh-105 and Au-199 as potential radiotherapeutic agents

    International Nuclear Information System (INIS)

    Troutner, D.E.; Schlemper, E.O.

    1990-01-01

    Since last year we have: continued the synthesis of pentadentate bifunctional chelating agents based on diethylene triamine; studied the chelation Rh-105, Au-198 (as model for Au-199) and Tc-99m with these agents as well as chelation of Pd-109, Cu-67, In-111, and Co-57 with some of them; synthesized a new class of potential bifunctional chelating agents based on phenylene diamine; investigated the behavior of Au-198 as a model for Au-199; begun synthesis of bifunctional chelating agents based on terpyridly and similar ligands; and continued attempts to produce tetradentate bifunctional chelates based on diaminopropane. Each of these will be addressed in this report

  1. Stemcell Information: SKIP000844 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 370S 10001.198.01 10001.198.01 パーキンソン病 G20 Parkinson Disease 168600 ... 68 60-69 Male Ashkenazi Jewish ... ...Ashkenazi Jewish ... Yes No Transgene-free iPS cells from Parkinson Disease patient who has Monozygotic twin br....023 iPSC-derived dopamine neurons reveal differences between monozygotic twins discordant for Parkinson...other.Using CytoTune iPS Sendai reprogramming protocol (Life Technologies). 一卵性双生児のパーキンソン

  2. Suspension Array for Multiplex Detection of Eight Fungicide-Resistance Related Alleles in Botrytis cinerea

    OpenAIRE

    Zhang, Xin; Xie, Fei; Lv, Baobei; Zhao, Pengxiang; Ma, Xuemei

    2016-01-01

    A simple and high-throughput assay to detect fungicide resistance is required for large-scale monitoring of the emergence of resistant strains of Botrytis cinerea. Using suspension array technology performed on a Bio-Plex 200 System, we developed a single-tube allele-specific primer extension (ASPE) assay that can simultaneously detect eight alleles in one reaction. These eight alleles include E198 and 198A of the β-Tubulin gene (BenA), H272 and 272Y of the Succinate dehydrogenase iron–sulfur...

  3. Aphid parasitoid (Hymenoptera:Braconidae: Aphidiinae) in wetland habitats in western Palearctic: key and associated aphid parasitoid guilds

    Czech Academy of Sciences Publication Activity Database

    Tomanović, Ž.; Starý, Petr; Kavallieratos, N. G.; Gagić, V.; Plećaš, M.; Janković, M.; Rakhshani, E.; Ćetković, A.; Petrović, A.

    2012-01-01

    Roč. 48, 1-2 (2012), s. 189-198 ISSN 0037-9271 Grant - others:The Ministry of Science and Technological Development of the Republic of Serbia(RS) 043001 Institutional research plan: CEZ:AV0Z50070508 Keywords : aphid parasitoids * tritrophic interactions * wetlands Subject RIV: EH - Ecology, Behaviour Impact factor: 0.529, year: 2012 http://zoologie.umh.ac.be/asef/pdf/2012_48_01_02/full/Tomanovic_et_al_2012_ASEF_48_1_2_189_198_full.pdf

  4. Indirect Radiohalogenation of Targeting Proteins: Labelling Chemistry and Biological Characterisation

    Energy Technology Data Exchange (ETDEWEB)

    Orlova, Anna

    2003-03-01

    In about half of all newly diagnosed cancer cases, conventional treatment is not adequately curative, mainly due to the failure of conventional techniques to find and kill residual cells and metastases, which might consist of only a few malignant cells, without causing unacceptable complications to healthy tissue. To solve the problem a more selective delivery of cytotoxic substances to tumour cells is needed. The approach applied here is called 'tumour targeting' and implies the use of biomolecules that recognise specific molecular structures on the malignant cell surface. Such molecules are then used for a selective transport of toxic agents to the cancer cells. The use of radionuclides as cytotoxic substances has a number of advantages: 1) radiation does not cause severe resistance; 2) there is a cross-fire effect and 3) smaller amounts of nuclides are required than other cytotoxic substances to cause the same damage. Such an approach is called radionuclide tumour therapy. Several factors are important for the success of radionuclide therapy, such as the pharmacokinetics of the radiolabelled substance and its radiocatabolites, as well as the physical and chemical properties of the radiolabel used. Nuclear properties of the label should be consistent with the problem to be solved: primary diagnostics; quantification of pharmacokinetics and dose planning; or therapy. From this point of view, radiohalogens are an attractive group of radiolabels. Halogens have nuclides with a variety of physical properties while the chemical and biological properties of halogens are very similar. The same labelling procedures can be used for all heavy halogens, i.e. bromine, iodine and astatine. It has been demonstrated that the biodistribution of proteins labelled with different heavy halogens is quite similar. The main goal of the study was to develop protein radiohalogenation methods that provide a stable halogen-protein bond, convenient labelling chemistry that

  5. Radiostatine and radioiodine uptake characterization in sodium iodine symporter-expressing cell lines

    International Nuclear Information System (INIS)

    Petrich, T.; Helmeke, H.J.; Meyer, G.J.; Knapp, W.H.; Poetter, E.

    2002-01-01

    Full text: The sodium iodide symporter (NIS) has been recognized as an attractive target for cancer gene therapy. Here we investigated NIS-mediated transport of the high LET α-emitter astatine, 211 At, in comparison to radioiodine. A constitutive expression vector harbouring the human NIS cDNA was used in combination with reporter gene vectors for transient transfection of 13 different human cancer cell lines. Radioiodine uptake was measured as well as transfection efficiencies. Six stable NIS-expressing cell lines (3 derived from thyroid carcinomas, 2 colon carcinoma, 1 glioblastoma) were generated by antibiotic selection. NIS expression was monitored by immunohistochemistry and RT-PCR. Subsequently the radioastatine and radioiodine uptake characteristics of genetically modified cells were studied in comparison to the respective control cells. After xenotransplantation in nude mice in vivo tumor imaging by scintigraphy and biodistribution studies following organ removal were performed. Transient transfection of NIS cDNA led to high specific sodium perchlorate-sensitive radioiodine uptake in NIS-expressing cells that roughly correlates to transfection efficiencies. Similarly, stable NIS-expressing cell lines were able to concentrate high levels of radioiodine and in addition showed comparable transport capacity for radioastatine. Accumulation of 211 At was inhibited by sodium perchlorate like iodide uptake and displayed dependency an extracellular Na + - and I - -ions as well. Compared to wash-out experiments in cell culture the effective half life of radioiodine and radioastatine in vivo was significantly prolonged. Preliminary dose calculations by MIRD concepts indicated higher tumor radiation doses for 211 At compared to 131 I. Tumor cells of different origins transfected with the NIS-expression vector specifically and significantly take-up radioiodine and radioastatine in vitro and in vivo. The data provide direct evidence that the NIS efficiently transports

  6. α-Imaging Confirmed Efficient Targeting of CD₄₅-Positive Cells After ²¹¹At-Radioimmunotherapy for Hematopoietic Cell Transplantation

    Energy Technology Data Exchange (ETDEWEB)

    Frost, Sophia; Miller, Brian W.; Back, Tom; Santos, E. B.; Hamlin, Donald K.; Knoblaugh, E.; Frayo, Shani; Kenoyer, Aimee L.; Storb, Rainer; Press, O. W.; Wilbur, D. Scott; Pagel, John M.; Sandmaier, B. M.

    2015-09-03

    Alpha-radioimmunotherapy (α-RIT) targeting CD45 may substitute for total body irradiation in hematopoietic cell transplantation (HCT) preparative regimens for lymphoma. Our goal was to optimize the anti-CD45 monoclonal antibody (MAb; CA12.10C12) protein dose for astatine-²¹¹(²¹¹At)-RIT, extending the analysis to include intra-organ ²¹¹At activity distribution and α-imaging-based small-scale dosimetry, along with imunohistochemical staining. Methods: Eight normal dogs were injected with either 0.75 (n=5) or 1.00 mg/kg (n=3) of ²¹¹At-B10-CA12.10C12 (11.5–27.6 MBq/kg). Two were euthanized and necropsied 19–22 hours postinjection (p.i.), and six received autologous HCT three days after ²¹¹At-RIT, following lymph node and bone marrow biopsies at 2–4 and/or 19 hours p.i. Blood was sampled to study toxicity and clearance; CD45 targeting was evaluated by flow cytometry. ²¹¹At localization and small scale dosimetry were assessed using two α-imaging : α-camera and iQID. Results: Uptake of ²¹¹At was highest in spleen (0.31–0.61 %IA/g), lymph nodes (0.02–0.16 %IA/g), liver (0.11–0.12 %IA/g), and marrow (0.06–0.08 %IA/g). Lymphocytes in blood and marrow were efficiently targeted using either MAb dose. Lymph nodes remained unsaturated, but displayed targeted ²¹¹At localization in T lymphocyte-rich areas. Absorbed doses to blood, marrow, and lymph nodes were estimated at 3.9, 3.0, and 4.2 Gy/210 MBq, respectively. All transplanted dogs experienced transient hepatic toxicity. Liver enzyme levels were temporarily elevated in 5 of 6 dogs; 1 treated with 1.00 mg MAb/kg developed ascites and was euthanized 136 days after HCT. Conclusion: ²¹¹At-anti-CD45 RIT with 0.75 mg MAb/kg efficiently targeted blood and marrow without severe toxicity. Dosimetry calculations and observed radiation-induced effects indicated that sufficient ²¹¹At-B10-CA12.10C12 localization was achieved for efficient conditioning for HCT.

  7. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    Energy Technology Data Exchange (ETDEWEB)

    Lyckesvärd, Madeleine Nordén, E-mail: madeleine.lyckesvard@oncology.gu.se [Department of Oncology, Sahlgrenska Academy, University of Gothenburg (Sweden); Delle, Ulla; Kahu, Helena [Department of Oncology, Sahlgrenska Academy, University of Gothenburg (Sweden); Lindegren, Sture [Department of Radiation Physics, Sahlgrenska Academy, University of Gothenburg (Sweden); Jensen, Holger [The PET and Cyclotron Unit Copenhagen University Hospital, Rigshospitalet (Denmark); Bäck, Tom [Department of Radiation Physics, Sahlgrenska Academy, University of Gothenburg (Sweden); Swanpalmer, John [Department of Medical Physics and Biomedical Engineering, Sahlgrenska University Hospital, Gothenburg (Sweden); Elmroth, Kecke [Department of Oncology, Sahlgrenska Academy, University of Gothenburg (Sweden)

    2014-07-15

    Highlights: • We study DNA damage response to low-LET photons and high-LET alpha particles. • Cycling primary thyrocytes are more sensitive to radiation than stationary cells. • Influence of radiation quality varies due to cell cycle status of normal cells. • High-LET radiation gives rise to a sustained DNA damage response. - Abstract: Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ({sup 211}At), concentrated in the thyroid by the same mechanism as {sup 131}I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation and much less is known of high-LET irradiation. In this paper we investigated the DNA damage response and biological consequences to photons from Cobolt-60 ({sup 60}Co) and alpha particles from {sup 211}At in normal primary thyrocytes of different cell cycle status. For both radiation qualities the intensity levels of γH2AX decreased during the first 24 h in both cycling and stationary cultures and complete repair was seen in all cultures but cycling cells exposed to {sup 211}At. Compared to stationary cells alpha particles were more harmful for cycling cultures, an effect also seen at the pChk2 levels. Increasing ratios of micronuclei per cell nuclei were seen up to 1 Gy {sup 211}At. We found that primary thyrocytes were much more sensitive to alpha particle exposure compared with low-LET photons. Calculations of the relative biological effectiveness yielded higher RBE for cycling cells compared with stationary cultures at a modest level of damage, clearly demonstrating that cell cycle status influences the relative

  8. Quantitative single-particle digital autoradiography with α-particle emitters for targeted radionuclide therapy using the iQID camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W., E-mail: brian.miller@pnnl.gov [Pacific Northwest National Laboratory, Richland, Washington 99354 and College of Optical Sciences, The University of Arizona, Tucson, Arizona 85719 (United States); Frost, Sofia H. L.; Frayo, Shani L.; Kenoyer, Aimee L.; Santos, Erlinda; Jones, Jon C.; Orozco, Johnnie J. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 (United States); Green, Damian J.; Press, Oliver W.; Pagel, John M.; Sandmaier, Brenda M. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 and Department of Medicine, University of Washington, Seattle, Washington 98195 (United States); Hamlin, Donald K.; Wilbur, D. Scott [Department of Radiation Oncology, University of Washington, Seattle, Washington 98195 (United States); Fisher, Darrell R. [Dade Moeller Health Group, Richland, Washington 99354 (United States)

    2015-07-15

    Purpose: Alpha-emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm), causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with α emitters may thus inactivate targeted cells with minimal radiation damage to surrounding tissues. Tools are needed to visualize and quantify the radioactivity distribution and absorbed doses to targeted and nontargeted cells for accurate dosimetry of all treatment regimens utilizing α particles, including RIT and others (e.g., Ra-223), especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, the ionizing-radiation quantum imaging detector (iQID) camera, for use in α-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection system that images and identifies charged-particle and gamma-ray/x-ray emissions spatially and temporally on an event-by-event basis. It employs CCD-CMOS cameras and high-performance computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, the authors evaluated its characteristics for α-particle imaging, including measurements of intrinsic detector spatial resolutions and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 ({sup 211}At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ∼20 μm full width at half maximum and the α-particle background was measured at a rate as low as (2.6 ± 0.5) × 10{sup −4} cpm/cm{sup 2} (40 mm diameter detector area

  9. Quantitative single-particle digital autoradiography with α-particle emitters for targeted radionuclide therapy using the iQID camera.

    Science.gov (United States)

    Miller, Brian W; Frost, Sofia H L; Frayo, Shani L; Kenoyer, Aimee L; Santos, Erlinda; Jones, Jon C; Green, Damian J; Hamlin, Donald K; Wilbur, D Scott; Fisher, Darrell R; Orozco, Johnnie J; Press, Oliver W; Pagel, John M; Sandmaier, Brenda M

    2015-07-01

    Alpha-emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50-80 μm), causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with α emitters may thus inactivate targeted cells with minimal radiation damage to surrounding tissues. Tools are needed to visualize and quantify the radioactivity distribution and absorbed doses to targeted and nontargeted cells for accurate dosimetry of all treatment regimens utilizing α particles, including RIT and others (e.g., Ra-223), especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, the ionizing-radiation quantum imaging detector (iQID) camera, for use in α-RIT experiments. The iQID camera is a scintillator-based radiation detection system that images and identifies charged-particle and gamma-ray/x-ray emissions spatially and temporally on an event-by-event basis. It employs CCD-CMOS cameras and high-performance computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, the authors evaluated its characteristics for α-particle imaging, including measurements of intrinsic detector spatial resolutions and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 ((211)At) activity distributions in cryosections of murine and canine tissue samples. The highest spatial resolution was measured at ∼20 μm full width at half maximum and the α-particle background was measured at a rate as low as (2.6 ± 0.5) × 10(-4) cpm/cm(2) (40 mm diameter detector area). Simultaneous imaging of multiple tissue sections was

  10. Formulation, Development, and In Vitro Evaluation of a CD22 Targeted Liposomal System Containing a Non-Cardiotoxic Anthracycline for B Cell Malignancies

    Directory of Open Access Journals (Sweden)

    Nivesh K. Mittal

    2018-04-01

    Full Text Available Doxorubicin cardiotoxicity has led to the development of superior chemotherapeutic agents such as AD 198. However, depletion of healthy neutrophils and thrombocytes from AD 198 therapy must be limited. This can be done by the development of a targeted drug delivery system that delivers AD 198 to the malignant cells. The current research highlights the development and in vitro analysis of targeted liposomes containing AD 198. The best lipids were identified and optimized for physicochemical effects on the liposomal system. Physiochemical characteristics such as size, ζ-potential, and dissolution were also studied. Active targeting to CD22 positive cells was achieved by conjugating anti-CD22 Fab’ to the liposomal surface. Size and ζ-potential of the liposomes was between 115 and 145 nm, and −8 to−15 mV. 30% drug was released over 72 h. Higher cytotoxicity was observed in CD22+ve Daudi cells compared to CD22−ve Jurkat cells. The route of uptake was a clathrin- and caveolin-independent pathway. Intracellular localization of the liposomes was in the endolysosomes. Upon drug release, apoptotic pathways were activated partly by the regulation of apoptotic and oncoproteins such as caspase-3 and c-myc. It was observed that the CD22 targeted drug delivery system was more potent and specific compared to other untargeted formulations.

  11. Enhanced production of glucose oxidase from UVmutant of ...

    African Journals Online (AJOL)

    UV rays were used as mutagen in wild type strain of Aspergillus niger for enhanced production of glucose oxidase. After mutangenization and selection, mutant A. niger strains, resistant to 2-deoxy-Dglucose were obtained. The mutants showed 1.57 and 1.98 fold increase in activities of extra and intra cellular glucose ...

  12. Search Results | Page 18 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 171 - 180 of 198 ... The burden of disease caused by smoking, and the medical and social costs associated with it, are not well quantified in low- and middle income countries. ... In an attempt to block policies aimed at reducing the demand for tobacco products, tobacco companies claim that such policies will have a ...

  13. Deformation twinning in zinc-aluminium single crystals after slip

    International Nuclear Information System (INIS)

    Lukac, P.; Kral, F.; Trojanova, Z.; Kral, R.

    1993-01-01

    Deformation twinning in Zn-Al single crystals deformed by slip in the basal system is examined. The influence of temperature and the content of aluminium in zinc on the twinning stress is investigated in the temperature range from 198 to 373 K. It is shown that the twinning stress rises with increasing temperature and increases with the concentration of Al atoms. (orig.)

  14. Improving Counterterrorism Efforts by Removing Misconceptions about Islam in the Western World

    Science.gov (United States)

    2010-12-01

    communist or socialist regime.198 The Baader-Meinhof Group (Germany), the Japanese Red Army, the Weathermen (United States in the 1970s), and the Red... cinema prefers to focus on Arabs and Muslims.310 Hollywood films of recent times, such as Iron Eagle, True Lies, and The Siege, have “Islamic

  15. an endemic rare species of Uludağ mountain

    African Journals Online (AJOL)

    use

    2011-12-14

    Dec 14, 2011 ... various ex vitro and in vitro cultural methods which have low impact on wild ... methods, tissue culture represents an important potential ..... We gratefully acknowledge Dumlupınar University. Research Fund ... Doctoral thesis. p. 198. ... management on Krvavec ski resort (Slovenia) on hydrological function ...

  16. Dissolution kinetics of Pd and Pt from automobile catalysts by naturally occurring complexing agents

    Czech Academy of Sciences Publication Activity Database

    Šebek, O.; Mihaljevič, M.; Strnad, L.; Ettler, V.; Ježek, J.; Štědrý, R.; Drahota, P.; Ackerman, Lukáš; Adamec, V.

    2011-01-01

    Roč. 198, December (2011), s. 331-339 ISSN 0304-3894 Institutional research plan: CEZ:AV0Z30130516 Keywords : automobile catalyst * Platinum group elements * mobilisation * leaching * kinetic Subject RIV: DD - Geochemistry Impact factor: 4.173, year: 2011

  17. The Use of Internet of EFL Learners

    Science.gov (United States)

    Srichanyachon, A. Napaporn

    2013-01-01

    This study investigated attitudes toward using the Internet as a learning tool among students at Bangkok University; students' expectation of social networks and search engines in learning English, as well as their perceived usefulness. It also examined their use of the Internet for learning English. The samples were 198 undergraduate students…

  18. Molecular Characterization of a Heterothallic Mating System in Pseudogymnoascus destructans, the Fungus Causing White-Nose Syndrome of Bats

    Czech Academy of Sciences Publication Activity Database

    Palmer, J.M.; Kubátová, Alena; Nováková, Alena; Minnis, A.M.; Kolařík, Miroslav; Lindner, D.L.

    2014-01-01

    Roč. 4, č. 9 (2014), s. 1755-1763 ISSN 2160-1836 R&D Projects: GA ČR(CZ) GAP506/12/1064 Institutional support: RVO:61388971 Keywords : geomyces * sexual reproduction * mating type Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.198, year: 2014

  19. Molecular characterization of a heterothallic mating system in .i.Pseudogymnoascus destructans./i., the fungus causing white-nose syndrome of bats

    Czech Academy of Sciences Publication Activity Database

    Palmer, J.M.; Kubátová, A.; Nováková, Alena; Minnis, A.M.; Kolařík, M.; Lindner, D.L.

    2014-01-01

    Roč. 4, č. 9 (2014), s. 1755-1763 ISSN 2160-1836 Institutional support: RVO:60077344 Keywords : Genetics of Sex * geomyces * mating type * sexual reproduction * white-nose syndrome Subject RIV: EE - Microbiology, Virology Impact factor: 3.198, year: 2014

  20. Assessment of magmatic vs. metasomatic processes in rare-metal granites: A case study of the Cínovec/Zinnwald Sn–W–Li deposit, Central Europe

    Czech Academy of Sciences Publication Activity Database

    Breiter, Karel; Ďurišová, Jana; Hrstka, Tomáš; Korbelová, Zuzana; Hložková Vaňková, M.; Vašinová Galiová, M.; Kanický, V.; Rambousek, P.; Knésl, I.; Dobeš, P.; Dosbaba, M.

    292/293, November (2017), s. 198-217 ISSN 0024-4937 R&D Projects: GA ČR GA14-13600S Institutional support: RVO:67985831 Keywords : rare-metal granite * Cínovec/Zinnwald deposit * rock textures * metasomatic processes * magmatic processes Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 3.677, year: 2016

  1. 78 FR 48640 - Special Access Proceeding; Comment Deadline Extension

    Science.gov (United States)

    2013-08-09

    ... CONTACT: William Layton, Pricing Policy Division, Wireline Competition Bureau, 202-418-0868 or William...-198. See 44 U.S.C. 3506(c)(4). For further information, please contact William Layton, Pricing Policy... its rules for granting pricing flexibility for the special access services provided by incumbent local...

  2. Decolorization of different textile dyes by Penicillium simplicissimum and toxicity evaluation after fungal treatment

    Directory of Open Access Journals (Sweden)

    L.R. Bergsten-Torralba

    2009-12-01

    Full Text Available The objective of this study was to investigate the capacity of decolorization and detoxification of the textile dyes Reactive Red 198 (RR198, Reactive Blue 214 (RB214, Reactive Blue 21 (RB21 and the mixture of the three dyes (MXD by Penicillium simplicissimum INCQS 40211. The dye RB21, a phthalocyanine, was totally decolorized in 2 days, and the others, the monoazo RR198, the diazo RB214 and MXD were decolorized after 7 days by P. simplicissimum. Initially the dye decolorization involved dye adsorption by the biomass followed by degradation. The acute toxicity after fungal treatment was monitored with the microcrustacean Daphnia pulex and measured through Effective Concentration 50% (EC50. P. simplicissimum reduced efficiently the toxicity of RB21 from moderately acutely toxic to minor acutely toxic and it also reduced the toxicity of RB214 and MXD, which remained minor acutely toxic. Nevertheless, the fungus increased the toxicity of RR198 despite of the reduction of MXD toxicity, which included this dye. Thus, P. simplicissimum INCQS 40211 was efficient to decolorize different textile dyes and the mixture of them with a significant reduction of their toxicity. In addition this investigation also demonstrated the need of toxicological assays associated to decolorization experiments.

  3. Isolation and expression pattern of COR15b and KIN1 genes in ...

    African Journals Online (AJOL)

    ClKIN1) and KIN1 in pumpkin (CmKIN1) were 198 bp, encoding two short polypeptides of 65 amino acids. The putative amino acids of ClKIN1 and CmKIN1 shared 98.48 and 90.51% identities to AtKIN1 respectively, although they also contained ...

  4. Search Results | Page 6 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 51 - 60 of 198 ... ... 10 Apply West Indies filter · Middle East 7 Apply Middle East filter .... Ebola Crisis: Improving Science-Based Communication and ... Clinical Trials of an Experimental Ebola Vaccine: A Canadian Research Response ... Integrated Intervention for Diabetes Risk After Gestational Diabetes in South Africa.

  5. Materialistic Thinking and Its Mental-Hygienic Implications among Students of Budapest Business School

    Science.gov (United States)

    Gombás, Judit

    2015-01-01

    Previous research with extrinsic ("materialistic") and intrinsic ("non-materialistic") life goals suggest that intrinsic aspirations (e.g. relationships, community service, personal development) are associated with a better functioning, mentally and physically more healthy personality. In this survey 198 undergraduate students…

  6. 77 FR 15966 - Ohio: Final Authorization of State Hazardous Waste Management Program Revision

    Science.gov (United States)

    2012-03-19

    ... Hazardous Waste Management Program Revision AGENCY: Environmental Protection Agency (EPA). ACTION: Final..., 1989 (54 FR 27170) to implement the RCRA hazardous waste management program. We granted authorization... Combustors; Final Rule, Checklist 198, February 14, 2002 (67 FR 6968); Hazardous Waste Management System...

  7. 76 FR 56708 - Ohio: Final Authorization of State Hazardous Waste Management Program Revision

    Science.gov (United States)

    2011-09-14

    ... Hazardous Waste Management Program Revision AGENCY: Environmental Protection Agency (EPA). ACTION: Proposed..., 1989 (54 FR 27170) to implement the RCRA hazardous waste management program. We granted authorization... December 7, 2004. Waste Combustors; Final Rule; Checklist 198. Hazardous Waste Management March 13, 2002...

  8. Petrogenesis of orogenic lamproites of the Bohemian Massif: Sr-Nd-Pb-Li isotope constraints for Variscan enrichment of ultra-depleted mantle domains

    Czech Academy of Sciences Publication Activity Database

    Krmíček, Lukáš; Romer, R. L.; Ulrych, Jaromír; Glodny, J.; Prelevič, D.

    2016-01-01

    Roč. 35, 1 July (2016), s. 198-216 ISSN 1342-937X Institutional support: RVO:67985831 Keywords : Silica-rich lamproites * Sr-Nb-Pb-Li isotopes * mantle metasomatism * Variscides Subject RIV: DB - Geology ; Mineralogy Impact factor: 6.959, year: 2016

  9. Search Results | Page 12 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 111 - 120 of 198 ... ... Apply INFECTIOUS DISEASES filter · SOCIAL PROBLEMS 12 Apply SOCIAL ... Information and Networks in Asia and Sub-Saharan Africa 2 Apply ... This mosquito-transmitted disease has spread over the last 20 years, putting ... Panama's tobacco epidemic demonstrates the importance of strong ...

  10. The Identification of Seniors at Risk screening tool is useful for predicting acute readmissions

    DEFF Research Database (Denmark)

    Rosted, Elizabeth; Schultz, Martin; Dynesen, Helle

    2014-01-01

    . Patients ≥ 65 years treated during a 14-day period were included. Their mean age was 78 years. Screening with the Identification of Seniors at Risk (ISAR) was performed (n = 198) by the Mobile Geriatric Team (MGT). The patients' medical journals were assessed retrospectively by the SG to determine any need...

  11. Extraction of MOS VLSI (Very-Large-Scale-Integrated) Circuit Models Including Critical Interconnect Parasitics.

    Science.gov (United States)

    1987-09-01

    level descrip- tion without human intervention. Although design rules and the layout function may not be checked, performance verification is still a...digital syvstems.- Proc. I1E1., vol. 69. no. 10. pp. 1200-1211. October 198 1. [2] A. Gupta, AT A circuit extractor." Proc. 20th Design Automiation

  12. Summary of Available Hail Literature and the Effect of Hail on Aircraft in Flight

    Science.gov (United States)

    1952-09-01

    pp. 427-428. Illustrated description of refrigerating chamber and of the method by which a thin section of a hailstone can be obtained for micro ... Servicio Meteorologica Nacional (Madrid), 19^+8, PP. 104-1LU. (Available U. S. Weather Bur. Lib.) 3 figures. *F-70. Roth, Richard J.: Crop-Hail

  13. African Journals Online (AJOL)

    African Journals Online (AJOL)

    AJOL is a Non-Profit Organisation based in South Africa. More about AJOL and the challenges we work to address. AJOL hosts 521 Journals, including 221 Open Access Journals; The site has 12 740 Issues containing 149 188 Abstracts. There are 143 406 Full Text Articles for download, of which 82 198 are Open Access ...

  14. Basic Education in Tanzania: A Slight Touch on the Views of ...

    African Journals Online (AJOL)

    The objective of this paper is to visualize what basic education is. To provide a focus to the paper, from 1997-2003, 198 primary seven leavers from Nachingwea and Tandahimba districts in the southern regions of Tanzania were sampled. Six simple questions from six conventional primary school subjects (Kiswahili, ...

  15. Spectroscopy of Na-18: Bridging the two-proton radioactivity of Mg-19

    Czech Academy of Sciences Publication Activity Database

    Assie, M.; de Oliveira Santos, F.; Achouri, L.; Angelique, J. C.; Borcea, C.; Borcea, R.; Caceres, L.; Chudoba, V.; Pang, D. Y.; Ducoin, D.; Fallot, M.; Kamalou, O.; Kiener, J.; Lam, Y.; Lefevre, A.; Lotay, G.; Mrázek, Jaromír; Perrot, L.; Sánchez, A.; Rotaru, F.

    2012-01-01

    Roč. 712, č. 3 (2012), s. 198-202 ISSN 0370-2693 Grant - others:European Commission(XE) RII3-CT-2004-506065 Institutional support: RVO:61389005 Keywords : two-proton radioactivity * resonant elastic scattering * (19)mg * Na-18 * Ne-17 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 4.569, year: 2012

  16. Wetlands Evaluation Technique (WET). Volume 1: Literature Review and Evaluation Rationale.

    Science.gov (United States)

    1991-10-01

    the transport of nutrients to water bodies are widely available (see review by Westerdahl et al. 198 1I/*L). 28. Direct Alteration (predictor for...Manage. 7:151-153. York. Westerdahl , H. E., W. B. Ford III, J. Harris, Weller, M. W. 1979. Density and habitat and C. R. Lee. 1981. Evaluation of tech

  17. The DAG1 transcription factor negatively regulates the seed-to-seedling transition in Arabidopsis acting on ABA and GA levels

    Czech Academy of Sciences Publication Activity Database

    Boccaccini, A.; Lorrai, R.; Ruta, V.; Frey, A.; Mercey-Boutet, S.; Marion-Poll, F.; Tarkowská, Danuše; Strnad, Miroslav; Costantino, P.; Vittorioso, P.

    2016-01-01

    Roč. 16, SEP 9 (2016), s. 198 ISSN 1471-2229 R&D Projects: GA MŠk LK21306; GA MŠk(CZ) LO1204; GA ČR GA14-34792S Institutional support: RVO:61389030 Keywords : DAG1 * Seed development * Chromatin remodelling Subject RIV: EF - Botanics Impact factor: 3.964, year: 2016

  18. The Impact of Perceptual, Economic, and Demographic Variables on Entrepreneurial Activity in Globally Diverse Ecosystems: Evidence from GEM Data

    Science.gov (United States)

    Adams, Kenneth Raymond

    2016-01-01

    Leveraging a sample of more than 198,000 adult entrepreneurs, both currently involved in the startup of a business or formerly involved in business creation, this study investigates the perceptual, societal impression, economic, and demographic variables that are predictive with an individual's decision to engage in entrepreneurial activity.…

  19. The relative roles of electrostatics and dispersion in the stabilization of halogen bonds

    Czech Academy of Sciences Publication Activity Database

    Riley, K. E.; Hobza, Pavel

    2013-01-01

    Roč. 15, č. 41 (2013), s. 17742-17751 ISSN 1463-9076 R&D Projects: GA ČR GBP208/12/G016 Institutional support: RVO:61388963 Keywords : adapted perturbation-theory * density functional theory * Kohn-Sham orbitals Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.198, year: 2013

  20. Temperature and face dependent copper–graphene interactions

    Czech Academy of Sciences Publication Activity Database

    da Costa e Silva, S.; Ek Weis, Johan; Frank, Otakar; Kalbáč, Martin

    2015-01-01

    Roč. 93, NOV 2015 (2015), s. 793-799 ISSN 0008-6223 R&D Projects: GA MŠk LL1301 Institutional support: RVO:61388955 Keywords : graphene * charge transfer * copper Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 6.198, year: 2015

  1. On the nature of unusual intensity changes in the infrared spectra of the enflurane ... acetone complexes

    Czech Academy of Sciences Publication Activity Database

    Zierkiewicz, W.; Zalesny, R.; Hobza, Pavel

    2013-01-01

    Roč. 15, č. 16 (2013), s. 6001-6007 ISSN 1463-9076 Institutional support: RVO:61388963 Keywords : shifting hydrogen-bonds * center-dot-o * molecular-orbital methods Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.198, year: 2013

  2. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Articles written in Pramana – Journal of Physics. Volume 58 Issue 2 February 2002 pp 333-341. From chaos to disorder: Statistics of the eigenfunctions ... the framework of nonlinear sigma models of supersymmetry. Volume 77 Issue 1 July 2011 pp 185-198. Magnetohydrodynamics turbulence: An astronomical perspective.

  3. In Situ Catalytic Groundwater Treatment Using Pd-Catalysts and Horizontal Flow Treatment Wells

    Science.gov (United States)

    2007-02-01

    Hautman (USEPA, Office of Water) and David J. Munch (USEPA, Office of Water) - Method 300.1, (1997) NATIONAL EXPOSURE RESEARCH LABORATORY OFFICE OF...Kummer, N. A.; Weidenthaler, C.; Schad, H. Appl. Catal., B 2004, 52, 197-203. (6) Zaera, F. Prog. Surf. Sci. 2001, 69, 1-98. (7) Cremer , P. S.; Su, X

  4. 7 CFR 1260.128 - Act.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Act. 1260.128 Section 1260.128 Agriculture... Promotion and Research Order Definitions § 1260.128 Act. Act means the Beef Promotion and Research Act of 1985, Title XVI, Subtitle A of the Food Security Act of 1985, Pub. L. 99-198 and any amendments thereto. ...

  5. A comparative evaluation of three methods used to tag South African ...

    African Journals Online (AJOL)

    Tagging effects and loss rates of 60 Roman Chrysoblephus laticeps tagged with dart tags with barbs (D-tags), T-bar filaments (T-tags) and visible implant fluorescent elastomer (VIFE) tags were investigated. The fish were tagged and monitored in a controlled tank experiment over a period of 198 days. Application technique ...

  6. How Can the U.S. Military Avoid Another 9/15?: An Analysis of the Inability of U.S. Military Leaders to Provide an Adequate Strategy for Responding to the 9/11 Attacks

    Science.gov (United States)

    2007-12-01

    bombing campaign 6-Apr-72 23-Oct-72 I 195 Operation Pocket Money Military aerial mining of Haiphong harbor 9-May-72 23-Oct-72 I 196 Operation...197 Operation Endsweep Military counter-mine measure to remove mines dropped during Operation Pocket Money North Vietnam 27-Jan-72 27-Jul-73 I 198

  7. 77 FR 51037 - Agency Information Collection Activities Under Emergency Review by the Office of Management and...

    Science.gov (United States)

    2012-08-23

    ..., used at the time of re-contact, incorporates the required elements of a written consent form. The... signed a MI/SP Counselor Consent. This form explains the purpose of the data collection, privacy, risks... Follow-up Interview 295 1 295 .67 198 MI/SP Counselor Consent......... 75 1 75 .08 6 MI/SP Counselor...

  8. AF-Geospace User’s Manual Version 2.5.1 and Version 2.51P

    Science.gov (United States)

    2012-08-01

    SECURITY CLASSIFICATION OF: 17. LIMITATION OF ABSTRACT 18. NUMBER OF PAGES 19a. NAME OF RESPONSIBLE PERSON Adrian Wheelock a. REPORT...Australids (202-214) 27 Jul 2.89 21Jul-02Aug 42.0 delta-Aquarids(S) (185-232) 28 Jul 11.37 04Jul-20Aug 43.0 iota -Aquarids(S) (198-233

  9. New bradykinin analogues acylated on the N-terminus: effect on rat uterus and blood pressure

    Czech Academy of Sciences Publication Activity Database

    Labudda, O.; Wierzba, T.; Sobolewski, D.; Sleszyňska, M.; Gawiňski, L.; Plačková, Malgorzata; Slaninová, Jiřina; Prahl, A.

    2007-01-01

    Roč. 54, č. 1 (2007), s. 193-198 ISSN 0001-527X Grant - others:State Comittee for Scientific Research(PL) PB1108/T09/2005/28 Institutional research plan: CEZ:AV0Z40550506 Keywords : bradykinin * antagonists * acylation Subject RIV: CE - Biochemistry Impact factor: 1.261, year: 2007 www.actabp.pl

  10. Inhibition of FMLP-stimulated neutrophil chemiluminescence by blood platelets increased in the presence of the serotonin-liberating drug chloroquine

    Czech Academy of Sciences Publication Activity Database

    Jančinová, V.; Drábiková, K.; Nosáľ, R.; Petríková, M.; Číž, Milan; Lojek, Antonín; Danihelová, E.

    2003-01-01

    Roč. 109, 5-6 (2003), s. 293-298 ISSN 0049-3848 R&D Projects: GA MŠk ME 198 Grant - others:VEGA MŠ SR(SK) 2/1012/21 Institutional research plan: CEZ:AV0Z5004920 Keywords : blood platelets * neutrophils * chloroquine Subject RIV: BO - Biophysics Impact factor: 1.710, year: 2003

  11. Role of phytohormones in organogenic ability of elm multiplicated shoots

    Czech Academy of Sciences Publication Activity Database

    Malá, J.; Gaudinová, Alena; Dobrev, Petre; Eder, Josef; Cvikrová, Milena

    2006-01-01

    Roč. 50, č. 1 (2006), s. 8-14 ISSN 0006-3134 Institutional research plan: CEZ:AV0Z5038910; CEZ:AV0Z50380511 Keywords : auxin * cytokinins * multiplication of elm Subject RIV: GK - Forestry Impact factor: 1.198, year: 2006

  12. Calibration of TWSTFT Links Through the Triangle Closure Condition

    Science.gov (United States)

    2008-12-01

    y Observatorio de la Armada, San Fernando, Spain SP Swedish National Testing and Research Institute in Borås, Sweden USNO US Naval Observatory in...accuracy for the realization of International Atomic Time,” Metrologia , 45, 185- 198. [5] D. Piester et al., 2006, “Calibration of six European TWSTFT

  13. Two-Way Satellite Time and Frequency Transfer Using 1 MChips/s Codes

    Science.gov (United States)

    2009-11-01

    Bundesanstalt, Braunschweig, Germany ROA Real Instituto y Observatorio de la Armada, San Fernando, Spain SP Sveriges Provnings- och...International Atomic Time,” Metrologia , 45, 185- 198. [4] A. Bauch, J. Achkar, R. Dach, R. Hlavac, L. Lorini, T. Parker, G. Petit, and P. Uhrich

  14. Ambulatory Visits Among Members of the Active Component, U.S. Armed Forces, 2011

    Science.gov (United States)

    2012-04-01

    encounters for admin- istrative purposes (8.7%), and special investigations and examinations (including vision, dental , and gynecological exams) (6.9...17,389 16.2 Other disorders of male genital organs 25,986 19.8 Neoplasm of uncertain behavior of other/unspecifi ed sites 15,901 14.8 Calculus of kidney

  15. Trypanocidal properties of Terminalia ivorensis A. Chev ...

    African Journals Online (AJOL)

    The column fractions of the ethyl acetate fraction gave E.D50 value between 1.98 and 5.46 μg/mL for the very active fractions indicating prospect for the development of potential trypanocidal agent from the plant. Keywords: Terminalis ivorensis, Trypanosoma brucei rhodesiensis, trypanocidal. African Journal of Traditional, ...

  16. From (p)ppGpp to (pp)pGpp: Characterization of Regulatory Effects of pGpp Synthesized by the Small Alarmone Synthetase of Enterococcus faecalis

    Czech Academy of Sciences Publication Activity Database

    Gaca, A. O.; Kudrin, P.; Colomer-Winter, C.; Beljantseva, J.; Liu, K.; Anderson, B.; Wang, J. D.; Rejman, Dominik; Potrykus, K.; Cashel, M.; Hauryliuk, V.; Lemos, J. A.

    2015-01-01

    Roč. 197, č. 18 (2015), s. 2908-2919 ISSN 0021-9193 R&D Projects: GA ČR GA15-11711S Institutional support: RVO:61388963 Keywords : pGpp * stringent response * bacteria Subject RIV: CC - Organic Chemistry Impact factor: 3.198, year: 2015

  17. AN MHC class I immune evasion gene of Marek's disease virus

    Science.gov (United States)

    Marek's disease virus (MDV) is a widespread a-herpesvirus of chickens that causes T cell tumors. Acute, but not latent, MDV infection has previously been shown to lead to downregulation of cell-surface MHC class I (Virology 282:198–205 (2001)), but the gene(s) involved have not been identified. Here...

  18. Social Information Processing Patterns, Social Skills, and School Readiness in Preschool Children

    Science.gov (United States)

    Ziv, Yair

    2013-01-01

    The links among social information processing, social competence, and school readiness were examined in this short-term longitudinal study with a sample of 198 preschool children. Data on social information processing were obtained via child interview, data on child social competence were obtained via teacher report, and data on school readiness…

  19. Neural Network Based Reactive Navigation for Mobile Robot in Dynamic Environment

    Czech Academy of Sciences Publication Activity Database

    Krejsa, Jiří; Věchet, S.; Ripel, T.

    2013-01-01

    Roč. 198, č. 2013 (2013), s. 108-113 ISSN 1012-0394 Institutional research plan: CEZ:AV0Z20760514 Institutional support: RVO:61388998 Keywords : mobile robot * reactive navigation * artificial neural networks Subject RIV: JD - Computer Applications, Robotics

  20. Software developed by research vs. Freedom of information in EU (open access and open data)

    Czech Academy of Sciences Publication Activity Database

    Kolman, Jiří

    2014-01-01

    Roč. 8, č. 2 (2014), s. 183-198 ISSN 1802-5951 Institutional support: RVO:67179843 Keywords : cooperation of public research institutions and private partners * freedom of information in the EU * open access * open data * research and development * software Subject RIV: AG - Legal Sciences

  1. 46 CFR 181.600 - Fire axe.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Fire axe. 181.600 Section 181.600 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) FIRE PROTECTION EQUIPMENT Additional Equipment § 181.600 Fire axe. A vessel of more than 19.8 meters (65 feet) in length...

  2. 46 CFR 118.600 - Fire axe.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Fire axe. 118.600 Section 118.600 Shipping COAST GUARD... OVERNIGHT ACCOMMODATIONS FOR MORE THAN 49 PASSENGERS FIRE PROTECTION EQUIPMENT Additional Equipment § 118.600 Fire axe. A vessel of more than 19.8 meters (65 feet) in length must have at least one fire axe...

  3. Comparative Economic Analysis of Beekeeping Using Traditional ...

    African Journals Online (AJOL)

    The study was carried out in Tabora and Katavi regions in the miombo woodlands of Tanzania. The overall objective of the study was to undertake a comparative economic analysis of beekeeping using improved or traditional beehives. Data were collected from 198 beekeepers that were randomly selected from a sampling ...

  4. Chemical Constituents and Biological Properties of the Marine Soft ...

    African Journals Online (AJOL)

    1001/PKIMIA/811187); and the authors. (F.A.) and (Y.C.K.) are also grateful to. Universiti Sains Malaysia for the USM fellowship awards. . REFERENCES. 1. John Faulkner D. Marine natural products. Natural. Product Reports, 1999; 16(2): 155-198. 2. Bowden BF, Coll JC, Mitchell SJ. Studies of. Australian soft corals. XXI.

  5. Spatial profiling of degradation processes in hindered-amine-stabilized polymers by electron spin resonance imaging of nitroxides

    Czech Academy of Sciences Publication Activity Database

    Marek, Antonín; Kaprálková, Ludmila; Pfleger, Jiří; Pospíšil, Jan; Pilař, Jan

    2005-01-01

    Roč. 99, S (2005), s. 195-198 ISSN 0009-2770. [Meeting on Chemistry and Life /3./. Brno, 20.9.2005-22.9.2005] Institutional research plan: CEZ:AV0Z40500505 Keywords : polymer degradation * nitroxides * electron spin resonance imaging Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.445, year: 2005

  6. First-order P-wave ray synthetic seismograms in inhomogeneous, weakly anisotropic, layered media

    Czech Academy of Sciences Publication Activity Database

    Pšenčík, Ivan; Farra, V.

    2014-01-01

    Roč. 198, č. 1 (2014), s. 298-307 ISSN 0956-540X R&D Projects: GA ČR(CZ) GAP210/11/0117 Institutional support: RVO:67985530 Keywords : body waves * seismic anisotropy * wave propagation Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 2.724, year: 2013

  7. A summation due to Ramanujan revisited

    Indian Academy of Sciences (India)

    [1] Berndt B C, Ramanujan's Notebooks Part II (1989) (Springer). [2] Berndt B C, Lamb G and Rogers M, Two-dimensional series evaluations via the elliptic functions of Ramanujan and Jacobi, Ramanujan J. 29 (2012) 185–198. [3] Hardy G H, On the convergence of certain multiple series, Proc. Cambridge Philos. Soc.

  8. 75 FR 3640 - Maupin, Oregon

    Science.gov (United States)

    2010-01-22

    ...) the Commission's Electronic Comment Filing System (ECFS), (2) the Federal Government's eRulemaking... Reduction Act of 1995, Public Law 104-13. In addition, therefore, it does not contain any information... Business Paperwork Relief Act of 2002, Public Law 107-198, see 44 U.S.C. 3506(c)(4). The Commission will...

  9. Internalization of Values and Self-Esteem among Brazilian Teenagers from Authoritative, Indulgent, Authoritarian, and Neglectful Homes

    Science.gov (United States)

    Martinez, Isabel; Garcia, Jose Fernando

    2008-01-01

    The relation between parenting styles and adolescent outcomes was analyzed in a sample of 1,198 15-18-year-old Brazilians. The adolescents were classified into 1 of 4 groups (Authoritative, Authoritarian, Indulgent, and Neglectful) on the basis of their own ratings of their parents on two dimensions: Acceptance/Involvement and…

  10. The Relationship between Intrinsic Motivation and Academic Achievement for First Generation Latino College Students

    Science.gov (United States)

    Trevino, Naomi Noel; DeFreitas, Stacie Craft

    2014-01-01

    Hispanic students are pursuing higher education more than in previous years and they often represent their family as the first member to attend college (Strage in "Coll Stud J" 33:198-205, 1999). Past educational research has studied the influence of intrinsic motivation on academic achievement in various ethnically diverse elementary,…

  11. Genome-wide association study of renal cell carcinoma identifies two susceptibility loci on 2p21 and 11q13.3

    NARCIS (Netherlands)

    Purdue, Mark P.; Johansson, Mattias; Zelenika, Diana; Toro, Jorge R.; Scelo, Ghislaine; Moore, Lee E.; Prokhortchouk, Egor; Wu, Xifeng; Kiemeney, Lambertus A.; Gaborieau, Valerie; Jacobs, Kevin B.; Chow, Wong-Ho; Zaridze, David; Matveev, Vsevolod; Lubinski, Jan; Trubicka, Joanna; Szeszenia-Dabrowska, Neonila; Lissowska, Jolanta; Rudnai, Peter; Fabianova, Eleonora; Bucur, Alexandru; Bencko, Vladimir; Foretova, Lenka; Janout, Vladimir; Boffetta, Paolo; Colt, Joanne S.; Davis, Faith G.; Schwartz, Kendra L.; Banks, Rosamonde E.; Selby, Peter J.; Harnden, Patricia; Berg, Christine D.; Hsing, Ann W.; Grubb, Robert L.; Boeing, Heiner; Vineis, Paolo; Clavel-Chapelon, Francoise; Palli, Domenico; Tumino, Rosario; Krogh, Vittorio; Panico, Salvatore; Duell, Eric J.; Quiros, Jose Ramon; Sanchez, Maria-Jose; Navarro, Carmen; Ardanaz, Eva; Dorronsoro, Miren; Khaw, Kay-Tee; Allen, Naomi E.; Bueno-de-Mesquita, H. Bas; Peeters, Petra H. M.; Trichopoulos, Dimitrios; Linseisen, Jakob; Ljungberg, Borje; Overvad, Kim; Tjonneland, Anne; Romieu, Isabelle; Riboli, Elio; Mukeria, Anush; Shangina, Oxana; Stevens, Victoria L.; Thun, Michael J.; Diver, W. Ryan; Gapstur, Susan M.; Pharoah, Paul D.; Easton, Douglas F.; Albanes, Demetrius; Weinstein, Stephanie J.; Virtamo, Jarmo; Vatten, Lars; Hveem, Kristian; Njolstad, Inger; Tell, Grethe S.; Stoltenberg, Camilla; Kumar, Rajiv; Koppova, Kvetoslava; Cussenot, Olivier; Benhamou, Simone; Oosterwijk, Egbert; Vermeulen, Sita H.; Aben, Katja K. H.; van der Marel, Saskia L.; Ye, Yuanqing; Wood, Christopher G.; Pu, Xia; Mazur, Alexander M.; Boulygina, Eugenia S.; Chekanov, Nikolai N.; Foglio, Mario; Lechner, Doris; Gut, Ivo; Heath, Simon; Blanche, Helene; Hutchinson, Amy; Thomas, Gilles; Wang, Zhaoming; Yeager, Meredith; Fraumeni, Joseph F.; Skryabin, Konstantin G.; McKay, James D.; Rothman, Nathaniel; Chanock, Stephen J.; Lathrop, Mark; Brennan, Paul

    We conducted a two-stage genome-wide association study of renal cell carcinoma (RCC) in 3,772 affected individuals (cases) and 8,505 controls of European background from 11 studies and followed up 6 SNPs in 3 replication studies of 2,198 cases and 4,918 controls. Two loci on the regions of 2p21 and

  12. Applications of a Sequence of Points in Teaching Linear Algebra, Numerical Methods and Discrete Mathematics

    Science.gov (United States)

    Shi, Yixun

    2009-01-01

    Based on a sequence of points and a particular linear transformation generalized from this sequence, two recent papers (E. Mauch and Y. Shi, "Using a sequence of number pairs as an example in teaching mathematics". Math. Comput. Educ., 39 (2005), pp. 198-205; Y. Shi, "Case study projects for college mathematics courses based on a particular…

  13. Download this PDF file

    African Journals Online (AJOL)

    This paper examines the quality of palm oil samples obtained from different locations in Abia State,. Nigeria in terms of their physicochemical properties. The results obtained showed that the saponification value (SV) ranged from 129.04 - 198,03KOH/g of oil. The free fatty acid (FFA) of the palm oil samples ranged from 2.73 ...

  14. Quality assessment of palm oil sold in major markets in Abia State ...

    African Journals Online (AJOL)

    This paper examines the quality of palm oil samples obtained from different locations in Abia State, Nigeria in terms of their physicochemical properties. The results obtained showed that the saponification value (SV) ranged from 129.04 – 198.03KOH/g of oil. The free fatty acid (FFA) of the palm oil samples ranged from 2.73 ...

  15. 11 Soil Microbial Biomass

    African Journals Online (AJOL)

    186–198. Insam H. (1990). Are the soil microbial biomass and basal respiration governed by the climatic regime? Soil. Biol. Biochem. 22: 525–532. Insam H. D. and Domsch K. H. (1989). Influence of microclimate on soil microbial biomass. Soil Biol. Biochem. 21: 211–21. Jenkinson D. S. (1988). Determination of microbial.

  16. Inflation convergence within the European Union: a panel data analysis

    Czech Academy of Sciences Publication Activity Database

    Kočenda, Evžen; Papell, D. H.

    1997-01-01

    Roč. 2, č. 3 (1997), s. 189-198 ISSN 1076-9307 Keywords : inflation convergence * European Union * panel data Subject RIV: AH - Economics http://search.ebscohost.com/login.aspx?direct=true&db=bth&AN=16616418&site=ehost-live

  17. Ostrich: Journal of African Ornithology - Vol 75, No 4 (2004)

    African Journals Online (AJOL)

    Fowl play: identification and management of hybridisation between wild and domestic Helmeted Guineafowl (Numida meleagris) in South Africa · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Andrew L Walker, Rauri CK Bowie, Charles S Ratcliffe, Timothy M Crowe, 195-198.

  18. Search Results | Page 7 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 61 - 70 of 198 ... This project will increase awareness and access to economic and policy data for ... has significantly increased tobacco consumption among women and ... The Impact of Price, Tax, and Advertising Policies on Alcohol Use in ... for the exceptionally high levels of interpersonal violence in South Africa's ...

  19. Biliary excretion of ciprofloxacin and piperacillin in the obstructed biliary tract

    NARCIS (Netherlands)

    van den Hazel, S. J.; de Vries, X. H.; Speelman, P.; Dankert, J.; Tytgat, G. N.; Huibregtse, K.; van Leeuwen, D. J.

    1996-01-01

    Biliary excretion of ciprofloxacin and piperacillin was determined in cholestatic patients who had undergone endoscopic cholangiography. The median concentration of ciprofloxacin (n = 9) was 2.36 micrograms/ml (range, 0.29 to 19.8 micrograms/ml) in bile compared with 1.66 micrograms/ml (range, 0.73

  20. Low Vision Rehabilitation in a Nursing Home Population: The SEEING Study

    Science.gov (United States)

    Deremeik, James; Broman, Aimee T.; Friedman, David; West, Sheila K.; Massof, Robert; Park, William; Bandeen-Roche, Karen; Frick, Kevin; Munoz, Beatriz

    2007-01-01

    As part of a study of 198 residents with low vision in 28 nursing homes, 91 participated in a low vision rehabilitation intervention. Among the rehabilitation participants, 78% received simple environmental modifications, such as lighting; 75% received low vision instruction; 73% benefited from staff training; and 69% received simple nonoptical…