WorldWideScience

Sample records for astatine 198

  1. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  2. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-09-15

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Discovery of the astatine, radon, francium, and radium isotopes

    Science.gov (United States)

    Fry, C.; Thoennessen, M.

    2013-09-01

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration

    2011-11-30

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  6. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Science.gov (United States)

    Uusitalo, J.; Jakobsson, U.

    2011-11-01

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  7. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy.

    Science.gov (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  9. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others

    2015-10-15

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  10. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Science.gov (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.

    2015-10-01

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  11. Comment: 198 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available ゲノム比較解析のためにゲノム解読が行われた。 撮影:成瀬清(基礎生物学研究所) Photo: Kiyoshi Naruse (National Institute for Basic Biology) bando 2009/10/01 14:48:45 2010/01/14 20:09:26 ... ...nal Institute for Basic Biology) licensed under CC Attribution2.1 Japan メダカ近交系 HNI-Ⅱ系統 北日本集団由来の純系。 Hd-rR系統との...Japanese medaka Oryzias latipes Oryzias_latipes_L.png 198.png Kiyoshi Naruse (Natio

  12. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  13. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  14. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  15. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  16. 21 CFR 211.198 - Complaint files.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Complaint files. 211.198 Section 211.198 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Records and Reports § 211.198 Complaint...

  17. 49 CFR 572.198 - Pelvis acetabulum.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 7 2010-10-01 2010-10-01 false Pelvis acetabulum. 572.198 Section 572.198... Dummy, Small Adult Female § 572.198 Pelvis acetabulum. (a) The acetabulum is part of the lower torso... torso of the assembled dummy (drawing 180-0000). The dummy is equipped with a laterally oriented pelvis...

  18. 50 CFR 665.198 - Management area.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Management area. 665.198 Section 665.198 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE (CONTINUED) FISHERIES IN THE WESTERN PACIFIC Hawaii Fisheries § 665.198 Management...

  19. Nuclear Data Sheets for A = 198

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Xiaolong; Kang, Mengxiao

    2016-03-15

    The 2009 version of Nuclear Data Sheets for A=198 (2009Hu11) has been updated and revised on the basis of the experimental results from various decay and reaction studies before December 2014. The experimental data for all known nuclei with mass number A=198 (Re,Os,Ir,Pt,Au,Hg,Tl,Pb,Bi,Po,At,Rn,Fr) have been revised, updated, and incorporated into the ENSDF data file. The experimental methods, references, Jπ arguments, and necessary comments are given in the text. The adopted levels for 198Re and 198Fr are firstly presented in this evaluation. In addition, Q values have been updated based on 2012Wa38.

  20. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  1. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  2. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  3. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study

    Science.gov (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi

    2018-01-01

    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).

  4. 21 CFR 820.198 - Complaint files.

    Science.gov (United States)

    2010-04-01

    ... Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES QUALITY SYSTEM REGULATION Records § 820.198 Complaint files. (a) Each manufacturer shall maintain... reported to FDA under part 803 of this chapter, Medical Device Reporting. (b) Each manufacturer shall...

  5. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  6. Decolorization of a textile dye, reactive red 198 (rr198, by Aspergillus parasiticus fungal biosorbent

    Directory of Open Access Journals (Sweden)

    S. Tunali Akar

    2009-06-01

    Full Text Available The decolorization potential of textile dye Reactive Red 198 (RR198 by Aspergillus parasiticus fungal biosorbent has been investigated as a function of initial pH, contact time, biosorbent and initial dye concentration in a batch system. Maximum dye biosorption capacity 1.03x10-4 mol g-1 was observed at pH 2.0 and 2.0 g L-1 of biosorbent concentration. Biosorption equilibrium was attained within 50 min. The equilibrium data followed Langmuir, Freundlich and Dubinin-Radushkevich isotherm models at 20, 30, 40 and 50ºC. Anincrease in the biosorption capacity of A. parasiticus with temperature showed that the decolorization process is endothermic. Results indicated that Aspergillus parasiticus was an effective candidate for textile dye RR198 removal from aqueous solutions.

  7. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  8. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  9. 22 CFR 19.8 - Obligations of members.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Obligations of members. 19.8 Section 19.8 Foreign Relations DEPARTMENT OF STATE PERSONNEL BENEFITS FOR SPOUSES AND FORMER SPOUSES OF PARTICIPANTS IN THE FOREIGN SERVICE RETIREMENT AND DISABILITY SYSTEM § 19.8 Obligations of members. Participants and...

  10. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  11. 30 CFR 250.198 - Documents incorporated by reference.

    Science.gov (United States)

    2010-07-01

    ..., Section 3—Concentric, Square-Edged Orifice Meters; Part 3—Natural Gas Applications; Third Edition, August... GAS AND SULPHUR OPERATIONS IN THE OUTER CONTINENTAL SHELF General References § 250.198 Documents...-642-4900; and/or American Society of Mechanical Engineers (ASME), 22 Law Drive, P.O. Box 2900...

  12. 19 CFR 10.198 - Evidence of country of origin.

    Science.gov (United States)

    2010-04-01

    ... § 10.198 Evidence of country of origin. (a) Shipments covered by a formal entry—(1) Articles not wholly... beneficiary country where the article was produced or last processed shall be prepared to submit directly to... the articles described below (a) were produced or manufactured in ________ (country) by means of...

  13. GT198 Expression Defines Mutant Tumor Stroma in Human Breast Cancer.

    Science.gov (United States)

    Yang, Zheqiong; Peng, Min; Cheng, Liang; Jones, Kimya; Maihle, Nita J; Mivechi, Nahid F; Ko, Lan

    2016-05-01

    Human breast cancer precursor cells remain to be elucidated. Using breast cancer gene product GT198 (PSMC3IP; alias TBPIP or Hop2) as a unique marker, we revealed the cellular identities of GT198 mutant cells in human breast tumor stroma. GT198 is a steroid hormone receptor coactivator and a crucial factor in DNA repair. Germline mutations in GT198 are present in breast and ovarian cancer families. Somatic mutations in GT198 are present in ovarian tumor stromal cells. Herein, we show that human breast tumor stromal cells carry GT198 somatic mutations and express cytoplasmic GT198 protein. GT198(+) stromal cells share vascular smooth muscle cell origin, including myoepithelial cells, adipocytes, capillary pericytes, and stromal fibroblasts. Frequent GT198 mutations are associated with GT198(+) tumor stroma but not with GT198(-) tumor cells. GT198(+) progenitor cells are mostly capillary pericytes. When tested in cultured cells, mutant GT198 induces vascular endothelial growth factor promoter, and potentially promotes angiogenesis and adipogenesis. Our results suggest that multiple lineages of breast tumor stromal cells are mutated in GT198. These findings imply the presence of mutant progenitors, whereas their descendants, carrying the same GT198 mutations, are collectively responsible for forming breast tumor microenvironment. GT198 expression is, therefore, a specific marker of mutant breast tumor stroma and has the potential to facilitate diagnosis and targeted treatment of human breast cancer. Copyright © 2016 American Society for Investigative Pathology. Published by Elsevier Inc. All rights reserved.

  14. Phenotype-gene: 198 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 198 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1196i decreased size for quantity.../metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u12566580i decreased size for quantity of inflorescence http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u721i AT4G08150

  15. Optimization of the Parameters Affecting the Fenton Process for Decolorization of Reactive Red 198 (RR-198 from the Aqueous Phase

    Directory of Open Access Journals (Sweden)

    Mansooreh Dehghani

    2015-10-01

    Full Text Available Background: Recently, there has been a great concern about the consumption of dyes because of their toxicity, mutagenicity, carcinogenicity, and persistence in the aquatic environment. Reactive dyes are widely used in textile industry. Advanced oxidation processes are one of the cost-effective methods for the removal of these dyes. The main aims of this study were determining the feasibility of using Fenton process in removing Reactive Red 198 (RR-198 dye from aqueous solution and determining the optimal conditions. Methods: This is a cross-sectional study conducted at a laboratory scale. A total of 69 samples were considered and the effect of pH, Fe (II concentration, H2O2 concentration, initial dye concentration and reaction time were investigated. Results: According to the results, a maximum removal efficiency of 92% was obtained at pH of 3 and the reaction time of 90 min; also, the concentration of Fe (II, H2O2, initial dye concentration were 100 mg/L, 50 mg/L, and 100 mg/L, respectively. The results revealed that by increasing the concentration of Fe (II, H2O2 and initial dye, the removal efficiency was increased. Conclusions: The results showed that Fenton process could be used as a cost-effective method for removing RR-198 dye from textile wastewater efficiently.

  16. Optimization of the Parameters Influencing the Photo-Fenton Process for the Decolorization of Reactive Red 198 (RR198

    Directory of Open Access Journals (Sweden)

    Dehghani

    2015-04-01

    Full Text Available Background Reactive dyes, anionic compounds with high water solubility, are widely used in textile industries. Objectives The present study aimed to assess the feasibility of the photo-Fenton process in removing Reactive Red 198 dye from aqueous solutions and determine the optimal conditions for maximum removal. Materials and Methods This study was performed on a laboratory scale using a 4-liter photochemical reactor. The spectrophotometer DR5000 (wavelength 520 nm was used to determine the dye concentration. The effect of the influencing parameters, including pH (3–9, Fe (II concentration (10–200 mg/L, H2O2 concentration (25 - 150 mg/L, initial dye concentration (50–200 mg/L, and reaction time (15 - 120 minutes were studied. Results According to the results, the photo-Fenton (UV/ H2O2/Fe (II process significantly removed dye from the aqueous solution. The Reactive Red 198 dye removal efficiency from aqueous solutions was more than 99% at optimal conditions (pH = 3, Fe (II = 10 mg/L, H2O2 = 75 mg/L, initial dye concentration = 50 mg/L, and reaction time = 120 minutes. Conclusions The present study demonstrated that the UV/ H2O2/Fe (II process could be used as an efficient, reliable method for removing Reactive Red 198 dye from textile wastewater.

  17. 43 CFR 19.8 - Prospecting, mineral locations, mineral patents, and mineral leasing within National Forest...

    Science.gov (United States)

    2010-10-01

    ... patents, and mineral leasing within National Forest Wilderness. 19.8 Section 19.8 Public Lands: Interior... § 19.8 Prospecting, mineral locations, mineral patents, and mineral leasing within National Forest... locations, mineral patents, and mineral leasing within National Forest Wilderness are contained in parts...

  18. 40 CFR 267.198 - What are the general operating requirements for my tank systems?

    Science.gov (United States)

    2010-07-01

    ... FACILITIES OPERATING UNDER A STANDARDIZED PERMIT Tank Systems § 267.198 What are the general operating... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What are the general operating requirements for my tank systems? 267.198 Section 267.198 Protection of Environment ENVIRONMENTAL PROTECTION...

  19. 42 CFR 413.198 - Recordkeeping and cost reporting requirements for outpatient maintenance dialysis.

    Science.gov (United States)

    2010-10-01

    ... outpatient maintenance dialysis. 413.198 Section 413.198 Public Health CENTERS FOR MEDICARE & MEDICAID... § 413.198 Recordkeeping and cost reporting requirements for outpatient maintenance dialysis. (a) Purpose... will enable CMS to determine the costs incurred in furnishing outpatient maintenance dialysis as...

  20. Acquisition through horizontal gene transfer of plasmid pSMA198 by Streptococcus macedonicus ACA-DC 198 points towards the dairy origin of the species.

    Science.gov (United States)

    Papadimitriou, Konstantinos; Anastasiou, Rania; Maistrou, Eleni; Plakas, Thomas; Papandreou, Nikos C; Hamodrakas, Stavros J; Ferreira, Stéphanie; Supply, Philip; Renault, Pierre; Pot, Bruno; Tsakalidou, Effie

    2015-01-01

    Streptococcus macedonicus is an intriguing streptococcal species whose most frequent source of isolation is fermented foods similarly to Streptococcus thermophilus. However, S. macedonicus is closely related to commensal opportunistic pathogens of the Streptococcus bovis/Streptococcus equinus complex. We analyzed the pSMA198 plasmid isolated from the dairy strain Streptococcus macedonicus ACA-DC 198 in order to provide novel clues about the main ecological niche of this bacterium. pSMA198 belongs to the narrow host range pCI305/pWV02 family found primarily in lactococci and to the best of our knowledge it is the first such plasmid to be reported in streptococci. Comparative analysis of the pSMA198 sequence revealed a high degree of similarity with plasmids isolated from Lactococcus lactis strains deriving from milk or its products. Phylogenetic analysis of the pSMA198 Rep showed that the vast majority of closely related proteins derive from lactococcal dairy isolates. Additionally, cloning of the pSMA198 ori in L. lactis revealed a 100% stability of replication over 100 generations. Both pSMA198 and the chromosome of S. macedonicus exhibit a high percentage of potential pseudogenes, indicating that they have co-evolved under the same gene decay processes. We identified chromosomal regions in S. macedonicus that may have originated from pSMA198, also supporting a long co-existence of the two replicons. pSMA198 was also found in divergent biotypes of S. macedonicus and in strains isolated from dispersed geographic locations (e.g. Greece and Switzerland) showing that pSMA198's acquisition is not a recent event. Here we propose that S. macedonicus acquired plasmid pSMA198 from L. lactis via an ancestral genetic exchange event that took place most probably in milk or dairy products. We provide important evidence that point towards the dairy origin of this species.

  1. Acquisition through horizontal gene transfer of plasmid pSMA198 by Streptococcus macedonicus ACA-DC 198 points towards the dairy origin of the species.

    Directory of Open Access Journals (Sweden)

    Konstantinos Papadimitriou

    Full Text Available Streptococcus macedonicus is an intriguing streptococcal species whose most frequent source of isolation is fermented foods similarly to Streptococcus thermophilus. However, S. macedonicus is closely related to commensal opportunistic pathogens of the Streptococcus bovis/Streptococcus equinus complex.We analyzed the pSMA198 plasmid isolated from the dairy strain Streptococcus macedonicus ACA-DC 198 in order to provide novel clues about the main ecological niche of this bacterium. pSMA198 belongs to the narrow host range pCI305/pWV02 family found primarily in lactococci and to the best of our knowledge it is the first such plasmid to be reported in streptococci. Comparative analysis of the pSMA198 sequence revealed a high degree of similarity with plasmids isolated from Lactococcus lactis strains deriving from milk or its products. Phylogenetic analysis of the pSMA198 Rep showed that the vast majority of closely related proteins derive from lactococcal dairy isolates. Additionally, cloning of the pSMA198 ori in L. lactis revealed a 100% stability of replication over 100 generations. Both pSMA198 and the chromosome of S. macedonicus exhibit a high percentage of potential pseudogenes, indicating that they have co-evolved under the same gene decay processes. We identified chromosomal regions in S. macedonicus that may have originated from pSMA198, also supporting a long co-existence of the two replicons. pSMA198 was also found in divergent biotypes of S. macedonicus and in strains isolated from dispersed geographic locations (e.g. Greece and Switzerland showing that pSMA198's acquisition is not a recent event.Here we propose that S. macedonicus acquired plasmid pSMA198 from L. lactis via an ancestral genetic exchange event that took place most probably in milk or dairy products. We provide important evidence that point towards the dairy origin of this species.

  2. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.

    2017-04-01

    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  3. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination.

    Science.gov (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick

    2007-01-01

    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  4. MicroRNA-198 inhibited tumorous behaviors of human osteosarcoma through directly targeting ROCK1

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Shilian, E-mail: shilian_zhang@126.com; Zhao, Yuehua; Wang, Lijie

    2016-04-08

    Osteosarcoma is an aggressive primary sarcoma of bone and occurs mainly in adolescents and young adults. The prognosis of OS remains poor, and most of them will die due to local relapse or metastases. The discovery of microRNAs provides a new possibility for the early diagnosis and treatment of OS. Thus, the aim of this study was to explore the expression and functions of microRNA-198 (miR-198) in osteosarcoma. The expression levels of miR-198 were determined by qRT-PCR in osteosarcoma tissues and cell lines. Cell proliferation assays, migration and invasion assays were adopted to investigate the effects of miR-198 on tumorous behaviors of osteosarcoma cells. The results showed that miR-198 expression levels were lower in osteosarcoma tissues and cell lines. In addition, low miR-198 expression levels were correlated with TNM stage and distant metastasis. After miR-198 mimics transfection, cell proliferation, migration and invasion were significantly suppressed in the osteosarcoma cells. Furthermore, ROCK1 was identified as a novel direct target of miR-198 in osteosarcoma. These findings suggested that miR-198 may act not only as a novel prognostic marker, but also as a potential target for molecular therapy of osteosarcoma.

  5. Human Ovarian Cancer Stroma Contains Luteinized Theca Cells Harboring Tumor Suppressor Gene GT198 Mutations*

    Science.gov (United States)

    Peng, Min; Zhang, Hao; Jaafar, Lahcen; Risinger, John I.; Huang, Shuang; Mivechi, Nahid F.; Ko, Lan

    2013-01-01

    Ovarian cancer is a highly lethal gynecological cancer, and its causes remain to be understood. Using a recently identified tumor suppressor gene, GT198 (PSMC3IP), as a unique marker, we searched for the identity of GT198 mutant cells in ovarian cancer. GT198 has germ line mutations in familial and early onset breast and ovarian cancers and recurrent somatic mutations in sporadic fallopian tube cancers. GT198 protein has been shown as a steroid hormone receptor coregulator and also as a crucial factor in DNA repair. In this study, using GT198 as a marker for microdissection, we find that ovarian tumor stromal cells harboring GT198 mutations are present in various types of ovarian cancer including high and low grade serous, endometrioid, mucinous, clear cell, and granulosa cell carcinomas and in precursor lesions such as inclusion cysts. The mutant stromal cells consist of a luteinized theca cell lineage at various differentiation stages including CD133+, CD44+, and CD34+ cells, although the vast majority of them are differentiated overexpressing steroidogenic enzyme CYP17, a theca cell-specific marker. In addition, wild type GT198 suppresses whereas mutant GT198 protein stimulates CYP17 expression. The chromatin-bound GT198 on the human CYP17 promoter is decreased by overexpressing mutant GT198 protein, implicating the loss of wild type suppression in mutant cells. Together, our results suggest that GT198 mutant luteinized theca cells overexpressing CYP17 are common in ovarian cancer stroma. Because first hit cancer gene mutations would specifically mark cancer-inducing cells, the identification of mutant luteinized theca cells may add crucial evidence in understanding the cause of human ovarian cancer. PMID:24097974

  6. Human ovarian cancer stroma contains luteinized theca cells harboring tumor suppressor gene GT198 mutations.

    Science.gov (United States)

    Peng, Min; Zhang, Hao; Jaafar, Lahcen; Risinger, John I; Huang, Shuang; Mivechi, Nahid F; Ko, Lan

    2013-11-15

    Ovarian cancer is a highly lethal gynecological cancer, and its causes remain to be understood. Using a recently identified tumor suppressor gene, GT198 (PSMC3IP), as a unique marker, we searched for the identity of GT198 mutant cells in ovarian cancer. GT198 has germ line mutations in familial and early onset breast and ovarian cancers and recurrent somatic mutations in sporadic fallopian tube cancers. GT198 protein has been shown as a steroid hormone receptor coregulator and also as a crucial factor in DNA repair. In this study, using GT198 as a marker for microdissection, we find that ovarian tumor stromal cells harboring GT198 mutations are present in various types of ovarian cancer including high and low grade serous, endometrioid, mucinous, clear cell, and granulosa cell carcinomas and in precursor lesions such as inclusion cysts. The mutant stromal cells consist of a luteinized theca cell lineage at various differentiation stages including CD133(+), CD44(+), and CD34(+) cells, although the vast majority of them are differentiated overexpressing steroidogenic enzyme CYP17, a theca cell-specific marker. In addition, wild type GT198 suppresses whereas mutant GT198 protein stimulates CYP17 expression. The chromatin-bound GT198 on the human CYP17 promoter is decreased by overexpressing mutant GT198 protein, implicating the loss of wild type suppression in mutant cells. Together, our results suggest that GT198 mutant luteinized theca cells overexpressing CYP17 are common in ovarian cancer stroma. Because first hit cancer gene mutations would specifically mark cancer-inducing cells, the identification of mutant luteinized theca cells may add crucial evidence in understanding the cause of human ovarian cancer.

  7. 14 CFR 198.15 - Non-premium insurance-payment of registration binders.

    Science.gov (United States)

    2010-01-01

    ... registration binders. 198.15 Section 198.15 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT...—payment of registration binders. (a) The binder for initial registration is $575 for each aircraft or insurable item. This binder is adjusted not more frequently than annually based on changes in the Consumer...

  8. The nucleus 198Au investigated with neutron capture and transfer reactions. I. Experiments and evaluation.

    Science.gov (United States)

    Mayerhofer, Ulrich; von Egidy, Till; Klora, Jörg; Lindner, Helmut; Börner, Hans G.; Judge, Stephen; Krusche, Bernd; Robinson, Stephen; Schreckenbach, Klaus; Sukhovoj, Anatoly M.; Khitrov, Valery A.; Boneva, Stefka T.; Paar, Vladimir; Brant, Slobodan; Pezer, Robert

    The transfer reaction 197Au(d,p)198Au was measured at the Tandem Accelerator in Munich. The 197Au(n,g)198Au and 197Au(n,e)198Au reactions were performed at the High Flux Reactor of ILL, Grenoble. Up to 1560 keV a total of 111 levels were observed by the (d,p) reaction and 125 by the (n,g) reaction. For many of the levels, spins and parities were assigned. Additional information was obtained from summed (n,gg) coincidences measured in Dubna.

  9. Rational Design of Cyclic Antimicrobial Peptides Based on BPC194 and BPC198

    OpenAIRE

    Cirac, Anna D.; Maria Torné; Esther Badosa; Emilio Montesinos; Pedro Salvador; Lidia Feliu; Marta Planas

    2017-01-01

    A strategy for the design of antimicrobial cyclic peptides derived from the lead compounds c(KKLKKFKKLQ) (BPC194) and c(KLKKKFKKLQ) (BPC198) is reported. First, the secondary β-structure of BPC194 and BPC198 was analyzed by carrying out molecular dynamics (MD) simulations. Then, based on the sequence pattern and the β-structure of BPC194 or BPC198, fifteen analogues were designed and synthesized on solid-phase. The best peptides (BPC490, BPC918, and BPC924) showed minimum inhibitory concentra...

  10. Yeast Interacting Proteins Database: YGL198W, YDR084C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGL198W YIP4 Protein that interacts with Rab GTPases, localized to late Golgi vesicles; computational... GTPases, localized to late Golgi vesicles; computational analysis of large-scale protein-protein interactio

  11. Yeast Interacting Proteins Database: YDL226C, YGL198W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available s bait as prey (0) YGL198W YIP4 Protein that interacts with Rab GTPases, localized to late Golgi vesicles; computational...iption Protein that interacts with Rab GTPases, localized to late Golgi vesicles; computational

  12. Cyclotron produced 198gAu, a potential radionuclide for diagnostic and therapeutic applications

    Science.gov (United States)

    Khandaker, Mayeen Uddin; Haba, Hiromitsu; Kassim, Hasan Abu

    2016-02-01

    Production cross-sections of the natPt(d,x)198Au reactions have been measured from a 24-MeV deuteron energy down to the threshold by using a stacked-foil activation technique combined with HPGe γ-ray spectrometry. Only a partial agreement is obtained with the existing literature data and the theoretical data extracted from the TENDL-2013 library. Physical thick target yield for the 198Au radionuclide was deduced using the measured cross-sections, and found a general agreement with the directly measured yield available in the literature. This study reveals that a low deuteron energy (<15 MeV) cyclotron and an enriched 198Pt (100%) target could be used to obtain 198Au in no carrier added form.

  13. 15 CFR 19.8 - When will Commerce entities suspend or terminate debt collection on a Commerce debt?

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false When will Commerce entities suspend or terminate debt collection on a Commerce debt? 19.8 Section 19.8 Commerce and Foreign Trade Office of the Secretary of Commerce COMMERCE DEBT COLLECTION Procedures To Collect Commerce Debts § 19.8 When will...

  14. Synthesis and Characterization of Poly(Amidoamine Dendrimers Encapsulatd 198Au Nanoparticles

    Directory of Open Access Journals (Sweden)

    R. Ritawidya1,2

    2012-12-01

    Full Text Available Brachytherapy or internal radiotherapy is one of many methods used for treatment of cancer. This modality requires an agent with radionuclides that emits  or β particle with a proper energy. 198Au (99% β max = 0.96 MeV and t1/2 = 2.69 days is one of radionuclides that has been considered to be effective for the above-mentioned purpose. The purpose of this research was to synthesis and characterize poly(amidoamine (PAMAM G3.0 dendrimers encapsulated 198Au nanoparticles as a new brachytherapy agent. PAMAM G3.0 dendrimers encapsulated 198Au nanoparticles was successfully synthesized by a bottom-up method using sodium borohydride as a reductor. Purification was then performed by a size exclusion chromatography in order to separate large Au nanoparticles that were formed outside the cavity of PAMAM G3.0 dendrimers. Prior to the synthesis of PAMAM G3.0 dendrimers encapsulated 198Au nanoparticles, the synthetic procedure was first established by using a non-radioactive Au. The PAMAM G3.0 dendrimers encapsulated Au nanoparticles produced was then characterized by using an UV-Vis spectroscopy, a transmission electron microscopy (TEM, particle size analyzer (PSA, and an atomic absorption spectroscopy (AAS. Characterization results revealed that PAMAM G3.0 dendrimers encapsulated Au nanoparticles that were prepared from a reaction mixture of PAMAM G3.0 dendrimers and Au HAuCl4 with mol ratio of 2.8, was found to be a proper formula. It produced PAMAM G3.0 dendrimers encapsulated Au nanoparticles with diameter of 1.743 nm, spheris, uniform and drug loading value of 26.34%. This formula was then used in synthesis using radioactive Au, 198Au. Characterization results of PAMAM G3.0 dendrimers encapsulated 198Au nanoparticles gave a radiochemical purity of 99.4% and zero charge.

  15. 14 CFR 121.198 - Cargo service airplanes: Increased zero fuel and landing weights.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Cargo service airplanes: Increased zero... AND OPERATIONS OPERATING REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Airplane Performance Operating Limitations § 121.198 Cargo service airplanes: Increased zero fuel and landing weights...

  16. Yeast Interacting Proteins Database: YDR425W, YGL198W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available with this bait as prey (0) YGL198W YIP4 Protein that interacts with Rab GTPases, localized to late Golgi vesicles; computational...IP4 Prey description Protein that interacts with Rab GTPases, localized to late Golgi vesicles; computatio...nal analysis of large-scale protein-protein interaction data suggests a possible ro

  17. 19 CFR 10.198a - Duty reduction for certain leather-related articles.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Duty reduction for certain leather-related... Basin Initiative § 10.198a Duty reduction for certain leather-related articles. Except as otherwise..., flat goods, work gloves, and leather wearing apparel that were not designated on August 5, 1983, as...

  18. Degradation analysis of Reactive Red 198 by hairy roots of Tagetes patula L. (Marigold).

    Science.gov (United States)

    Patil, Pratibha; Desai, Neetin; Govindwar, Sanjay; Jadhav, Jyoti Prafulla; Bapat, Vishwas

    2009-09-01

    Tagetes patula L. (Marigold) hairy roots were selected among few hairy root cultures from other plants tested for the decolorization of Reactive Red 198. Hairy roots of Tagetes were able to remove dye concentrations up to 110 mg L(-l) and could be successively used at least for five consecutive decolorization cycles. The hairy roots of Tagetes decolorized six different dyes, viz. Golden Yellow HER, Methyl Orange, Orange M2RL, Navy Blue HE2R, Reactive Red M5B and Reactive Red 198. Significant induction of the activity of biotransformation enzymes indicated their crucial role in the dye metabolism. UV-vis spectroscopy, HPLC and FTIR spectroscopy analyses confirmed the degradation of Reactive Red 198. A possible pathway for the biodegradation of Reactive Red 198 has been proposed with the help of GC-MS and metabolites identified as 2-aminonaphthol, p-aminovinylsulfone ethyl disulfate and 1-aminotriazine, 3-pyridine sulfonic acid. The phytotoxicity study demonstrated the non-toxic nature of the extracted metabolites. The use of such hairy root cultures with a high ability for bioremediation of dyes is discussed.

  19. 37 CFR 2.198 - Filing of correspondence by “Express Mail.”

    Science.gov (United States)

    2010-07-01

    ... OFFICE, DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES General Information and Correspondence in Trademark Cases § 2.198 Filing of correspondence by “Express Mail.” (a)(1) Except for documents... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Filing of correspondence by â...

  20. Comparing the Methodologies in ASTM G198: Is There an Easy Way Out?

    Science.gov (United States)

    Samuel L. Zelinka

    2013-01-01

    ASTM(1) G198, Standard test method for determining the relative corrosion performance of driven fasteners in contact with treated wood, was accepted by consensus and published in 2011. The method has two different exposure conditions for determining fastener corrosion performance in treated wood. The first method places the wood and embedded...

  1. Comparing the Methodologies in ASTM G198 Using Combined Hygrothermal-Corrosion Modeling

    Science.gov (United States)

    Samuel L. Zelinka

    2013-01-01

    ASTM G198, “Standard test method for determining the relative corrosion performance of driven fasteners in contact with treated wood,” was accepted by consensus and published in 2011. The method has two different exposure conditions for determining fastener corrosion performance in treated wood. The first method places the wood and embedded fasteners in a...

  2. Application of radioisotopes Au -198 to radiometrical field investigation of spraying machine

    Energy Technology Data Exchange (ETDEWEB)

    Goraczko, W.; Kocorowska, E. [Technical Univeristy, Poznan (Poland). Radio and Photo-Chemistry Department

    1997-10-01

    The poster shows application of radioisotope {sup 198}Au to radiometrical field testing of spraying machine. In the research was tested the Polish suspensioned tractor OZS400 type spraying machine. The machine worked in two different variants: without and with the beam stabilisation (oscillatory stabilisation)

  3. miR-198 functions as a tumor suppressor in breast cancer by targeting CUB domain-containing protein 1.

    Science.gov (United States)

    Hu, Yingbin; Tang, Ziyuan; Jiang, Bonian; Chen, Juying; Fu, Zhongpin

    2017-03-01

    The molecular mechanisms underlying the dysregulation of microRNAs (miRs) have been previously documented in breast cancer. miR-198 has been reported to be deregulated in several human cancers. However, the detailed effects of miR-198 on breast cancer progression remain unclear. Using quantitative polymerase chain reaction analysis, we demonstrated in the present study that miR-198 was downregulated in breast cancer tissues and cell lines, and that downregulation of miR-198 was significantly correlated with lymph node metastasis. Functional studies revealed that miR-198 inhibited cell proliferation and migration and promoted cell adhesion in aggressive breast cancer cells in vitro. In addition, we observed that CUB domain-containing protein 1 (CDCP1) was a direct target of miR-198, and that knockdown of CDCP1 inhibited cell proliferation and migration, and promoted cell adhesion, which was similar to the effects of overexpression of miR-198. Taken together, we provide evidence to characterize the role of miR-198/CDCP1 interaction in breast cancer, which may be useful in breast cancer therapy.

  4. The half-life of 198Au : High-precision measurement shows no temperature dependence

    Science.gov (United States)

    Goodwin, J. R.; Golovko, V. V.; Iacob, V. E.; Hardy, J. C.

    2007-12-01

    We have measured the half-life of the β -decay of 198Au in a metallic environment, both at low temperature (19K), and also at room temperature. We find the half-lives at both temperatures to be the same within 0.04%, a finding that contradicts a recent report of a 3.6±1.0 % difference in the 198Au half-life when measured at essentially the same two temperatures. Our results for the half-life, 2.6949±0.0009 d at room temperature and 2.6953±0.0008 d at 19K, also agree well with previous precision room temperature measurements.

  5. Yeast Interacting Proteins Database: YGL198W, YGL161C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGL198W YIP4 Protein that interacts with Rab GTPases, localized to late Golgi vesicles; computational...that interacts with Rab GTPases, localized to late Golgi vesicles; computational ...eracts with Rab GTPases, localized to late Golgi vesicles; computational analysis of large-scale protein-pro...ized to late Golgi vesicles; computational analysis of large-scale protein-protein interaction data suggests

  6. Determination of environmental dependence of the &-circ; decay half-life of ^198Au

    Science.gov (United States)

    Dibidad, A.; Goodwin, J.; Hardy, J.

    2009-10-01

    A series of articles by the C. Rolfs group [1] claimed changes in the half-lives of isotopes undergoing α, β^-, β^+, and electron-capture decays as the temperature reduced to 12 K from room temperature. These isotopes were contained in metallic, conductive environments, such as Au, Cu, and Pd, but it was also suggested that the half-life is different in an insulator. One publication [1] reported the half-life of ^198Au in a gold metal environment to change by 3.6 ±1.0% between room temperature and 12 K. Until then, radioactive half-lives were considered independent of environmental factors. We repeated the measurements of the ^198Au half-life in a gold metal environment under similar conditions as ref. [1] and demonstrated [2] that the half-life is the same at both temperatures within 0.04%, two orders of magnitude below the original claims. In the experiment reported here, we measured the half-life of ^198Au in an insulated environment -- gold (III) oxide -- at room temperature. Preliminary results indicate there is no difference in the measured half-life in an insulator as compared in a conductor. [4pt] [1] T. Spillane et al, Eur. Phys. J. A 31, 203 (2007) [0pt] [2] J.R. Goodwin et al, Eur. Phys. J. A 34, 271 (2007)

  7. Dosimetric characteristics and a standard for the (198)gold seed used in interstitial brachytherapy

    Science.gov (United States)

    Dauffy, Lucile S.

    Cancer of the prostate can be treated in different ways. One of them, brachytherapy, is an internal irradiation method consisting of the placement of radioactive sources, called seeds, into the tumor. This work deals with the dosimetry of the 198Au interstitial brachytherapy source. In order to facilitate its clinical use and to obtain the data to be employed in the latest treatment planning systems, new quantities and a potential calibration standard are studied. These quantities, based on dose rates, were recommended in 1995 by the American Association of Physicists in Medicine Task Group 43, AAPM TG-43, and have not previously been obtained for 198Au. They are measured in a solid water phantom using thermoluminescent detectors, and calculated using the Monte Carlo N-Particle code, MCNP, and simple analytic models. In the last part of this work, the "198Au equivalent" activity of 137Cs and 192Ir surrogate seeds is calculated since the National Institute of Standards and Technology, NIST, does not provide a standard for the short half-life 198Au source that would allow checking the activity of the seeds before use on patients. This calculation is done by simulating the response of the Sun Nuclear ionization chamber, model 1008, with MCNP 4C. The air kerma strength, Sk, per unit apparent activity is found equal to 2.0627 (MCNP) and 2.0889 U mCi-1 (measured). Sk per unit activity is 1.8050 U mCi-1 (MCNP). The dose rate constant per unit apparent activity, Λ/Aapp, is equal to 2.3099 (MCNP) and 2.2878 cGy h-1 mCi -1 (measured). This same quantity per unit air kerma strength is 1.1198 (MCNP) and 1.0952 cGy h-1 U-1 (measured). The values of the radial dose function, g(r), the anisotropy function, F(r,θ), the anisotropy factor, φan(r), and the anisotropy constant are also given. Finally, the "198Au equivalent" activity for the 192Ir surrogate seed is equal to 1.9549 times the real activity of the 192Ir seed, and that for the 137Cs surrogate seed is 1.4895 times its

  8. Study of various processes for marking sediments with gold-198; Etude de divers procedes de marquages de sediments par l'or 198

    Energy Technology Data Exchange (ETDEWEB)

    Jeanneau, B. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1967-12-15

    The use of radioactive isotopes for the study of sediment deposits is based mainly on two methods: marking in the mass - a glass of an element which can be activated replaces the sediment; surface marking - a physico-chemical process is used to deposit a radio-element at the surface of the sediment. The second process is used in particular for sands when it is advantageous to have a large number of particles for statistical analysis. The aim of this work was to develop a rapid and simple method of marking which could be applied on the actual site of the experiment where equipment, may be limited. The method recommended for marking sand with gold-198 is a combination of the Petersen (treatment with tin chloride) and Campbell (treatment with silver) methods combined with prior treatments with nitric acid and caustic soda. Using this method it is possible to deposit 125 mg of gold per kilo of sediment with a yield of 95 per cent (i.e. 10 Ci/kg) using a hydrochloric acid solution containing gold. The problem of the solidity of the deposits, of their value and of their reproducibility is discussed from the point of view of the mineral constitution of the sand. (author) [French] L'utilisation d'isotopes radioactifs pour l'etude des deplacements sedimentaires fait, principalement appel a deux methodes: le marquage massique - un verre contenant un element activable remplace le sediment; le marquage superficiel - un traitement physico-chimique permet de deposer un radioelement a la surface du sediment. Le second procede est surtout employe pour les sables lorsqu'il est utile de disposer d'un grand nombre de grains pour des raisons statistiques. Le but de ce travail etait de mettre au point une methode simple et rapide de marquage pouvant etre appliquee sur le site meme de l'experience pour les utilisateurs disposant d'un equipement limite. Le procede preconise pour le marquage des sables par l'or 198 est une combinaison des methodes

  9. Adsorption Rate of 198 Reactive Red Dye from Aqueous Solutions by using Activated Red Mud

    Directory of Open Access Journals (Sweden)

    MA Zazouli

    2013-06-01

    Full Text Available Backgroud and purpose: Dye is one of the problems of industrial effluent such as textile industries. The dyes can be removed by various methods. Therefore, the aim of this study was the evaluation of adsorption rate of reactive red 198 from aqueous solution by activated red mud. Materials and methods: This research was a lab study. Activated red mud was used as an adsorbent to remove reactive red 198 dye. The effect of various parameters on performance of adsorbent was investigated and the isotherm of adsorption was determined. The dye concentration was measured in wavelength of 518 nm by spectrophotometer. Results: The results indicated that the adsorption efficiency reduced by increasing of initial dye concentration. Increasing of contact time and adsorbent dose can lead to increasing of the removal efficiency. The maximum removal efficiency was occurred pH between 2 to 3. The data was best fitted on Frandlich and Temkin isotherms. Conclusion: The red mud had a satisfactory quality in dye adsorption. It can be used as effective and inexpensive adsorbents for treatment of textile effluent.

  10. α-decay studies of the francium isotopes 198Fr and 199Fr

    Science.gov (United States)

    Uusitalo, J.; Sarén, J.; Juutinen, S.; Leino, M.; Eeckhaudt, S.; Grahn, T.; Greenlees, P. T.; Jakobsson, U.; Jones, P.; Julin, R.; Ketelhut, S.; Leppänen, A.-P.; Nyman, M.; Pakarinen, J.; Rahkila, P.; Scholey, C.; Semchenkov, A.; Sorri, J.; Steer, A.; Venhart, M.

    2013-06-01

    Very neutron deficient francium isotopes have been produced in fusion evaporation reactions using 60Ni ions on 141Pr targets. The gas-filled recoil separator RITU was employed to collect the fusion products and to separate them from the scattered beam. The activities were implanted into a position sensitive silicon detector after passing through a gas-counter system. The isotopes were identified using spatial and time correlations between the implants and the decays. Two α-particle activities, with Eα=7613(15) keV and T1/2 = (15-5+12) ms and Eα=7684(15) keV and T1/2 = (16-5+13) ms were identified in the new isotope 198Fr. In addition, the half-life and α-particle energy of 199Fr were measured with improved precision. The measured decay properties deduced for 199Fr and 198Fr suggest that there is an onset of ground-state deformation at N=112 in the Fr isotopes.

  11. SCM-198 attenuates early atherosclerotic lesions in hypercholesterolemic rabbits via modulation of the inflammatory and oxidative stress pathways.

    Science.gov (United States)

    Zhang, Yanfei; Guo, Wei; Wen, Yadan; Xiong, Qinghui; Liu, Hongrui; Wu, Jian; Zou, Yunzeng; Zhu, Yizhun

    2012-09-01

    To investigate SCM-198 (also known as "leonurine"), a compound in Herba leonuri, as well as its effect on the progression of atherosclerosis in hypercholesterolemic rabbits and underlying mechanisms. Thirty New Zealand male White rabbits (5 groups, n = 6) were fed either a normal diet or a high-cholesterol diet (1%). The rabbits on the high-cholesterol diet received treatments of low, moderate, and high doses of SCM-198 and placebo concurrently. Eight weeks later, the animals underwent ultrasonographic imaging. They were then sacrificed for further pathological and molecular biological analysis. SCM-198-treated rabbits showed a significant alleviation in the development of atherosclerosis in a dose-dependent manner. The lesions were smaller after the SCM-198 treatments. In addition, the elasticity of the arteries and hemodynamic status improved, accompanied with a decrease in smooth muscle cell migration and, macrophage infiltration, as well as the expression of platelet-endothelial cell adhesion molecule-1 (PECAM-1) in the aortas. Marginal changes in the lipid parameters were found in the SCM-198-treated rabbits, with high-density lipid cholesterol (HDL-C) elevation and triglyceride (TG) reduction at the high dose. SCM-198 treatment dose-dependently reduced levels of serum soluble vascular cell adhesion molecule-1 (sVCAM-1), soluble intercellular adhesion molecule-1 (sICAM-1), interleukin-6 (IL-6) and tumor necrosis factor-α (TNF-α), as well as the mRNA levels of VCAM-1, IL-6, TNF-α, monocyte chemoattractant protein-1 (MCP-1), iNOS and MMP-9 in the aorta. In addition, SCM-198 also dose-dependently increased the total antioxidant capacities and in parallel decreased the lipid peroxidation levels in the serum and liver. The antioxidant effects of SCM-198 were implicated by the enhanced activities of catalase (CAT), superoxide dismutase (SOD), glutathione peroxidase (GPx) and levels of glutathione (GSH) in the liver, as well as the mRNA levels of CAT, SOD-1 and

  12. Removal of Reactive Red 198 by Nanoparticle Zero Valent Iron in the Presence of Hydrogen Peroxide

    Directory of Open Access Journals (Sweden)

    Siroos Shojaei

    2017-04-01

    Full Text Available Although dyes are widely used in textile industries, they are carcinogenic, teratogenic and mutagenic. Industries discharge their wastewater containing a variety of colors into water resources and make harmful effect on the environment. The present study aims to Evaluate removal of reactive red 198 by nanoparticle zero valent iron (NZVI in the presence of hydrogen peroxide from aqueous solution. The effective parameters on the removal of dye such as the hydrogen peroxide concentration of NZVI, contact time, pH and dye concentration were investigated and optimized. According to the results, the combination of NZVI with hydrogen peroxide is more effective than single hydrogen peroxide. At pH = 4, contact time= 40 min, 200 M of hydrogen peroxide, dye concentration= 75 mg/L and concentration of NZVI 2g/L, color removal was achieved 91% approximately. Based on the results of experiments, using hydrogen peroxide- NZVI has high efficiency in removal of azo dye type.

  13. International spread of an epidemic population of Salmonella enterica serotype Kentucky ST198 resistant to ciprofloxacin.

    Science.gov (United States)

    Le Hello, Simon; Hendriksen, Rene S; Doublet, Benoît; Fisher, Ian; Nielsen, Eva Møller; Whichard, Jean M; Bouchrif, Brahim; Fashae, Kayode; Granier, Sophie A; Jourdan-Da Silva, Nathalie; Cloeckaert, Axel; Threlfall, E John; Angulo, Frederick J; Aarestrup, Frank M; Wain, John; Weill, François-Xavier

    2011-09-01

    National Salmonella surveillance systems from France, England and Wales, Denmark, and the United States identified the recent emergence of multidrug-resistant isolates of Salmonella enterica serotype Kentucky displaying high-level resistance to ciprofloxacin. A total of 489 human cases were identified during the period from 2002 (3 cases) to 2008 (174 cases). These isolates belonged to a single clone defined by the multilocus sequence type ST198, the XbaI-pulsed-field gel electrophoresis cluster X1, and the presence of the Salmonella genomic island 1 variant SGI1-K. This clone was probably selected in 3 steps in Egypt during the 1990s and the early 2000s and has now spread to several countries in Africa and, more recently, in the Middle East. Poultry has been identified as a potential major vehicle for infection by this clone. Continued surveillance and appropriate control measures should be implemented by national and international authorities to limit the spread of this strain.

  14. The global establishment of a highly-fluoroquinolone resistant Salmonella enterica serotype Kentucky ST198 strain

    Science.gov (United States)

    Le Hello, Simon; Bekhit, Amany; Granier, Sophie A.; Barua, Himel; Beutlich, Janine; Zając, Magdalena; Münch, Sebastian; Sintchenko, Vitali; Bouchrif, Brahim; Fashae, Kayode; Pinsard, Jean-Louis; Sontag, Lucile; Fabre, Laetitia; Garnier, Martine; Guibert, Véronique; Howard, Peter; Hendriksen, Rene S.; Christensen, Jens P.; Biswas, Paritosh K.; Cloeckaert, Axel; Rabsch, Wolfgang; Wasyl, Dariusz; Doublet, Benoit; Weill, François-Xavier

    2013-01-01

    While the spread of Salmonella enterica serotype Kentucky resistant to ciprofloxacin across Africa and the Middle-East has been described recently, the presence of this strain in humans, food, various animal species (livestock, pets, and wildlife) and in environment is suspected in other countries of different continents. Here, we report results of an in-depth molecular epidemiological study on a global human and non-human collection of S. Kentucky (n = 70). We performed XbaI-pulsed field gel electrophoresis and multilocus sequence typing, assessed mutations in the quinolone resistance-determining regions, detected β-lactam resistance mechanisms, and screened the presence of the Salmonella genomic island 1 (SGI1). In this study, we highlight the rapid and extensive worldwide dissemination of the ciprofloxacin-resistant S. Kentucky ST198-X1-SGI1 strain since the mid-2000s in an increasingly large number of contaminated sources, including the environment. This strain has accumulated an increasing number of chromosomal and plasmid resistance determinants and has been identified in the Indian subcontinent, Southeast Asia and Europe since 2010. The second substitution at position 87 in GyrA (replacing the amino acid Asp) appeared helpful for epidemiological studies to track the origin of contamination. This global study provides evidence leading to the conclusion that high-level resistance to ciprofloxacin in S. Kentucky is a simple microbiological trait that facilitates the identification of the epidemic clone of interest, ST198-X1-SGI1. Taking this into account is essential in order to detect and monitor it easily and to take rapid measures in livestock to ensure control of this infection. PMID:24385975

  15. The global establishment of a highly-fluoroquinolone resistant Salmonella enterica serotype Kentucky ST198 strain

    Directory of Open Access Journals (Sweden)

    Simon eLe Hello

    2013-12-01

    Full Text Available While the spread of Salmonella enterica serotype Kentucky resistant to ciprofloxacin across Africa and the Middle-East has been described recently, the presence of this strain in humans, food, various animal species (livestock, pets, and wildlife and in environment is suspected in other countries of different continents. Here, we report results of an in-depth molecular epidemiological study on a global human and non-human collection of S. Kentucky (n=70.We performed XbaI-pulsed field gel electrophoresis and multilocus sequence typing, assessed mutations in the quinolone resistance-determining regions, detected β-lactam resistance mechanisms, and screened the presence of the Salmonella genomic island 1 (SGI1. In this study, we highlight the rapid and extensive worldwide dissemination of the ciprofloxacin-resistant S. Kentucky ST198-X1-SGI1 strain since the mid-2000s in an increasingly large number of contaminated sources, including the environment. This strain has accumulated an increasing number of chromosomal and plasmid resistance determinants and has been identified in the Indian subcontinent, Southeast Asia and Europe since 2010. The second substitution at position 87 in GyrA (replacing the amino acid Asp appeared helpful for epidemiological studies to track the origin of contamination.This global study provides evidence leading to the conclusion that high-level resistance to ciprofloxacin in S. Kentucky is a simple microbiological trait that facilitates the identification of the epidemic clone of interest, ST198-X1-SGI1. Taking this into account is essential in order to detect and monitor it easily and to take rapid measures in livestock to ensure control of this infection.

  16. Laminin receptor specific therapeutic gold nanoparticles (198AuNP-EGCg) show efficacy in treating prostate cancer

    Energy Technology Data Exchange (ETDEWEB)

    Shukla, R.; Chanda, N.; Zambre, A.; Upendran, A.; Katti, K.; Kulkarni, R. R.; Nune, S. K.; Casteel, S. W.; Smith, C. J.; Vimal, J.; Boote, E.; Robertson, J. D.; Kan, P.; Engelbrecht, H.; Watkinson, L. D.; Carmack, T. L.; Lever, J. R.; Cutler, C. S.; Caldwell, C.; Kannan, R.; Katti, K. V.

    2012-07-16

    Systemic delivery of therapeutic agents to solid tumors is hindered by vascular and interstitial barriers. We hypothesized that prostate tumor specific epigallocatechingallate( EGCg) functionalized radioactive gold nanoparticles, when delivered intratumorally (IT), will circumvent transport barriers, resulting in targeted delivery of therapeutic payloads. The results described herein provide unequivocal validation of our hypothesis. We report the development of inherently therapeutic gold nanoparticles derived from Au-198 isotope; the range of 198Au β-particle ( ~ 11 mm in tissue or ~1100 cell diameters) is sufficiently long to provide cross-fire effects of radiation dose delivered to cells within the prostate gland and short enough to minimize radiation dose to critical tissues near the periphery of the capsule. The formulation of biocompatible 198AuNPs utilizes the redox chemistry of prostate tumor specific phytochemical EGCg as it converts gold salt into gold nanoparticles and also selectively binds with excellent affinity to Laminin67R receptors which are over expressed in prostate tumor cells. Pharmacokinetic studies in PC-3 xenograft SCID mice showed ~72% retention of 198AuNP-EGCg in tumors 24 h after intratumoral administration. Therapeutic studies showed 80% reduction of tumor volumes after 28 days demonstrating significant inhibition of tumor growth compared to controls. This innovative “green nanotechnological“approach serves as a basis for designing target specific antineoplastic agents. This novel intratumorally injectable 198AuNP-EGCg nanotherapeutic agent may provide significant advances in oncology for use as an effective treatment for prostate and other solid tumors.

  17. Letrozole compared with tamoxifen for elderly patients with endocrine-responsive early breast cancer: the BIG 1-98 trial

    DEFF Research Database (Denmark)

    Crivellari, D.; Sun, Z.; Coates, A.S.

    2008-01-01

    PURPOSE: To explore potential differences in efficacy, treatment completion, and adverse events (AEs) in elderly women receiving adjuvant tamoxifen or letrozole for five years in the Breast International Group (BIG) 1-98 trial. METHODS: This report includes the 4,922 patients allocated to 5 years...... of letrozole or tamoxifen in the BIG 1-98 trial. The median follow-up was 40.4 months. Subpopulation Treatment Effect Pattern Plot (STEPP) analysis was used to examine the patterns of differences in disease-free survival and incidences of AEs according to age. In addition, three categoric age groups were...

  18. ramR mutations affecting fluoroquinolone susceptibility in epidemic multidrug-resistant Salmonella enterica serovar Kentucky ST198.

    Science.gov (United States)

    Baucheron, Sylvie; Le Hello, Simon; Doublet, Benoît; Giraud, Etienne; Weill, François-Xavier; Cloeckaert, Axel

    2013-01-01

    A screening for non-target mutations affecting fluoroquinolone susceptibility was conducted in epidemic multidrug-resistant Salmonella enterica serovar Kentucky ST198. Among a panel of representative isolates (n = 27), covering the epidemic, only three showed distinct mutations in ramR resulting in enhanced expression of genes encoding the AcrAB-TolC efflux system and low increase in ciprofloxacin MIC. No mutations were detected in other regulatory regions of this efflux system. Ciprofloxacin resistance in serovar Kentucky ST198 is thus currently mainly due to multiple target gene mutations.

  19. ramR Mutations Affecting Fluoroquinolone Susceptibility in Epidemic Multidrug-Resistant Salmonella enterica Serovar Kentucky ST198

    Directory of Open Access Journals (Sweden)

    Axel eCloeckaert

    2013-07-01

    Full Text Available A screening for non-target mutations affecting fluoroquinolone susceptibility was conducted in epidemic multidrug-resistant Salmonella enterica serovar Kentucky ST198. Among a panel of representative isolates (n=30, covering the epidemic, only three showed distinct mutations in ramR resulting in enhanced expression of genes encoding the AcrAB-TolC efflux system and low increase in ciprofloxacin MIC. No mutations were detected in other regulatory regions of this efflux system. Ciprofloxacin resistance in serovar Kentucky ST198 is thus currently mainly due to multiple target gene mutations.

  20. In vivo SPECT imaging of tumors by {sup 198,199}Au-labeled graphene oxide nanostructures

    Energy Technology Data Exchange (ETDEWEB)

    Fazaeli, Yousef [Nuclear Medicine Research Group, Agricultural, Medical and Industrial Research School, Nuclear Science and Technology Research Institute (NSTRI), P.O. Box 31485-498, Karaj (Iran, Islamic Republic of); Akhavan, Omid, E-mail: oakhavan@sharif.edu [Department of Physics, Sharif University of Technology (SUT), P.O. Box 11155-9161, Tehran (Iran, Islamic Republic of); Institute for Nanoscience and Nanotechnology, Sharif University of Technology (SUT), P.O. Box 14588-89694, Tehran (Iran, Islamic Republic of); Rahighi, Reza [Department of Physics, Sharif University of Technology (SUT), P.O. Box 11155-9161, Tehran (Iran, Islamic Republic of); Aboudzadeh, Mohammad Reza; Karimi, Elham; Afarideh, Hossein [Nuclear Medicine Research Group, Agricultural, Medical and Industrial Research School, Nuclear Science and Technology Research Institute (NSTRI), P.O. Box 31485-498, Karaj (Iran, Islamic Republic of)

    2014-12-01

    Graphene oxide (GO) sheets functionalized by aminopropylsilyl groups (8.0 wt.%) were labeled by {sup 198,199}Au nanoparticle radioisotopes (obtained through reduction of HAuCl{sub 4} in sodium citrate solution followed by thermal neutron irradiation) for fast in vivo targeting and SPECT imaging (high purity germanium-spectrometry) of tumors. Using instant thin layer chromatography method, the physicochemical properties of the amino-functionalized GO sheets labeled by {sup 198,199}Au NPs ({sup 198,199}Au@AF-GO) were found to be highly stable enough in organic phases, e.g. a human serum, to be reliably used in bioapplications. In vivo biodistribution of the {sup 198,199}Au@AF-GO composite was investigated in rats bearing fibrosarcoma tumor after various post-injection periods of time. The {sup 198,199}Au@AF-GO nanostructure exhibited a rapid as well as high tumor uptake (with uptake ratio of tumor to muscle of 167 after 4 h intravenous injection) that resulted in an efficient tumor targeting/imaging. Meantime, the low lipophilicity of the {sup 198,199}Au@AF-GO caused to its fast excretion (∼ 24 h) throughout the body by the kidneys (as also confirmed by the urinary tract). Because of the short half-life of {sup 198,199}Au radioisotopes, the {sup 198,199}Au@AF-GO with an excellent tumor targeting/imaging and fast washing out from the body can be suggested as one of the most effective and promising nanomaterials in nanotechnology-based cancer diagnosis and therapy. - Graphical abstract: Amino-functionalized graphene oxide sheets were labeled with radioactive gold nanoparticles as effective SPECT imaging and therapeutic agents. - Highlights: • GO sheets were functionalized by amino groups and labeled by Au NP radioisotopes. • Au@AF-GO nanocomposites were used for in vivo targeting and SPECT imaging of tumors. • In vivo biodistribution study showed high tumor uptake of the nanocomposites. • Low lipophilicity of the nanocomposite caused its fast excretion

  1. Molecular risk assessment of BIG 1-98 participants by expression profiling using RNA from archival tissue

    OpenAIRE

    Giobbie-Hurder Anita; Thürlimann Beat; Oberli Andrea; Baltzer Anna; Wirapati Pratyaksha; Delorenzi Mauro; Popovici Vlad; Antonov Janine; Viale Giuseppe; Altermatt Hans; Aebi Stefan; Jaggi Rolf

    2010-01-01

    Abstract Background The purpose of the work reported here is to test reliable molecular profiles using routinely processed formalin-fixed paraffin-embedded (FFPE) tissues from participants of the clinical trial BIG 1-98 with a median follow-up of 60 months. Methods RNA from fresh frozen (FF) and FFPE tumor samples of 82 patients were used for quality control, and independent FFPE tissues of 342 postmenopausal participants of BIG 1-98 with ER-positive cancer were analyzed by measuring prospect...

  2. GPX1 Pro(198)Leu polymorphism, erythrocyte GPX activity, interaction with alcohol consumption and smoking, and risk of colorectal cancer

    DEFF Research Database (Denmark)

    Hansen, Rikke Dalgaard; Krath, Britta N.; Frederiksen, Kirsten

    2009-01-01

    and information on lifestyle factors was obtained from questionnaires filled in at enrolment in 1993–1997. GPX1 Pro198Leu, hOGG1 Ser326Cys and erythrocyte GPX enzyme activity were not associated with risk of colorectal cancer. We observed a higher risk associated with alcohol consumption and smoking among......198Leu genotype, gender, smoking intensity, and intake of fruits and vegetables. Our results indicate that lifestyle-related oxidative stress may be a risk factor for colorectal cancer among subjects with a lowered defence....

  3. Treatment of Sulfonated Azo Dye Reactive Red 198 by UV/H2O2

    Directory of Open Access Journals (Sweden)

    Jefferson P. Ribeiro

    2014-01-01

    Full Text Available UV/H2O2 system was tested on the color removal of sulfonated azo dye Reactive Red 198 (RR, which is widely used in textile process. The effects of hydrogen peroxide concentration, temperature, pH, and the in-line addition of hydrogen peroxide on high color and chemical oxygen demand (COD removals were investigated. The kinetic of dye decolorization was also determined. The results showed that 2% H2O2 decreased the process efficiency, while 1% H2O2 solution led to a better performance of the system. Despite the fact that the pH increase had small effect on color removal, it affects positively COD removals. The same behavior was found for temperature increase. A high temperature resulted in a slight decrease in color removal and a sharp decrease for COD removal. In addition the H2O2 in-line provided a small improvement in both color and COD removals. UV/1% H2O2 treatment was the most efficient, the good performance was linked to higher amount of hydroxyl radicals formed.

  4. Production mechanism of new neutron-rich heavy nuclei in the 136Xe +198Pt reaction

    Science.gov (United States)

    Li, Cheng; Wen, Peiwei; Li, Jingjing; Zhang, Gen; Li, Bing; Xu, Xinxin; Liu, Zhong; Zhu, Shaofei; Zhang, Feng-Shou

    2018-01-01

    The multinucleon transfer reaction of 136Xe +198Pt at Elab = 7.98 MeV/nucleon is investigated by using the improved quantum molecular dynamics model. The quasielastic, deep-inelastic, and quasifission collision mechanisms are studied via analyzing the angular distributions of fragments and the energy dissipation processes during the collisions. The measured isotope production cross sections of projectile-like fragments are reasonably well reproduced by the calculation of the ImQMD model together with the GEMINI code. The isotope production cross sections for the target-like fragments and double differential cross sections of 199Pt, 203Pt, and 208Pt are calculated. It is shown that about 50 new neutron-rich heavy nuclei can be produced via deep-inelastic collision mechanism, where the production cross sections are from 10-3 to 10-6 mb. The corresponding emission angle and the kinetic energy for these new neutron-rich nuclei locate at 40∘-60∘ and 100-200 MeV, respectively.

  5. Cholesterol, Cholesterol-Lowering Medication Use, and Breast Cancer Outcome in the BIG 1-98 Study

    DEFF Research Database (Denmark)

    Borgquist, Signe; Giobbie-Hurder, Anita; Ahern, Thomas P

    2017-01-01

    on cholesterol levels and hypercholesterolemia per se may counteract the intended effect of aromatase inhibitors. Patients and Methods The Breast International Group (BIG) conducted a randomized, phase III, double-blind trial, BIG 1-98, which enrolled 8,010 postmenopausal women with early-stage, hormone receptor...

  6. 9 CFR 381.198 - Importer to make application for inspection of poultry products offered for entry.

    Science.gov (United States)

    2010-01-01

    ... MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION POULTRY PRODUCTS INSPECTION REGULATIONS Imported Poultry Products § 381.198 Importer to make application for inspection of... or other poultry product shall make application for inspection to the import supervisor of the import...

  7. 25 CFR 900.198 - Are Federal employees assigned to a self-determination contractor under the Intergovernmental...

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Are Federal employees assigned to a self-determination... SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES CONTRACTS UNDER THE INDIAN SELF-DETERMINATION AND....198 Are Federal employees assigned to a self-determination contractor under the Intergovernmental...

  8. 46 CFR 122.282 - Logbook for vessels of more than 19.8 meters (65 feet) in length with overnight accommodations...

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Logbook for vessels of more than 19.8 meters (65 feet... Voyage Records § 122.282 Logbook for vessels of more than 19.8 meters (65 feet) in length with overnight..., the owner, managing operator, or master of a vessel of more than 19.8 meters (65 feet) in length with...

  9. 46 CFR 177.315 - Vessels of not more than 19.8 meters (65 feet) in length carrying not more than 12 passengers.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Vessels of not more than 19.8 meters (65 feet) in length... Structure § 177.315 Vessels of not more than 19.8 meters (65 feet) in length carrying not more than 12 passengers. The scantlings for a vessel of not more than 19.8 meters (65 feet) in length carrying not more...

  10. t198gb.m77t and t198gb.h77t: MGD77T data and header files for single-beam bathymetry data for field activity T-1-98-GB in Glacier Bay, Alaska from 08/21/1998 to 09/01/1998

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of the U.S. Geological Survey cruise T-1-98-GB. The cruise was conducted in Glacier...

  11. Disruption of the Putative Vascular Leak Peptide Sequence in the Stabilized Ricin Vaccine Candidate RTA1-33/44-198

    Directory of Open Access Journals (Sweden)

    Charles B. Millard

    2013-01-01

    Full Text Available Vitetta and colleagues identified and characterized a putative vascular leak peptide (VLP consensus sequence in recombinant ricin toxin A-chain (RTA that contributed to dose-limiting human toxicity when RTA was administered intravenously in large quantities during chemotherapy. We disrupted this potentially toxic site within the more stable RTA1-33/44-198 vaccine immunogen and determined the impact of these mutations on protein stability, structure and protective immunogenicity using an experimental intranasal ricin challenge model in BALB/c mice to determine if the mutations were compatible. Single amino acid substitutions at the positions corresponding with RTA D75 (to A, or N and V76 (to I, or M had minor effects on the apparent protein melting temperature of RTA1-33/44-198 but all four variants retained greater apparent stability than the parent RTA. Moreover, each VLP(− variant tested provided protection comparable with that of RTA1-33/44-198 against supralethal intranasal ricin challenge as judged by animal survival and several biomarkers. To understand better how VLP substitutions and mutations near the VLP site impact epitope structure, we introduced a previously described thermal stabilizing disulfide bond (R48C/T77C along with the D75N or V76I substitutions in RTA1-33/44-198. The D75N mutation was compatible with the adjacent stabilizing R48C/T77C disulfide bond and the Tm was unaffected, whereas the V76I mutation was less compatible with the adjacent disulfide bond involving C77. A crystal structure of the RTA1-33/44-198 R48C/T77C/D75N variant showed that the structural integrity of the immunogen was largely conserved and that a stable immunogen could be produced from E. coli. We conclude that it is feasible to disrupt the VLP site in RTA1-33/44-198 with little or no impact on apparent protein stability or protective efficacy in mice and such variants can be stabilized further by introduction of a disulfide bond.

  12. Outcomes of special histotypes of breast cancer after adjuvant endocrine therapy with letrozole or tamoxifen in the monotherapy cohort of the BIG 1-98 trial

    DEFF Research Database (Denmark)

    Munzone, E; Giobbie-Hurder, A; Gusterson, B A

    2015-01-01

    BACKGROUND: We investigated the outcomes of postmenopausal women with hormone receptor-positive, early breast cancer with special histotypes (mucinous, tubular, or cribriform) enrolled in the monotherapy cohort of the BIG 1-98 trial. PATIENTS AND METHODS: The intention-to-treat BIG 1-98 monothera...

  13. Bone fractures among postmenopausal patients with endocrine-responsive early breast cancer treated with 5 years of letrozole or tamoxifen in the BIG 1-98 trial

    National Research Council Canada - National Science Library

    Rabaglio, M; Sun, Z; Price, K. N; Castiglione-Gertsch, M; Hawle, H; Thürlimann, B; Mouridsen, H; Campone, M; Forbes, J. F; Paridaens, R. J; Colleoni, M; Pienkowski, T; Nogaret, J.-M; Láng, I; Smith, I; Gelber, R. D; Goldhirsch, A; Coates, A. S

    2009-01-01

    ...-responsive early breast cancer in the Breast International Group (BIG) 1-98 trial. Methods: We evaluated 4895 patients allocated to 5 years of letrozole or tamoxifen in the BIG 1-98 trial who received at least some study medication...

  14. 46 CFR 116.730 - Crew accommodations on vessels of more than 19.8 meters (65 feet) in length with overnight...

    Science.gov (United States)

    2010-10-01

    ... (65 feet) in length with overnight accommodations for more than 49 passengers. 116.730 Section 116.730... ARRANGEMENT Crew Spaces § 116.730 Crew accommodations on vessels of more than 19.8 meters (65 feet) in length... more than 19.8 meters (65 feet) in length with overnight accommodations for more than 49 passengers...

  15. 46 CFR 120.434 - Lifeboat and liferaft floodlights on vessels of more than 19.8 meters (65 feet) in length with...

    Science.gov (United States)

    2010-10-01

    ... than 19.8 meters (65 feet) in length with overnight accommodations for more than 49 passengers. 120.434... (65 feet) in length with overnight accommodations for more than 49 passengers. Each vessel of more than 19.8 meters (65 feet) in length carrying more than 600 passengers or with overnight accommodations...

  16. 46 CFR 120.312 - Power sources on vessels of more than 19.8 meters (65 feet) in length carrying more than 600...

    Science.gov (United States)

    2010-10-01

    ... feet) in length carrying more than 600 passengers or with overnight accommodations for more than 49... of more than 19.8 meters (65 feet) in length carrying more than 600 passengers or with overnight accommodations for more than 49 passengers. A vessel of more than 19.8 meters (65 feet) in length carrying more...

  17. ramR mutations affecting fluoroquinolone susceptibility in epidemic multidrug-resistant Salmonella enterica serovar Kentucky ST198

    OpenAIRE

    Baucheron, Sylvie; Le Hello, Simon; Doublet, Benoît; Giraud, Etienne; Weill, François-Xavier; Cloeckaert, Axel

    2013-01-01

    International audience; A screening for non-target mutations affecting fluoroquinolone susceptibility was conducted in epidemic multidrug-resistant Salmonella enterica serovar Kentucky ST198. Among a panel of representative isolates (n = 27), covering the epidemic, only three showed distinct mutations in ramR resulting in enhanced expression of genes encoding the AcrAB-TolC efflux system and low increase in ciprofloxacin MIC. No mutations were detected in other regulatory regions of this effl...

  18. Preparation of magnetic composite based on zinc oxide nanoparticles and chitosan as a photocatalyst for removal of reactive blue 198

    Science.gov (United States)

    Nguyen, Van Cuong; Giang Nguyen, Ngoc Lam; Hue Pho, Quoc

    2015-09-01

    In this study a novel magnetic composite used as a photocatalyst with combination of zinc oxide nanoparticles and chitosan (ZnO/Fe3O4/CS) was synthesized by a simple co-precipitation method. The role of the prepared magnetic nanocomposite is to improve the removal efficiency of textile dye due to the photocatalytic activity of zinc oxide nanoparticles and reusable capacity of Fe3O4 magnetic nanoparticles. Constituents and structure properties of ZnO/Fe3O4/CS were investigated by scanning electron microscopy (SEM), x-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR) and thermogravimetric analysis (TGA). Magnetic property of the prepared composite was determined by vibrating sample magnetometer (VSM). The results demonstrated that ZnO/Fe3O4/CS nanocomposite dramatically improved the removal efficiency of reactive blue 198 dye (RB198) with high photocatalytic activity and easy separation by a permanent magnet. In addition, the photocatalytic activity of the prepared composite was also performed under different parameters such as contact time, initial pH, the amount of composite and initial concentration of RB198. Interestingly, ZnO/Fe3O4/CS nanocomposite still showed high removal efficiency after recycling three times and performed in a real textile dyeing wastewater.

  19. Complementary effect of Phloxine B on the insecticidal efficacy of Isaria fumosorosea SFP-198 wettable powder against greenhouse whitefly, Trialeurodes vaporariorum West.

    Science.gov (United States)

    Kim, Jae Su; Je, Yeon Ho; Choi, Jae Young

    2010-12-01

    Insecticidal activities of five photoactive dyes against greenhouse whitefly (GWF), Trialeurodes vaporariorum West., in tomatoes were investigated to improve the control efficacy of an entomopathogenic fungal product, Isaria fumosorosea SFP-198 wettable powder (WP). Azorubine, Eosin B, Erythrosine, Brilliant Green and Phloxine B were used in this work, accompanying pyriproxyfen emulsifiable concentrate (EC) as a commercial standard for comparison. Phloxine B had the highest control efficacy in glasshouse conditions. The most suitable dose of Phloxine B was determined as 0.005 g L(-1) , given the dosage-dependent control efficacy and phytotoxicity of the dye, and its influence on the germination of SFP-198 conidia. In field conditions, SFP-198 WP + Phloxine B (2 + 0.005 g L(-1) ; tank mix) showed 89.1 and 95.3% control efficacy 7 and 14 days post-application, which was significantly higher than the efficacy of SFP-198 WP alone (43.5 and 64.0%), Phloxine B (47.5 and 30.7%) or pyriproxyfen EC (67.7 and 80.2%). Phloxine B cooperates with SFP-198 WP complementarily, possibly in the order of killing action (early: Phloxine B; late: SFP-198 WP). The dye can be incorporated into SFP-198 WP to improve its efficacy and applied to other Hypocrelean entomopathogenic fungal products. Copyright © 2010 Society of Chemical Industry.

  20. Physiological and clinical implications of proANP(1-98) circulating levels in the perioperative phase of liver transplantation.

    Science.gov (United States)

    Cillo, U; Bassanello, M; Lancerin, F; Senzolo, M; Burra, P; Brolese, A; Zanus, G; Gatti, R; Cappellin, E; Russo, F; Favia, G; D'Amico, D; De Palo, E F

    2001-08-01

    ProANP(1-126), the prohormone synthesized and secreted by atrial myocites, generates an ANP peptide family, the main forms of which are proANP(1-30), proANP(31-67), proANP(1-98) and proANP(99-126). These molecular circulating forms are involved in hemodynamic and electrolyte homeostasis. In cirrhotic patients, volume homeostasis is almost impaired due to abnormal sodium retention, which results in ascites formation and hemodynamic changes, including high cardiac output and low systemic vascular resistance. During liver transplantation, in the anhepatic phase, hemodynamic instability may occur because of decreased venous return due to surgical manipulation of inferior vena cava, considerable blood loss or cross-clamping. Moreover, marked hemodynamic instability is often observed at the reperfusion of the graft. The aims of present study are to investigate the changes of ANP during the perioperative phases of Orthotopic Liver Transplantation (OLTx) in end-stage cirrhotic patients. From July to September 1999, 11 cirrhotic patients undergoing to OLTx were included in the study: seven males and four females (average age 46+/-10.4 years) affected by post-alcoholic cirrhosis [Hypertension 15 (1990) 9], post-hepatitis cirrhosis [D.G. Gardner, M.C. Lapointe, B. Kovacic-Milivojevic, C.F. Deschepper, Molecular analisys and regulation of the atrial natriuretic factor gene, in: A.D. Struphers (Ed.), Frontiers in Farmacology and Therapeutics: Atrial Natriuretic Factor, Blackwell, Oxford, England, 1991, pp. 1-22], Wilson disease [Life Sci. 28 (1981) 89] and polycystic disease [Life Sci. 28 (1981) 89], autoimmune cirrhosis [Life Sci. 28 (1981) 89]. In each patient, a hemodynamic assessment was achieved using a Swan-Ganz catheter. Periferical venous samples were performed during and immediately after OLTx for the determination of ANP(1-98) and other biohumoral parameters. Mean ANP(1-98) (pmol/ml mean+/-SD) basal levels resulted higher than that recorded in the group of healthy

  1. Proteins ZNF198 and SUZ12 are down-regulated in hepatitis B virus (HBV) X protein-mediated hepatocyte transformation and in HBV replication.

    Science.gov (United States)

    Wang, Wen-Horng; Studach, Leo L; Andrisani, Ourania M

    2011-04-01

    Chronic hepatitis B virus (HBV) infection is a major etiologic factor in hepatocellular carcinoma (HCC) pathogenesis, involving effects of chronic liver inflammation and of the weakly oncogenic HBV X protein (pX). pX-mediated hepatocyte transformation requires Polo-like kinase1 (Plk1) activity, but the mechanism is not fully understood. We identified by a genome-wide short hairpin RNA (shRNA) library screen the genes zinc finger, MYM-type 2 (ZNF198) and suppressor of zeste 12 homolog (Drosophila) (SUZ12) whose protein depletion rescues pX-expressing cells from DNA damage-induced apoptosis. ZNF198 and SUZ12 are components of chromatin remodeling complexes and associate with promyelocytic leukemia (PML) nuclear bodies. Knockdown of ZNF198 and SUZ12 by small interfering RNA (siRNA) reduced p53 stability and DNA repair, rescued pX-expressing hepatocytes from DNA damage-induced apoptosis, and increased pX-induced polyploidy and oncogenic transformation, suggesting ZNF198 and SUZ12 have a role in pX-mediated transformation. Interestingly, during pX-mediated transformation the protein but not messenger RNA (mRNA) levels of ZNF198 and SUZ12 progressively decreased, whereas Plk1 levels increased. Inhibition of Plk1 activity restored protein levels of ZNF198 and SUZ12. In addition, transfected Polo-box-domain (PBD) of Plk1 coimmunoprecipitated with ZNF198 and SUZ12, suggesting that these proteins are Plk1 substrates. Elevated Plk1 and reduced protein levels of ZNF198 and SUZ12 were also observed in human liver cancer cell lines derived from HBV-related tumors and in the presence of HBV replication. Importantly, knockdown by siRNA of ZNF198 and SUZ12 enhanced HBV replication. Reduced protein levels of ZNF198 and SUZ12 and elevated Plk1 occur during pX-mediated hepatocyte transformation in human liver cancer cell lines, as well as during HBV replication, underscoring the significance of these genes both in HBV-mediated HCC pathogenesis and HBV replication. We propose Plk1

  2. PLK1 and HOTAIR Accelerate Proteasomal Degradation of SUZ12 and ZNF198 during Hepatitis B Virus-Induced Liver Carcinogenesis.

    Science.gov (United States)

    Zhang, Hao; Diab, Ahmed; Fan, Huitao; Mani, Saravana Kumar Kailasam; Hullinger, Ronald; Merle, Philippe; Andrisani, Ourania

    2015-06-01

    Elucidating mechanisms of hepatitis B virus (HBV)-mediated hepatocarcinogenesis is needed to gain insights into the etiology and treatment of liver cancer. Cells where HBV is replicating exhibit increased expression of Plk1 kinase and reduced levels of two transcription repression factors, SUZ12 and ZNF198. SUZ12 is an essential subunit of the transcription repressive complex PRC2. ZNF198 stabilizes the transcription repressive complex composed of LSD1, Co-REST, and HDAC1. These two transcription repressive complexes are held together by binding the long noncoding RNA HOTAIR. In this study, we linked these regulatory events mechanistically by showing that Plk1 induces proteasomal degradation of SUZ12 and ZNF198 by site-specific phosphorylation. Plk1-dependent ubiquitination of SUZ12 and ZNF198 was enhanced by expression of HOTAIR, significantly reducing SUZ12 and ZNF198 stability. In cells expressing the HBV X protein (HBx), downregulation of SUZ12 and ZNF198 mediated global changes in histone modifications. In turn, HBx-expressing cells propagated an altered chromatin landscape after cell division, as exemplified by changes in histone modifications of the EpCAM promoter, a target of PRC2 and LSD1/Co-REST/HDAC1 complexes. Notably, liver tumors from X/c-myc bitransgenic mice exhibited downregulation of SUZ12 and ZNF198 along with elevated expression of Plk1, HOTAIR, and EpCAM. Clinically, similar effects were documented in a set of HBV-related liver tumors consistent with the likelihood that downregulation of SUZ12 and ZNF198 leads to epigenetic reprogramming of infected hepatocytes. Because both Plk1 and HOTAIR are elevated in many human cancers, we propose that their combined effects are involved in epigenetic reprogramming associated broadly with oncogenic transformation. ©2015 American Association for Cancer Research.

  3. Characterization of the SUMO-binding activity of the myeloproliferative and mental retardation (MYM-type zinc fingers in ZNF261 and ZNF198.

    Directory of Open Access Journals (Sweden)

    Catherine M Guzzo

    Full Text Available SUMO-binding proteins interact with SUMO modified proteins to mediate a wide range of functional consequences. Here, we report the identification of a new SUMO-binding protein, ZNF261. Four human proteins including ZNF261, ZNF198, ZNF262, and ZNF258 contain a stretch of tandem zinc fingers called myeloproliferative and mental retardation (MYM-type zinc fingers. We demonstrated that MYM-type zinc fingers from ZNF261 and ZNF198 are necessary and sufficient for SUMO-binding and that individual MYM-type zinc fingers function as SUMO-interacting motifs (SIMs. Our binding studies revealed that the MYM-type zinc fingers from ZNF261 and ZNF198 interact with the same surface on SUMO-2 recognized by the archetypal consensus SIM. We also present evidence that MYM-type zinc fingers in ZNF261 contain zinc, but that zinc is not required for SUMO-binding. Immunofluorescence microscopy studies using truncated fragments of ZNF198 revealed that MYM-type zinc fingers of ZNF198 are necessary for localization to PML-nuclear bodies (PML-NBs. In summary, our studies have identified and characterized the SUMO-binding activity of the MYM-type zinc fingers in ZNF261 and ZNF198.

  4. Gold-198 and rose bengal marked with iodine-131 in the diagnostic of hepatic vesicular affections; L'or{sup 198} et le rose bengale marque a l'iode{sup 131} dans le diagnostic des affections hepatovesiculaires

    Energy Technology Data Exchange (ETDEWEB)

    Manambelona Razafimalaza, J. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1961-06-15

    Colloidal gold-198 makes it possible to obtain clear images of hepatic parenchyma; the examination can be repeated from different angles thus demonstrating the presence of pathologically inert regions, whether they be hydatic cysts, abscesses or neoplasia. The study of the disappearance curve for the colloid, together with a measurement of the blood volume, makes it possible also to calculate the hepatic flow. Using Rose Bengal marked with iodine-131, it is possible to obtain images of the liver and of the bile ducts, and to follow the elimination of the dye in the intestines. The simultaneous recording of the disappearance curves for the blood and of the appearance of the dye in the intestines constitutes an useful working test which is particularly sensible for evaluating the permeability of the bile ducts and, to a certain degree, the site of an obstruction. (author) [French] L'or colloidal-198 permet d'obtenir avec nettete des images du parenchyme hepatique; l'examen peut etre repete sous plusieurs incidences mettant ainsi en evidence les zones muettes pathologiques, qu'il s'agisse de kystes hydatiques, d'abces ou de neoplasies. L'etude de la courbe d'epuration du colloide completee par une mesure du volume sanguin offre en outre la possibilite de calculer le debit hepatique. A l'aide du rose bengale marque a l'iode-131, il est possible d'obtenir des images du foie et de la vesicule biliaire, et de suivre l'elimination intestinale du colorant. L'enregistrement simultane des courbes d'epuration sanguine et d'apparition intestinale constitue une epreuve fonctionnelle particulierement sensible pour apprecier la permeabilite des voies biliaires et dans une certaine mesure le site d'une obstruction. (auteur)

  5. Molecular risk assessment of BIG 1-98 participants by expression profiling using RNA from archival tissue

    Directory of Open Access Journals (Sweden)

    Giobbie-Hurder Anita

    2010-02-01

    Full Text Available Abstract Background The purpose of the work reported here is to test reliable molecular profiles using routinely processed formalin-fixed paraffin-embedded (FFPE tissues from participants of the clinical trial BIG 1-98 with a median follow-up of 60 months. Methods RNA from fresh frozen (FF and FFPE tumor samples of 82 patients were used for quality control, and independent FFPE tissues of 342 postmenopausal participants of BIG 1-98 with ER-positive cancer were analyzed by measuring prospectively selected genes and computing scores representing the functions of the estrogen receptor (eight genes, ER_8, the progesterone receptor (five genes, PGR_5, Her2 (two genes, HER2_2, and proliferation (ten genes, PRO_10 by quantitative reverse transcription PCR (qRT-PCR on TaqMan Low Density Arrays. Molecular scores were computed for each category and ER_8, PGR_5, HER2_2, and PRO_10 scores were combined into a RISK_25 score. Results Pearson correlation coefficients between FF- and FFPE-derived scores were at least 0.94 and high concordance was observed between molecular scores and immunohistochemical data. The HER2_2, PGR_5, PRO_10 and RISK_25 scores were significant predictors of disease free-survival (DFS in univariate Cox proportional hazard regression. PRO_10 and RISK_25 scores predicted DFS in patients with histological grade II breast cancer and in lymph node positive disease. The PRO_10 and PGR_5 scores were independent predictors of DFS in multivariate Cox regression models incorporating clinical risk indicators; PRO_10 outperformed Ki-67 labeling index in multivariate Cox proportional hazard analyses. Conclusions Scores representing the endocrine responsiveness and proliferation status of breast cancers were developed from gene expression analyses based on RNA derived from FFPE tissues. The validation of the molecular scores with tumor samples of participants of the BIG 1-98 trial demonstrates that such scores can serve as independent prognostic

  6. Molecular risk assessment of BIG 1-98 participants by expression profiling using RNA from archival tissue.

    Science.gov (United States)

    Antonov, Janine; Popovici, Vlad; Delorenzi, Mauro; Wirapati, Pratyaksha; Baltzer, Anna; Oberli, Andrea; Thürlimann, Beat; Giobbie-Hurder, Anita; Viale, Giuseppe; Altermatt, Hans Jörg; Aebi, Stefan; Jaggi, Rolf

    2010-02-09

    The purpose of the work reported here is to test reliable molecular profiles using routinely processed formalin-fixed paraffin-embedded (FFPE) tissues from participants of the clinical trial BIG 1-98 with a median follow-up of 60 months. RNA from fresh frozen (FF) and FFPE tumor samples of 82 patients were used for quality control, and independent FFPE tissues of 342 postmenopausal participants of BIG 1-98 with ER-positive cancer were analyzed by measuring prospectively selected genes and computing scores representing the functions of the estrogen receptor (eight genes, ER_8), the progesterone receptor (five genes, PGR_5), Her2 (two genes, HER2_2), and proliferation (ten genes, PRO_10) by quantitative reverse transcription PCR (qRT-PCR) on TaqMan Low Density Arrays. Molecular scores were computed for each category and ER_8, PGR_5, HER2_2, and PRO_10 scores were combined into a RISK_25 score. Pearson correlation coefficients between FF- and FFPE-derived scores were at least 0.94 and high concordance was observed between molecular scores and immunohistochemical data. The HER2_2, PGR_5, PRO_10 and RISK_25 scores were significant predictors of disease free-survival (DFS) in univariate Cox proportional hazard regression. PRO_10 and RISK_25 scores predicted DFS in patients with histological grade II breast cancer and in lymph node positive disease. The PRO_10 and PGR_5 scores were independent predictors of DFS in multivariate Cox regression models incorporating clinical risk indicators; PRO_10 outperformed Ki-67 labeling index in multivariate Cox proportional hazard analyses. Scores representing the endocrine responsiveness and proliferation status of breast cancers were developed from gene expression analyses based on RNA derived from FFPE tissues. The validation of the molecular scores with tumor samples of participants of the BIG 1-98 trial demonstrates that such scores can serve as independent prognostic factors to estimate disease free survival (DFS) in

  7. Letrozole compared with tamoxifen for elderly patients with endocrine-responsive early breast cancer: the BIG 1-98 trial.

    Science.gov (United States)

    Crivellari, Diana; Sun, Zhuoxin; Coates, Alan S; Price, Karen N; Thürlimann, Beat; Mouridsen, Henning; Mauriac, Louis; Forbes, John F; Paridaens, Robert J; Castiglione-Gertsch, Monica; Gelber, Richard D; Colleoni, Marco; Láng, István; Del Mastro, Lucia; Gladieff, Laurence; Rabaglio, Manuela; Smith, Ian E; Chirgwin, Jacquie H; Goldhirsch, Aron

    2008-04-20

    To explore potential differences in efficacy, treatment completion, and adverse events (AEs) in elderly women receiving adjuvant tamoxifen or letrozole for five years in the Breast International Group (BIG) 1-98 trial. This report includes the 4,922 patients allocated to 5 years of letrozole or tamoxifen in the BIG 1-98 trial. The median follow-up was 40.4 months. Subpopulation Treatment Effect Pattern Plot (STEPP) analysis was used to examine the patterns of differences in disease-free survival and incidences of AEs according to age. In addition, three categoric age groups were defined: "younger postmenopausal" patients were younger than 65 years (n = 3,127), "older" patients were 65 to 74 years old (n = 1,500), and "elderly" patients were 75 years of age or older (n = 295). Efficacy results for subpopulations defined by age were similar to the overall trial results: Letrozole significantly improved disease-free survival (DFS), the primary end point, compared with tamoxifen. Elderly patients were less likely to complete trial treatment, but at rates that were similar in the two treatment groups. The incidence of bone fractures, observed more often in the letrozole group, did not differ by age. In elderly patients, letrozole had a significantly higher incidence of any grade 3 to 5 protocol-specified non-fracture AE compared with tamoxifen (P = .002), but differences were not significant for thromboembolic or cardiac AEs. Adjuvant treatment with letrozole had superior efficacy (DFS) compared with tamoxifen in all age groups. On the basis of a small number of patients older than 75 years (6%), age per se should not unduly affect the choice of adjuvant endocrine therapy.

  8. SCM-198 inhibits microglial overactivation and attenuates Aβ(1-40)-induced cognitive impairments in rats via JNK and NF-кB pathways.

    Science.gov (United States)

    Hong, Zhen-Yi; Shi, Xue-Ru; Zhu, Kai; Wu, Ting-Ting; Zhu, Yi-Zhun

    2014-08-19

    Neuroinflammation mediated by overactivated microglia plays a key role in many neurodegenerative diseases, including Alzheimer's disease (AD). In this study, we investigated for the first time the anti-neuroinflammatory effects and possible mechanisms of SCM-198 (an alkaloid extracted from Herbaleonuri), which was previously found highly cardioprotective, both in vitro and in vivo. For in vitro experiments, lipopolysaccharide (LPS) or β-amyloid(1-40) (Aβ(1-40)) was applied to induce microglial overactivation. Proinflammatory mediators were measured and activations of NF-κB and mitogen-activated protein kinases' (MAPKs) pathways were investigated. Further protective effect of SCM-198 was evaluated in microglia-neuron co-culture assay and Sprague-Dawley (SD) rats intrahippocampally-injected with Aβ(1-40). SCM-198 reduced expressions of nitric oxide (NO), TNF-α, IL-1β and IL-6 possibly via, at least partially, inhibiting c-Jun N-terminal kinase (JNK) and NF-κB signaling pathways in microglia. Co-culture assay showed that activated microglia pretreated with SCM-198 led to less neuron loss and decreased phosphorylation of tau and extracellular signal-regulated kinase (ERK) in neurons. Besides, SCM-198 also directly protected against Aβ(1-40)-induced neuronal death and lactate dehydrogenase (LDH) release in primary cortical neurons. For in vivo studies, SCM-198 significantly enhanced cognitive performances of rats 12 days after intrahippocampal injections of aged Aβ(1-40) peptides in the Morris water maze (MWM), accompanied by less hippocampal microglial activation, decreased synaptophysin loss and phosphorylation of ERK and tau. Co-administration of donepezil and SCM-198 resulted in a slight cognitive improvement in SD rats 50 days after intrahippocampal injections of aged Aβ(1-40) peptides as compared to only donepezil or SCM-198 treated group. Our findings are the first to report that SCM-198 has considerable anti-neuroinflammatory effects on inhibiting

  9. Dental size reduction in Indonesian Homo erectus: Implications for the PU-198 premolar and the appearance of Homo sapiens on Java.

    Science.gov (United States)

    Polanski, Joshua M; Marsh, Hannah E; Maddux, Scott D

    2016-01-01

    The recent recovery of a hominin maxillary third premolar, PU-198, within the faunal collections from Punung Cave (East Java) has led to assertions that Homo sapiens appeared on Java between 143,000 and 115,000 years ago. The taxonomic assignment of PU-198 to H. sapiens was based predominantly on the small size of the specimen, following an analysis which found little to no overlap in premolar size between Homo erectus and terminal Pleistocene/Holocene H. sapiens. Here, we re-evaluate the use of size in the taxonomic assignment of PU-198 in light of 1) new buccolingual and mesiodistal measurements taken on the fossil, 2) comparisons to a larger sample of H. erectus and H. sapiens maxillary third premolars, and 3) evidence of a diachronic trend in post-canine dental size reduction among Javan H. erectus. Our results demonstrate PU-198 to be slightly larger than previously suggested, reveal substantial overlap in premolar size between H. erectus and H. sapiens, and indicate a statistically significant reduction in premolar size between early and late Javan H. erectus. Our findings cast doubt on the assignment of PU-198 to H. sapiens, and accordingly, question the appearance of H. sapiens on Java between 143,000 and 115,000 years ago. Copyright © 2015 Elsevier Ltd. All rights reserved.

  10. Mangiferin functionalized radioactive gold nanoparticles (MGF-198AuNPs) in prostate tumor therapy: green nanotechnology for production, in vivo tumor retention and evaluation of therapeutic efficacy.

    Science.gov (United States)

    Al-Yasiri, A Y; Khoobchandani, M; Cutler, C S; Watkinson, L; Carmack, T; Smith, C J; Kuchuk, M; Loyalka, S K; Lugão, A B; Katti, K V

    2017-10-31

    We report here an innovative feature of green nanotechnology-focused work showing that mangiferin-a glucose functionalized xanthonoid, found in abundance in mango peels-serves dual roles of chemical reduction and in situ encapsulation, to produce gold nanoparticles with optimum in vivo stability and tumor specific characteristics. The interaction of mangiferin with a Au-198 gold precursor affords MGF-198AuNPs as the beta emissions of Au-198 provide unique advantages for tumor therapy while gamma rays are used for the quantitative estimation of gold within the tumors and various organs. The laminin receptor specificity of mangiferin affords specific accumulation of therapeutic payloads of this new therapeutic agent within prostate tumors (PC-3) of human prostate tumor origin induced in mice which overexpress this receptor subtype. Detailed in vivo therapeutic efficacy studies, through the intratumoral delivery of MGF-198AuNPs, show the retention of over 80% of the injected dose (ID) in prostate tumors up to 24 h. By three weeks post treatment, tumor volumes of the treated group of animals showed an over 5 fold reduction as compared to the control saline group. New opportunities for green nanotechnology and a new paradigm of using mangiferin as a tumor targeting agent in oncology for the application of MGF-198AuNPs in the treatment of cancer are discussed.

  11. SCM-198 Ameliorates Cognitive Deficits, Promotes Neuronal Survival and Enhances CREB/BDNF/TrkB Signaling without Affecting Aβ Burden in AβPP/PS1 Mice.

    Science.gov (United States)

    Hong, Zhen-Yi; Yu, Shuang-Shuang; Wang, Zhi-Jun; Zhu, Yi-Zhun

    2015-08-07

    SCM-198 is an alkaloid found only in Herba leonuri and it has been reported to possess considerable neuroprotective effects in animal models of ischemic stroke, Parkinson's disease and Alzheimer's disease (AD). In this study, we demonstrated for the first time that 3-month oral SCM-198 treatment could significantly improve both recognition and spatial memory, inhibit microgliosis and promote neuronal survival in amyloid-β protein precursor and presenilin-1(AβPP/PS1) double-transgenic mice without affecting amyloid-β (Aβ) burden. In addition, decreases in cAMP-response element-binding protein (CREB) phosphorylation, brain-derived neurotrophic factor (BDNF) and tropomyosin-related kinase B (TrkB) phosphorylation were attenuated by SCM-198 both in vivo and in primary cortical neurons, which could be blocked by protein kinase A (PKA) inhibitors, suggesting the involvement of upstream PKA in enhancing the BDNF/TrkB/CREB signaling by SCM-198. Our results indicate that SCM-198, a drug that could promote neuronal survival and enhance BDNF/TrkB/CREB signaling, has beneficial effects on behavioral and biochemical alterations without affecting Aβ burden in AβPP/PS1 mice and might become a potential drug candidate for AD treatment in the future.

  12. SCM-198 Ameliorates Cognitive Deficits, Promotes Neuronal Survival and Enhances CREB/BDNF/TrkB Signaling without Affecting Aβ Burden in AβPP/PS1 Mice

    Directory of Open Access Journals (Sweden)

    Zhen-Yi Hong

    2015-08-01

    Full Text Available SCM-198 is an alkaloid found only in Herba leonuri and it has been reported to possess considerable neuroprotective effects in animal models of ischemic stroke, Parkinson’s disease and Alzheimer’s disease (AD. In this study, we demonstrated for the first time that 3-month oral SCM-198 treatment could significantly improve both recognition and spatial memory, inhibit microgliosis and promote neuronal survival in amyloid-β protein precursor and presenilin-1(AβPP/PS1 double-transgenic mice without affecting amyloid-β (Aβ burden. In addition, decreases in cAMP-response element-binding protein (CREB phosphorylation, brain-derived neurotrophic factor (BDNF and tropomyosin-related kinase B (TrkB phosphorylation were attenuated by SCM-198 both in vivo and in primary cortical neurons, which could be blocked by protein kinase A (PKA inhibitors, suggesting the involvement of upstream PKA in enhancing the BDNF/TrkB/CREB signaling by SCM-198. Our results indicate that SCM-198, a drug that could promote neuronal survival and enhance BDNF/TrkB/CREB signaling, has beneficial effects on behavioral and biochemical alterations without affecting Aβ burden in AβPP/PS1 mice and might become a potential drug candidate for AD treatment in the future.

  13. Obesity and risk of recurrence or death after adjuvant endocrine therapy with letrozole or tamoxifen in the breast international group 1-98 trial

    DEFF Research Database (Denmark)

    Ewertz, Marianne; Gray, Kathryn P; Regan, Meredith M

    2012-01-01

    To examine the association of baseline body mass index (BMI) with the risk of recurrence or death in postmenopausal women with early-stage breast cancer receiving adjuvant tamoxifen or letrozole in the Breast International Group (BIG) 1-98 trial at 8.7 years of median follow-up.......To examine the association of baseline body mass index (BMI) with the risk of recurrence or death in postmenopausal women with early-stage breast cancer receiving adjuvant tamoxifen or letrozole in the Breast International Group (BIG) 1-98 trial at 8.7 years of median follow-up....

  14. Novel anti-diabetic effect of SCM-198 via inhibiting the hepatic NF-κB pathway in db/db mice.

    Science.gov (United States)

    Huang, Hui; Xin, Hong; Liu, Xinhua; Xu, Yajun; Wen, Danyi; Zhang, Yahua; Zhu, Yi Zhun

    2012-04-01

    There are reports of early evidence that suggest the involvement of chronic low-grade inflammation in the pathogenesis of Type 2 diabetes. Thus, substances that have effects in reducing inflammation could be potential drugs for Type 2 diabetes. Leonurine (4-guanidino-n-butyl syringate; SCM-198) is an alkaloid in HL (Herba leonuri), which was reported to possess anti-inflammatory properties. We hypothesize that SCM-198 may have beneficial effects on Type 2 diabetes. In the present study, we attempted to test this hypothesis by evaluating the anti-diabetic effect of SCM-198 and the possible underlying mechanisms of its effects in db/db mice. SCM-198 (50, 100 and 200 mg/kg of body weight), pioglitazone (50 mg/kg of body weight, as a positive control) or 1% CMC-Na (sodium carboxymethylcellulose) were administered to the db/db or db/m mice once daily for 3 weeks. After 3 weeks, SCM-198 (200 mg/kg of body weight) treatment significantly reduced the fasting blood glucose level and increased the plasma insulin concentration in the db/db mice, meanwhile it significantly lowered the plasma TAG (triacylglycerol) concentration and increased the HDL (high-density lipoprotein)-cholesterol concentration. Moreover, the dysregulated transcription of the hepatic glucose metabolic enzymes, including GK (glucokinase), G6Pase (glucose-6-phosphatase) and PEPCK (phosphoenolpyruvate carboxykinase), was recovered by an Akt-dependent pathway. The pro-inflammatory mediators {such as TNFα (tumour necrosis factor α), IL (interleukin)-6, IL-1β, degradation of IκB [inhibitor of NF-κB (nuclear factor-κB)] α and thereafter activation of NF-κB} were reversed by SCM-198 treatment in the db/db mice. The present study provides first evidence that SCM-198 exhibits anti-inflammatory activity and has an ameliorating effect on diabetic symptoms via inhibiting of NF-κB/IKK (IκB kinase) pathway. Consequently, we suggest that SCM-198 may be a prospective agent for prevention and

  15. ORIGINAL ARTICLE 198

    African Journals Online (AJOL)

    boaz

    Pollution of river waters with pathogenic microorganisms has been on steady increase in the recent past. The major source of microbes in water is faeces from human and other mammals (18). Entry of pathogens into rivers can occur either from a point source, non- point sources or both. Non- point source microbial pollution ...

  16. Evaluation of Maize Tassel Powder Efficiency in Removal of Reactive Red 198 Dye from Synthetic Textile Wastewater

    Directory of Open Access Journals (Sweden)

    Mahboobeh Dehvari

    2013-01-01

    Full Text Available Introduction: Colored compounds which often are toxic and carcinogen is one of the environmental pollutants. These pollutants should be removed prior than discharge to the environment. The aim of this study was the evaluation of maize tassel powder efficiency for the removal of Reactive Red 198 dye from synthetic textile wastewater. Materials & Methods: This experimental study was performed in laboratory scale by using of batch reactors. In this study, the effect of adsorbent dose, contact time, initial dye concentration and pH had been evaluated. Maximum adsorption wavelength (λmax and the concentration of dye were determined by UV/Vis spectrophotometer. The adsorbent was prepared in laboratory condition and pulverized by standard ASTM sieves with the range of 40-60 mesh. The data were analyzed with Langmuir and Freundlich isotherm models. Results: The result showed that increasing of adsorbent dose led to increasing of the adsorption efficiency but adsorption efficiency was decreased with an elevation of pH from 3 to 9 and increasing of dye concentration from 25 to 50 mg/l. With increasing reaction time, adsorption efficiency increased and the most adsorption occurred in first 30 min of reaction. Obtained data were in good concordance with both Langmuir and Freundlich isotherm models. The adsorption kinetics followed the pseudo-second-order equation. Conclusion: Maize tassel powder is a natural and cheap adsorbent that can be used for the removal of contaminants in the environment.

  17. Prevalência de manifestações oculares em 198 pacientes com artrite reumatóide: um estudo retrospectivo Prevalence of ocular manifestation in 198 patients with rheumatoid arthritis: a restrospective study

    Directory of Open Access Journals (Sweden)

    Raphael Guimarães Bettero

    2008-06-01

    Full Text Available OBJETIVO: Estimar a prevalência de manifestações oculares na população local de artrite reumatóide (AR. Estimar se a presença de auto-anticorpos como fator reumatóide (FR e fator antinuclear (FAN influi no aparecimento destas manifestações e se existe associação entre o aparecimento de manifestações oculares e índice funcional do paciente, idade ao diagnóstico e tempo de doença. MÉTODOS: Foram estudados retrospectivamente 198 prontuários de pacientes com AR, acompanhados durante o período de 2003 a 2006. Avaliou-se a prevalência das manifestações oftalmológicas, perfil de auto-anticorpos, dados demográficos e índice funcional de Steinbrock destes pacientes. RESULTADOS: Síndrome de Sjögren secundária apareceu em 12,1% dos pacientes sendo mais comum em mulheres (p=0,049 e em pacientes com maior dano articular (p=0,016. Ceratite ulcerativa e esclerite incidiram em torno de 2% dos pacientes. Fator reumatóide (FR e fator antinuclear (FAN assim como tempo de doença e idade do paciente ao diagnóstico não influíram no aparecimento das manifestações estudadas. CONCLUSÃO: A síndrome de Sjögren secundária é a manifestação ocular mais prevalente em pacientes com AR, sendo mais comum em mulheres e em pacientes com mais disfunção articular.PURPOSE: To study the prevalence of eye manifestations in the local rheumatoid arthritis (RA population, as well as to know if the presence of rheumatoid factor (RF and antinuclear antibodies (ANA affect this profile. To study if there is association between eye manifestations and patient's articular functional index, age at diagnosis and illness duration. METHODS: We reviewed 198 charts of rheumatoid arthritis patients followed-up from 2003 to 2006. They were studied for: prevalence of ophthalmologic manifestations, autoantibody profile, demographic data and Steinbrock's functional index. RESULTS: Secondary Sjögren's syndrome was seen in 12.1% of the patients being more common

  18. Determination of the solid consumption in the transport of sands in sea beds with gold 198; Determinacion del gasto solido en el transporte de arenas en lechos marinos con oro 198

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez A, G

    1983-07-01

    The study of the movement of sediments in sea beds, is necessary when one plans to build a port. Among the techniques used for this studies, it is the radiotracer balance that gives an useful estimation of the quantity of sediment that it moves per day and by meter (perpendicular to the displacement). The main objectives of this work are: to) to present the characteristics of the obtaining of the used radiotracer, describing details those used safety measures, b) to describe the handling of the radiotracer and it radiological safety, during the transport and injection in the sea bottom, c) description of the detection way and the used equipment, d) to describe the information processing obtained in the field and finally, e) the estimate of the solid consumption and the determination of the direction and speed of displacement of those sediments in the sea bottom, in front of the Tabasco coast, to be used jointly with the information obtained by means of other techniques so that one can make a good planning of the operations of dredging during the construction and later on the maintenance of the Dos Bocas marine terminal. The first step is to obtain the radiotracer that in this case was sand of uniform grain metric, marked superficially with Gold-198. The second step is to transport the sand to the place of interest, to place it in the injection equipment and to deposit it in the sea bottom. The third step is to detect the radiotracer in the sea bed, from a craft that drags a sled, which takes mounted a scintillation detector of sodium iodide activated with thallium NaI(Tl) (probe). The fourth step is to process the field information and to obtain the corresponding results. (Author)

  19. Adaptive Neuro-Fuzzy Inference system analysis on adsorption studies of Reactive Red 198 from aqueous solution by SBA-15/CTAB composite

    Science.gov (United States)

    Aghajani, Khadijeh; Tayebi, Habib-Allah

    2017-01-01

    In this study, the Mesoporous material SBA-15 were synthesized and then, the surface was modified by the surfactant Cetyltrimethylammoniumbromide (CTAB). Finally, the obtained adsorbent was used in order to remove Reactive Red 198 (RR 198) from aqueous solution. Transmission electron microscope (TEM), Fourier transform infra-red spectroscopy (FTIR), Thermogravimetric analysis (TGA), X-ray diffraction (XRD), and BET were utilized for the purpose of examining the structural characteristics of obtained adsorbent. Parameters affecting the removal of RR 198 such as pH, the amount of adsorbent, and contact time were investigated at various temperatures and were also optimized. The obtained optimized condition is as follows: pH = 2, time = 60 min and adsorbent dose = 1 g/l. Moreover, a predictive model based on ANFIS for predicting the adsorption amount according to the input variables is presented. The presented model can be used for predicting the adsorption rate based on the input variables include temperature, pH, time, dosage, concentration. The error between actual and approximated output confirm the high accuracy of the proposed model in the prediction process. This fact results in cost reduction because prediction can be done without resorting to costly experimental efforts. SBA-15, CTAB, Reactive Red 198, adsorption study, Adaptive Neuro-Fuzzy Inference systems (ANFIS).

  20. Associations between GPX1 Pro198Leu polymorphism, erythrocyte GPX activity, alcohol consumption and breast cancer risk in a prospective cohort study

    DEFF Research Database (Denmark)

    Ravn-Haren, Gitte; Olsen, A.; Tjonneland, A.

    2006-01-01

    Breast cancer may be related to oxidative stress. Breast cancer patients have been reported to have lower antioxidant enzyme activity than healthy controls and the polymorphism GPX1 Pro198Leu has been associated with risk of lung and breast cancer. The purpose of the present nested case-control s...

  1. Relative Effectiveness of Letrozole Compared With Tamoxifen for Patients With Lobular Carcinoma in the BIG 1-98 Trial

    Science.gov (United States)

    Metzger Filho, Otto; Giobbie-Hurder, Anita; Mallon, Elizabeth; Gusterson, Barry; Viale, Giuseppe; Winer, Eric P.; Thürlimann, Beat; Gelber, Richard D.; Colleoni, Marco; Ejlertsen, Bent; Debled, Marc; Price, Karen N.; Regan, Meredith M.; Coates, Alan S.; Goldhirsch, Aron

    2015-01-01

    Purpose To evaluate the relative effectiveness of letrozole compared with tamoxifen for patients with invasive ductal or lobular carcinoma. Patients and Methods Patients diagnosed with early-stage invasive ductal carcinoma (IDC) or classic invasive lobular carcinoma (ILC) who were randomly assigned onto the Breast International Group (BIG) 1-98 trial and who had centrally reviewed pathology data were included (N = 2,923). HER2-negative IDC and ILC were additionally classified as hormone receptor–positive with high (luminal B [LB] –like) or low (luminal A [LA] –like) proliferative activity by Ki-67 labeling index. Survival analyses were performed with weighted Cox models that used inverse probability of censoring weighted modeling. Results The median follow-up time was 8.1 years. In multivariable models for disease-free survival (DFS), significant interactions between treatment and histology (ILC or IDC; P = .006) and treatment and subgroup (LB like or LA like; P = .01) were observed. In the ILC subset, there was a 66% reduction in the hazard of a DFS event with letrozole for LB (hazard ratio [HR], 0.34; 95% CI, 0.21 to 0.55) and a 50% reduction for LA subtypes (HR, 0.50; 95% CI, 0.32 to 0.78). In the IDC subset, there was a significant 35% reduction in the hazard of a DFS event with letrozole for the LB subtype (HR, 0.65; 95% CI, 0.53 to 0.79), but no difference between treatments was noted for IDC and the LA subtype (HR, 0.95; 95% CI, 0.76 to 1.20). Conclusion The magnitude of benefit of adjuvant letrozole is greater for patients diagnosed with lobular carcinoma versus ductal carcinoma. PMID:26215945

  2. The advantage of letrozole over tamoxifen in the BIG 1-98 trial is consistent in younger postmenopausal women and in those with chemotherapy-induced menopause

    DEFF Research Database (Denmark)

    Chirgwin, Jacquie; Sun, Zhuoxin; Smith, Ian

    2012-01-01

    Letrozole, an aromatase inhibitor, is ineffective in the presence of ovarian estrogen production. Two subpopulations of apparently postmenopausal women might derive reduced benefit from letrozole due to residual or returning ovarian activity: younger women (who have the potential for residual sub...... chemotherapy and patients with chemotherapy-induced menopause parallel the letrozole benefit seen in the BIG 1-98 population as a whole. These data support the use of letrozole even in such patients.......) in the BIG 1-98 trial we identified two relevant subpopulations: patients with potential residual ovarian function, defined as having natural menopause, treated without adjuvant or neoadjuvant chemotherapy and age ≤ 55 years (n = 641); and those with chemotherapy-induced menopause (n = 105). Neither...

  3. Genetic variation in codons 167, 198 and 200 of the beta-tubulin gene in whipworms (Trichuris spp.) from a range of domestic animals and wildlife

    DEFF Research Database (Denmark)

    Hansen, Tina Vicky Alstrup; Nejsum, Peter; Olsen, Annette

    2013-01-01

    and used to amplify a ~476 bp fragment of the beta-tubulin gene. The PCR products were sequenced, analysed and evaluated. We did not identify SNPs in codons 167, 198 or 200 that led to amino acid substitutions in any of the studied Trichuris spp., but genetic variation expected to be related to species......A recurrent problem in the control of whipworm (Trichuris spp.) infections in many animal species and man is the relatively low efficacy of treatment with a single application of benzimidazoles (BZs). The presence of single nucleotide polymorphisms (SNPs) in codons 167, 198 and 200 in the beta...... to investigate the presence of these SNPs in the beta-tubulin gene of Trichuris spp. obtained from a range of animals. DNA was extracted from a total of 121 Trichuris spp. adult whipworm specimens obtained from 6 different host species. The number of worms from each host was pig: 31, deer: 21, sheep: 18, mouse...

  4. OXA-48 carbapenemase-producing Salmonella enterica serovar Kentucky isolate of sequence type 198 in a patient transferred from Libya to Switzerland.

    Science.gov (United States)

    Seiffert, Salome N; Perreten, Vincent; Johannes, Sönke; Droz, Sara; Bodmer, Thomas; Endimiani, Andrea

    2014-01-01

    Here, we report a case of OXA-48-producing Salmonella enterica serovar Kentucky of sequence type 198 (ST198) from perianal screening cultures of a patient transferred from Libya to Switzerland. The blaOXA-48 gene was carried by Tn1999.2 and located on an ∼60-kb IncL/M plasmid. This Salmonella strain also possessed the blaVEB-8, aac(6)-Ib, tet(A), sul1, and mphA resistance genes and substitutions in GyrA (Ser83Phe and Asp87Asn) and ParC (Ser80Ile). This finding emphasizes that prompt screening strategies are essential to prevent the dissemination of carbapenemase producers imported from countries where they are endemic.

  5. Bone fractures among postmenopausal patients with endocrine-responsive early breast cancer treated with 5 years of letrozole or tamoxifen in the BIG 1-98 trial

    DEFF Research Database (Denmark)

    Rabaglio, M; Sun, Z; Price, K N

    2009-01-01

    BACKGROUND: To compare the incidence and timing of bone fractures in postmenopausal women treated with 5 years of adjuvant tamoxifen or letrozole for endocrine-responsive early breast cancer in the Breast International Group (BIG) 1-98 trial. METHODS: We evaluated 4895 patients allocated to 5 years...... of letrozole or tamoxifen in the BIG 1-98 trial who received at least some study medication (median follow-up 60.3 months). Bone fracture information (grade, cause, site) was collected every 6 months during trial treatment. RESULTS: The incidence of bone fractures was higher among patients treated...... with letrozole [228 of 2448 women (9.3%)] versus tamoxifen [160 of 2447 women (6.5%)]. The wrist was the most common site of fracture in both treatment groups. Statistically significant risk factors for bone fractures during treatment included age, smoking history, osteoporosis at baseline, previous bone...

  6. An aqueous route to [Ta6O19]8- and solid-state studies of isostructural niobium and tantalum oxide complexes.

    Science.gov (United States)

    Anderson, Travis M; Rodriguez, Mark A; Bonhomme, François; Bixler, Joel N; Alam, Todd M; Nyman, May

    2007-10-28

    A new soft chemical route to [Ta6O19]8- has been developed by the dissolution of [Ta(O2)4]3- in conditions alkaline enough to arrest formation of Ta2O5, followed by [VO4]3--catalyzed decomposition of the peroxide ligands and crystallization of the salt. An average of bond lengths and angles from isostructural salts of [Ta6O19]8- and [Nb6O19]8- indicate there is an increase in terminal M(eta=O) bond lengths and M-micro2-O-M angles and a decrease in bridging micro2-O-M bond lengths in [Ta6O19]8-, although the central micro6-O-M bond lengths are identical within experimental error. Two new structures of Na7[HNb6O19].15H2O () and Na8[Ta6O19].15H2O () are exemplary of the fact that protonated micro2-OH are observed exclusively in the niobates. In these structures, the metal-oxide framework, seven sodium atoms, and all fifteen water molecules are located in identical unit cell positions, but in an eighth charge-balancing sodium is located in close proximity to the protonated micro2-OH in . Differences in the basicity of Nb(v)- and Ta(v)-bound oxygen atoms are also manifested at the surfaces of 17O-enriched powders of Nb2O5 and Ta2O5. Oxygen exchange at the surface of these materials readily takes place at both terminal and bridging sites in Nb2O5 but only at terminal sites in Ta2O5.

  7. Predictors of early relapse in postmenopausal women with hormone receptor-positive breast cancer in the BIG 1-98 trial

    OpenAIRE

    Mauriac, L.; Keshaviah, A; Debled, M; Mouridsen, H; Forbes, Jf; Thürlimann, B; Paridaens, R; Monnier, A.; Láng, I.; Wardley, A; Nogaret, J-M; Gelber, RD; Castiglione-Gertsch, M.; Price, KN; Coates, AS

    2017-01-01

    Background: Aromatase inhibitors are considered standard adjuvant endocrine treatment of postmenopausal women with hormone receptor-positive breast cancer, but it remains uncertain whether aromatase inhibitors should be given upfront or sequentially with tamoxifen. Awaiting results from ongoing randomized trials, we examined prognostic factors of an early relapse among patients in the BIG 1-98 trial to aid in treatment choices. Patients and methods: Analyses included all 7707 eligible patient...

  8. Cardiovascular adverse events during adjuvant endocrine therapy for early breast cancer using letrozole or tamoxifen: safety analysis of BIG 1-98 trial.

    Science.gov (United States)

    Mouridsen, Henning; Keshaviah, Aparna; Coates, Alan S; Rabaglio, Manuela; Castiglione-Gertsch, Monica; Sun, Zhuoxin; Thürlimann, Beat; Mauriac, Louis; Forbes, John F; Paridaens, Robert; Gelber, Richard D; Colleoni, Marco; Smith, Ian; Price, Karen N; Goldhirsch, Aron

    2007-12-20

    Previous analyses of adjuvant studies of aromatase inhibitors versus tamoxifen, including the Breast International Group (BIG) 1-98 study, have suggested a small numerical excess of cardiac adverse events (AEs) on aromatase inhibitors, a reduction in the incidence of hypercholesterolemia on tamoxifen, and significantly higher incidence of thromboembolic AEs on tamoxifen. The purpose of the present study is to provide detailed updated information on these AEs in BIG 1-98. Eight thousand twenty-eight postmenopausal women with receptor-positive early breast cancer were randomly assigned (double-blind) between March 1998 and May 2003 to receive 5 years of adjuvant endocrine therapy with letrozole, tamoxifen, or a sequence of these agents. Seven thousand nine hundred sixty-three patients who actually received therapy are included in this safety analysis, which focuses on cardiovascular events. AE recording ceased 30 days after therapy completion (or after switch on the sequential arms). Baseline comorbidities were balanced. At a median follow-up time of 30.1 months, we observed similar overall incidence of cardiac AEs (letrozole, 4.8%; tamoxifen, 4.7%), more grade 3 to 5 cardiac AEs on letrozole (letrozole, 2.4%; tamoxifen, 1.4%; P = .001)--an excess only partially attributable to prior hypercholesterolemia--and more overall (tamoxifen, 3.9%; letrozole, 1.7%; P < .001) and grade 3 to 5 thromboembolic AEs on tamoxifen (tamoxifen, 2.3%; letrozole, 0.9%; P < .001). There was no significant difference between tamoxifen and letrozole in incidence of hypertension or cerebrovascular events. The present safety analysis, limited to cardiovascular AEs in BIG 1-98, documents a low overall incidence of cardiovascular AEs, which differed between treatment arms.

  9. Five years of letrozole compared with tamoxifen as initial adjuvant therapy for postmenopausal women with endocrine-responsive early breast cancer: update of study BIG 1-98.

    Science.gov (United States)

    Coates, Alan S; Keshaviah, Aparna; Thürlimann, Beat; Mouridsen, Henning; Mauriac, Louis; Forbes, John F; Paridaens, Robert; Castiglione-Gertsch, Monica; Gelber, Richard D; Colleoni, Marco; Láng, István; Del Mastro, Lucia; Smith, Ian; Chirgwin, Jacquie; Nogaret, Jean-Marie; Pienkowski, Tadeusz; Wardley, Andrew; Jakobsen, Erik H; Price, Karen N; Goldhirsch, Aron

    2007-02-10

    Previous analyses of the Breast International Group (BIG) 1-98 four-arm study compared initial therapy with letrozole or tamoxifen including patients randomly assigned to sequential treatment whose information was censored at the time of therapy change. Because this presentation may unduly reflect early events, the present analysis is limited to patients randomly assigned to the continuous therapy arms and includes protocol-defined updated results. Four thousand nine hundred twenty-two of the 8,028 postmenopausal women with receptor-positive early breast cancer randomly assigned (double-blind) to the BIG 1-98 trial were assigned to 5 years of continuous adjuvant therapy with either letrozole or tamoxifen; the remainder of women were assigned to receive the agents in sequence. Disease-free survival (DFS) was the primary end point. At a median follow-up time of 51 months, we observed 352 DFS events among 2,463 women receiving letrozole and 418 events among 2,459 women receiving tamoxifen. This reflected an 18% reduction in the risk of an event (hazard ratio, 0.82; 95% CI, 0.71 to 0.95; P = .007). No predefined subsets showed differential benefit. Adverse events were similar to previous reports. Patients on tamoxifen experienced more thromboembolic events, endometrial pathology, hot flashes, night sweats, and vaginal bleeding. Patients on letrozole experienced more bone fractures, arthralgia, low-grade hypercholesterolemia, and cardiovascular events other than ischemia and cardiac failure. The present updated analysis, which was limited to patients on monotherapy arms in BIG 1-98, yields results similar to those from the previous primary analysis but more directly comparable with results from other trials of continuous therapy using a single endocrine agent.

  10. El derecho a contraer matrimonio entre personas del mismo sexo. Algunas reflexiones a propósito de la sentencia del Tribunal Constitucional 198/2012

    OpenAIRE

    Expósito, Enriqueta

    2013-01-01

    La sentencia del Tribunal Constitucional 198/2012 constituye el último eslabón en el debate jurídico abierto con la promulgación de la ley 13/2005, por la cual se posibilita en nuestro ordenamiento que dos personas de un mismo sexo puedan contraer matrimonio, equiparándolos, a todos los efectos legales, a los matrimonios heterosexuales. La declaración de constitucionalidad de esta norma, viene a despojar al matrimonio -contemplado en el artículo 32 de la CE- de uno de sus elementos que durant...

  11. Comment on “Mathematical modeling of unicellular microalgae and cyanobacteria metabolism for biofuel production” by Baroukh et al. [Curr Opin Biotechnol. 2015, 33:198–205

    Energy Technology Data Exchange (ETDEWEB)

    Song, Hyun-Seob; Ramkrishna, Doraiswami

    2016-04-01

    This letter concerns an article recently published in Current Opinion in Biotechnology by Baroukh et al. entitled "Mathematical modeling of unicellular microalgae and cyanobacteria metabolism for biofuel production" (2015 Mar 26; 33:198-205). The issue we wish to bring to light is the authors’ claim that dynamic metabolic models including Hybrid Cybernetic Model (HCM) (Kim et al., 2008; Song et al., 2009) and Lumped HCM (L-HCM) (Song and Ramkrishna, 2010; 2011) are based on the balanced growth hypothesis so that they are unable to simulate the accumulation of intracellular metabolites. This is a misrepresentation of these models due to the following reasons.

  12. Decay Data Evaluation Project (DDEP): Updated decay data evaluations for (24)Na, (46)Sc, (51)Cr, (54)Mn, (57)Co, (59)Fe, (88)Y, (198)Au.

    Science.gov (United States)

    Chechev, Valery P; Kuzmenko, Nikolay K

    2016-03-01

    Updated DDEP evaluations have been presented for the decay characteristics of the radionuclides (24)Na, (46)Sc, (51)Cr, (54)Mn, (57)Co, (59)Fe, (88)Y and (198)Au. Previous DDEP evaluations for these radionuclides were published in the BIPM-5 monographie in 2004. The experimental data published during the intervening period of 2004-2014 were taken into account in the current evaluations as well as other information: new compilations, analyses, and corrections. The updated evaluations are compared to previous results. Copyright © 2015 Elsevier Ltd. All rights reserved.

  13. Measurement of the half-life of Au198 in a nonmetal: High-precision measurement shows no host-material dependence

    Science.gov (United States)

    Goodwin, J. R.; Nica, N.; Iacob, V. E.; Dibidad, A.; Hardy, J. C.

    2010-10-01

    We have measured the half-life of the β- decay of Au198 to be 2.6948(9) d, with the nuclide sited in an insulating environment. Comparing this result with the half-life we measured previously with a metallic environment, we find the half-lives in both environments to be the same within 0.04%, thus contradicting a prediction that screening from a “plasma” of quasifree electrons in a metal increases the half-life by as much as 7%.

  14. Evidence for {open_quotes}magnetic rotation{close_quotes} in nuclei: New results on the M1-bands of {sup 198,199}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Clark, R.M. [Lawrence Berkeley National Lab., CA (United States)

    1996-12-31

    Lifetimes of states in four of the M1-bands in {sup 198,199}Pb have been determined through a Doppler Shift Attenuation Method measurement performed using the Gammasphere array. The deduced B(M1) values, which are a sensitive probe of the underlying mechanism for generating these sequences, show remarkable agreement with Tilted Axis Cranking (TAC) calculations. Evidence is also presented for the possible termination of the bands. The results represent clear evidence for a new concept in nuclear excitations: {open_quote}magnetic rotation{close_quote}.

  15. An aqueous route to [Ta6O19]8- and solid-state studies of isostructural niobium and tantalum oxide complexes.

    Energy Technology Data Exchange (ETDEWEB)

    Nyman, May D.; Anderson, Travis Mark; Alam, Todd Michael; Rodriguez, Mark A; Joel N. Bixler; Francois Bonhomme

    2007-10-01

    Tantalate materials play a vital role in our high technology society: tantalum capacitors are found in virtually every cell phone. Furthermore, electronic characteristics and the incredibly inert nature of tantalates renders them ideal for applications such as biomedical implants, nuclear waste forms, ferroelectrics, piezoelectrics, photocatalysts and optical coatings. The inert and insoluble nature of tantalates is not fundamentally understood; and furthermore poor solubility renders fabrication of novel or optimized tantalates very difficult. We have developed a soft chemical route to water-soluble tantalum oxide clusters that can serve as both precursors for novel tantalate materials and ideal models for experimental and computational approaches to understanding the unusually inert behavior of tantalates. The water soluble cluster, [Ta6O19]8- is small, highly symmetric, and contains the representative oxygen types of a metal oxide surface, and thus ideally mimics a complex tantalate surface in a simplistic form that can be studied unambiguously. Furthermore; in aqueous solution, these highly charged and super-basic clusters orchestrate surprising acid-base behavior that most likely plays an important role in the inertness of related oxide surfaces. Our unique synthetic approach to the [Ta6O19]8- cluster allowed for unprecedented enrichment with isotopic labels (17O), enabling detailed kinetic and mechanistic studies of the behavior of cluster oxygens, as well as their acid-base behavior. This SAND report is a collection of two publications that resulted from these efforts.

  16. Predictors of early relapse in postmenopausal women with hormone receptor-positive breast cancer in the BIG 1-98 trial.

    Science.gov (United States)

    Mauriac, L; Keshaviah, A; Debled, M; Mouridsen, H; Forbes, J F; Thürlimann, B; Paridaens, R; Monnier, A; Láng, I; Wardley, A; Nogaret, J-M; Gelber, R D; Castiglione-Gertsch, M; Price, K N; Coates, A S; Smith, I; Viale, G; Rabaglio, M; Zabaznyi, N; Goldhirsch, A

    2007-05-01

    Aromatase inhibitors are considered standard adjuvant endocrine treatment of postmenopausal women with hormone receptor-positive breast cancer, but it remains uncertain whether aromatase inhibitors should be given upfront or sequentially with tamoxifen. Awaiting results from ongoing randomized trials, we examined prognostic factors of an early relapse among patients in the BIG 1-98 trial to aid in treatment choices. Analyses included all 7707 eligible patients treated on BIG 1-98. The median follow-up was 2 years, and the primary end point was breast cancer relapse. Cox proportional hazards regression was used to identify prognostic factors. Two hundred and eighty-five patients (3.7%) had an early relapse (3.1% on letrozole, 4.4% on tamoxifen). Predictive factors for early relapse were node positivity (P < 0.001), absence of both receptors being positive (P < 0.001), high tumor grade (P < 0.001), HER-2 overexpression/amplification (P < 0.001), large tumor size (P = 0.001), treatment with tamoxifen (P = 0.002), and vascular invasion (P = 0.02). There were no significant interactions between treatment and the covariates, though letrozole appeared to provide a greater than average reduction in the risk of early relapse in patients with many involved lymph nodes, large tumors, and vascular invasion present. Upfront letrozole resulted in significantly fewer early relapses than tamoxifen, even after adjusting for significant prognostic factors.

  17. CYP19A1 polymorphisms and clinical outcomes in postmenopausal women with hormone receptor-positive breast cancer in the BIG 1-98 trial

    DEFF Research Database (Denmark)

    Leyland-Jones, Brian; Gray, Kathryn P; Abramovitz, Mark

    2015-01-01

    To determine whether CYP19A1 polymorphisms are associated with abnormal activity of aromatase and with musculoskeletal and bone side effects of aromatase inhibitors. DNA was isolated from tumor specimens of 4861 postmenopausal women with hormone receptor-positive breast cancer enrolled in the BIG 1......-98 trial to receive tamoxifen and/or letrozole for 5 years. Tumors were genotyped for six CYP19A1 polymorphisms using PCR-based methods. Associations with breast cancer-free interval (BCFI), distant recurrence-free interval (DRFI), musculoskeletal and bone adverse events (AEs) were assessed using Cox...... proportional hazards models. All statistical tests were two-sided. No association between the CYP19A1 genotypes and BCFI or DRFI was observed overall. A reduced risk of a breast cancer event for tamoxifen-treated patients with rs700518 variants was observed (BCFI CC/TC vs. TT: HR 0.53, 95 % CI 0...

  18. Synthesis and Characterization of [(OH)TeNb5O18](6-) in Water Solution, Comparison with [Nb6O19](8-).

    Science.gov (United States)

    Abramov, Pavel A; Zemerova, Tatiana P; Moroz, Nikolay K; Kompankov, Nikolay B; Zhdanov, Artem A; Tsygankova, Alfiya R; Vicent, Cristian; Sokolov, Maxim N

    2016-02-15

    Reaction of [Nb6O19](8-) with H6TeO6 in water gives telluropentaniobate [(OH)TeNb5O18](6-) (1) as single product, which was isolated as Na(+) and mixed Na(+)/K(+) salts. Crystal structures were determined for Na6[(OH)TeNb5O18]·15H2O (Na6-1) and K6Na[Nb(5.5){Te(OH)}(0.5)O(18.5)]·26H2O (K6Na-1). Formation of 1 was monitored with electrospray ionization mass spectrometry (ESI-MS) and (125)Te NMR techniques. Capillary electrophoresis was used to calculate electrophoretic mobilities and radii of the anionic species in solutions of [(OH)TeNb5O18](6-) and [Nb6O19](8-) in borate buffer. No condensation or degradation products were detected. Reactions of 1 with {Cp*Rh}(2+) sources gives 1:1 and 2:1 hybrid polyoxometalate, which are present in solution as a mixture of isomers, as detected by (125)Te NMR. The isomerism is related to various possibilities of coordination of {Cp*Rh}(2+) to different {M3O3} faces, relative to the unique Te atom. According to ESI-MS experiments in water and methanol, rapid redistribution of the organometallic fragments between the 1:1 and 2:1 complexes takes place. The 1:1 complexes are more stable in water, while 2:1 complexes dominate in methanol. X-ray structural analysis of the crystals isolated from 2:1 reaction mixture allowed identification of Na3[{Cp*Rh}2TeNb5O19]·24H2O (Cp*2Rh2-1) with two {Cp*Rh}(2+) fragments capping the opposing faces of the Lindqvist anion.

  19. Gold nanoparticles production using reactor and cyclotron based methods in assessment of (196,198)Au production yields by (197)Au neutron absorption for therapeutic purposes.

    Science.gov (United States)

    Khorshidi, Abdollah

    2016-11-01

    Medical nano-gold radioisotopes is produced regularly using high-flux nuclear reactors, and an accelerator-driven neutron activator can turn out higher yield of (197)Au(n,γ)(196,198)Au reactions. Here, nano-gold production via radiative/neutron capture was investigated using irradiated Tehran Research Reactor flux and also simulated proton beam of Karaj cyclotron in Iran. (197)Au nano-solution, including 20nm shaped spherical gold and water, was irradiated under Tehran reactor flux at 2.5E+13n/cm(2)/s for (196,198)Au activity and production yield estimations. Meanwhile, the yield was examined using 30MeV proton beam of Karaj cyclotron via simulated new neutron activator containing beryllium target, bismuth moderator around the target, and also PbF2 reflector enclosed the moderator region. Transmutation in (197)Au nano-solution samples were explored at 15 and 25cm distances from the target. The neutron flux behavior inside the water and bismuth moderators was investigated for nano-gold particles transmutation. The transport of fast neutrons inside bismuth material as heavy nuclei with a lesser lethargy can be contributed in enhanced nano-gold transmutation with long duration time than the water moderator in reactor-based method. Cyclotron-driven production of βeta-emitting radioisotopes for brachytherapy applications can complete the nano-gold production technology as a safer approach as compared to the reactor-based method. Copyright © 2016 Elsevier B.V. All rights reserved.

  20. Adjuvant letrozole versus tamoxifen according to centrally-assessed ERBB2 status for postmenopausal women with endocrine-responsive early breast cancer: supplementary results from the BIG 1-98 randomised trial

    DEFF Research Database (Denmark)

    Regan, M.M.; Lykkesfeldt, A.E.; Dell'Orto, P.

    2008-01-01

    Background The Breast International Group (BIG) 1-98 trial (a randomised double-blind phase III trial) has shown that letrozole significantly improves disease-free survival (DFS) compared with tamoxifen in postmenopausal women with endocrine-responsive early breast cancer. Our aim was to establish...... was the primary endpoint, and to assess treatment-by-covariate interactions. The BIG 1-98 trial is registered on the clinical trials site of the US National Cancer institute website http://www.clinicaltrials.gov/ct/show/NCT00004205. Findings By central assessment 7% (257 of 3650) of tumours were classified...... whether the benefit of letrozole versus tamoxifen differs according to the ERBB2 status of tumours. Methods The BIG 1-98 trial consists of four treatment groups that compare 5 years of monotherapy with letrozole or tamoxifen, and sequential administration of one drug for 2 years followed by the other drug...

  1. Associations between glutathione peroxidase-1 Pro198Leu polymorphism, selenium status, and DNA damage levels in obese women after consumption of Brazil nuts.

    Science.gov (United States)

    Cominetti, Cristiane; de Bortoli, Maritsa Carla; Purgatto, Eduardo; Ong, Thomas Prates; Moreno, Fernando Salvador; Garrido, Arthur Belarmino; Cozzolino, Silvia Maria Franciscato

    2011-09-01

    Alterations in selenium (Se) status may result in suboptimal amounts of selenoproteins, which have been associated with increased oxidative stress levels. The Pro198Leu polymorphism at the glutathione peroxidase-1 (GPx1) gene is supposed to be functional. The response of Se status, GPx activity, and levels of DNA damage to a Se supplementation trial between the genotypes related to that polymorphism was investigated. A randomized trial was conducted with 37 morbidly obese women. Participants consumed one Brazil nut, which provided approximately 290 μg of Se a day, for 8 wk. Blood Se concentrations, erythrocyte GPx activity, and DNA damage levels were measured at baseline and at 8 wk. The results were compared by genotypes. The genotype frequencies were 0.487, 0.378, and 0.135 for Pro/Pro (the wild-type genotype), Pro/Leu, and Leu/Leu, respectively. At baseline, 100% of the subjects were Se deficient, and after the supplementation, there was an improvement in plasma Se (P < 0.001 for Pro/Pro and Pro/Leu, P < 0.05 for Leu/Leu), erythrocyte Se (P = 0.00 for Pro/Pro and Pro/Leu, P < 0.05 for Leu/Leu), and GPx activity (P = 0.00 for Pro/Pro, P < 0.00001 for Pro/Leu, P < 0.001 for Leu/Leu). In addition, the Pro/Pro group showed a decrease in DNA damage after Brazil nut consumption compared with baseline (P < 0.005), and those levels were higher in Leu/Leu subjects compared with those with the wild-type genotype (P < 0.05). Consumption of one unit of Brazil nuts daily effectively increases Se status and increases GPx activity in obese women, regardless of GPx1 Pro198Leu polymorphism. However, the evaluated biomarkers showed distinct results in response to the supplementation when the polymorphism was considered. Copyright © 2011 Elsevier Inc. All rights reserved.

  2. Which patients benefit most from adjuvant aromatase inhibitors? Results using a composite measure of prognostic risk in the BIG 1-98 randomized trial

    Science.gov (United States)

    Viale, G.; Regan, M. M.; Dell'Orto, P.; Mastropasqua, M. G.; Maiorano, E.; Rasmussen, B. B.; MacGrogan, G.; Forbes, J. F.; Paridaens, R. J.; Colleoni, M.; Láng, I.; Thürlimann, B.; Mouridsen, H.; Mauriac, L.; Gelber, R. D.; Price, K. N.; Goldhirsch, A.; Gusterson, B. A.; Coates, A. S.

    2011-01-01

    Background: On average, aromatase inhibitors are better than tamoxifen when used as initial or sequential therapy for postmenopausal women with endocrine-responsive early breast cancer. Because there may be contraindications to their use based on side-effects or cost, we investigated subgroups in which aromatase inhibitors may be more or less important. Patients and methods: Breast International Group 1-98 trial randomized 6182 women among four groups comparing letrozole and tamoxifen with sequences of each agent; 5177 (84%) had centrally confirmed estrogen receptor (ER) positivity. We assessed whether centrally determined ER, progesterone receptor (PgR), human epidermal growth factor receptor 2, and Ki-67 labeling index, alone or in combination with other prognostic features, predicted the magnitude of letrozole effectiveness compared with either sequence or tamoxifen monotherapy. Results: Individually, none of the markers significantly predicted differential treatment effects. Subpopulation treatment effect pattern plot analysis of a composite measure of prognostic risk revealed three patterns. Estimated 5-year disease-free survival for letrozole monotherapy, letrozole→tamoxifen, tamoxifen→letrozole, and tamoxifen monotherapy were 96%, 94%, 93%, and 94%, respectively, for patients at lowest risk; 90%, 91%, 93%, and 86%, respectively, for patients at intermediate risk; and 80%, 76%, 74%, and 69%, respectively, for patients at highest risk. Conclusion: A composite measure of risk informs treatment selection better than individual biomarkers and supports the choice of 5 years of letrozole for patients at highest risk for recurrence. PMID:21335417

  3. Sport, sex and age increase risk of illness at the Rio 2016 Summer Paralympic Games: a prospective cohort study of 51 198 athlete days.

    Science.gov (United States)

    Derman, Wayne; Schwellnus, Martin P; Jordaan, Esme; Runciman, Phoebe; Blauwet, Cheri; Webborn, Nick; Lexell, Jan; Van de Vliet, Peter; Tuakli-Wosornu, Yetsa; Kissick, James; Stomphorst, Jaap

    2018-01-01

    To describe the epidemiology of illness at the Rio 2016 Summer Paralympic Games. A total of 3657 athletes from 78 countries, representing 83.5% of all athletes at the Games, were monitored on the web-based injury and illness surveillance system (WEB-IISS) over 51 198 athlete days during the Rio 2016 Summer Paralympic Games. Illness data were obtained daily from teams with their own medical support through the WEB-IISS electronic data capturing systems. The total number of illnesses was 511, with an illness incidence rate (IR) of 10.0 per 1000 athlete days (12.4%). The highest IRs were reported for wheelchair fencing (14.9), para swimming (12.6) and wheelchair basketball (12.5) (pwheelchair fencing, para swimming and wheelchair basketball; (3) female and older athletes (35-75 years) were at increased risk of illness; and (4) the respiratory system, skin and subcutaneous system and digestive system were most affected by illness. These results allow for comparison at future Games. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  4. High-level fluoroquinolone resistant Salmonella enterica serovar Kentucky ST198 epidemic clone with IncA/C conjugative plasmid carrying bla(CTX-M-25) gene.

    Science.gov (United States)

    Wasyl, Dariusz; Kern-Zdanowicz, Izabela; Domańska-Blicharz, Katarzyna; Zając, Magdalena; Hoszowski, Andrzej

    2015-01-30

    Multidrug resistant Salmonella Kentucky strains have been isolated from turkeys in Poland since 2009. Multiple mutations within chromosomal genes gyrA and parC were responsible for high-level ciprofloxacin resistance. One of the isolates was extended spectrum β-lactamase- (ESBL) positive: the strain 1643/2010 carried a conjugative 167,779 bps plasmid of IncA/C family. The sequence analysis revealed that it carried a blaCTX-M-25 gene and an integron with another β-lactamase encoding gene-blaOXA-21. This is the first known report of a CTX-M-25 encoding gene both in Poland and in Salmonella Kentucky world-wide, as well as in the IncA/C plasmid. Analysis of the integron showed a novel arrangement of gene cassettes-aacA4, aacC-A1 and blaOXA-21 where the latter might result from an intergeneric gene transfer. The study confirmed Salmonella Kentucky population isolated in Poland belongs to global epidemics of high level fluoroquinolone resistant clone ST198 that can carry rare β-lactamase genes. Copyright © 2014 Elsevier B.V. All rights reserved.

  5. Antiapoptotic effect of novel compound from Herba leonuri - leonurine (SCM-198): a mechanism through inhibition of mitochondria dysfunction in H9c2 cells.

    Science.gov (United States)

    Liu, Xin Hua; Pan, Li Long; Gong, Qi Hai; Zhu, Yi Zhun

    2010-12-01

    Apoptosis of cardiomyocytes induced by oxidative stress play a critical role in cardiac dysfunction associated with ventricular remodeling and heart failure. We recently reported that leonurine attenuated hypoxia-induced cardiomyocyte damage. In this study, we investigated the mechanism of leonurine (originally from Herba leonuri but we synthesized it chemically it as also called SCM-198) (H₂O₂)-induced rat embryonic heart-derived H9c2 cells from apoptosis. Exposing H9c2 cells to H₂O₂ significantly decreased cell viability, and this was attenuated by pretreatment with leonurine for 4 h in a concentration-dependent manner. Meanwhile, leonurine was found to reduce intracellular reactive oxygen species (ROS) generation in H₂O₂-stimulated cell. Moreover, H9c2 cells stimulated by H₂O₂ was accompanied with apparent apoptotic characteristics, including fragmentation of DNA, apoptotic body formation, release of cytochrome c, translocation of Bax to mitochondria, loss of mitochondrial membrane potential (ΔΨ(m)) and activation of caspase 3. Furthermore, H₂O₂ also induced rapid and significant phosphorylation of the c-Jun-N-terminal kinase 1/2 (JNK1/2), which was inhibited SP600125 (a JNK1/2 inhibitor). All of these events were attenuated by leonurine pretreatment. Taken together, these results demonstrated that leonurine could protect H9c2 cells from H₂O₂-induced apoptosis via modulation of mitochondrial dysfunction associated with blocking the activation of JNK1/2.

  6. Analyses adjusting for selective crossover show improved overall survival with adjuvant letrozole compared with tamoxifen in the BIG 1-98 study.

    Science.gov (United States)

    Colleoni, Marco; Giobbie-Hurder, Anita; Regan, Meredith M; Thürlimann, Beat; Mouridsen, Henning; Mauriac, Louis; Forbes, John F; Paridaens, Robert; Láng, István; Smith, Ian; Chirgwin, Jacquie; Pienkowski, Tadeusz; Wardley, Andrew; Price, Karen N; Gelber, Richard D; Coates, Alan S; Goldhirsch, Aron

    2011-03-20

    Among postmenopausal women with endocrine-responsive breast cancer, the aromatase inhibitor letrozole, when compared with tamoxifen, has been shown to significantly improve disease-free survival (DFS) and time to distant recurrence (TDR). We investigated whether letrozole monotherapy prolonged overall survival (OS) compared with tamoxifen monotherapy. Of 8,010 postmenopausal women with hormone receptor-positive, early breast cancer enrolled on the Breast International Group (BIG) 1-98 study, 4,922 were randomly assigned to 5 years of continuous adjuvant therapy with either letrozole or tamoxifen. Of 2,459 patients enrolled in the tamoxifen treatment arm, 619 (25.2%) selectively crossed over to either adjuvant or extended letrozole after initial trial results were presented in January 2005. To gain better estimates of relative treatment effects in the presence of selective crossover, we used inverse probability of censoring weighted (IPCW) modeling. Weighted Cox models, by using IPCW, estimated a statistically significant, 18% reduction in the hazard of an OS event with letrozole treatment (hazard ratio [HR], 0.82; 95% CI, 0.70 to 0.95). Estimates of 5-year OS on the basis of IPCW were 91.8% and 90.4% for letrozole and tamoxifen, respectively. The HRs of DFS and TDR events by using IPCW modeling were 0.83 (95% CI, 0.74 to 0.94) and 0.80 (95% CI, 0.67 to 0.94), respectively (P < .05 for DFS, OS, and TDR). Median follow-up was 74 months. Adjuvant treatment with letrozole, compared with tamoxifen, significantly reduces the risk of death, the risk of recurrent disease, and the risk of recurrence at distant sites in postmenopausal women with hormone receptor-positive breast cancer.

  7. Synthesis and reactivity of {Ru(p-cymene)}2+ derivatives of [Nb6O19]8-: a rational approach towards fluxional organometallic derivatives of polyoxometalates.

    Science.gov (United States)

    Laurencin, Danielle; Thouvenot, René; Boubekeur, Kamal; Proust, Anna

    2007-04-07

    Three {Ru(p-cym)}(2+) (p-cym = p-cymene) derivatives of [Nb(6)O(19)](8-)-[Nb(6)O(19){Ru(p-cym)}](6-) (Nb(6)Ru(1)), trans-[Nb(6)O(19){Ru(p-cym)}(2)](4-) (t-Nb6Ru2), and [Nb(6)O(19){Ru(p-cym)}(4)] (Nb(6)Ru(4))--have been synthesized in water by reaction between [Ru(p-cym)Cl(2)](2) and the hexaniobate. In the solid state, Nb(6)Ru(1) and Nb(6)Ru(4) have been characterized by IR and EDX spectroscopies, whereas t-Nb(6)Ru(2) has been characterized by IR spectroscopy and single-crystal X-ray diffraction (crystal data for K(4)-trans-[Nb(6)O(19){Ru(p-cym)}(2)].14H(2)O (K(4)-t-Nb(6)Ru(2).14H(2)O). In solution, all compounds were characterized by (1)H NMR and ESI mass spectrometry analyses, and Nb(6)Ru(1) was also analyzed by (17)O NMR. These studies allowed a comparison of the differences in behaviour of the three complexes in water: Nb(6)Ru(1) is particularly stable, Nb(6)Ru(4) decomposes by loss of {Ru(p-cym)}(2+) fragments, and trans-[Nb(6)O(19){Ru(p-cym)}(2)](4-) isomerizes into cis-[Nb(6)O(19){Ru(p-cym)}(2)](4-). A rational mechanism for the isomerisation of t-Nb(6)Ru(2) is proposed on the basis of a kinetic study.

  8. High precompetition injury rate dominates the injury profile at the Rio 2016 Summer Paralympic Games: a prospective cohort study of 51 198 athlete days.

    Science.gov (United States)

    Derman, Wayne; Runciman, Phoebe; Schwellnus, Martin; Jordaan, Esme; Blauwet, Cheri; Webborn, Nick; Lexell, Jan; van de Vliet, Peter; Tuakli-Wosornu, Yetsa; Kissick, James; Stomphorst, Jaap

    2018-01-01

    To describe the incidence of injury in the precompetition and competition periods of the Rio 2016 Summer Paralympic Games. A total of 3657 athletes from 78 countries, representing 83.4% of all athletes at the Games, were monitored on the web-based injury and illness surveillance system over 51 198 athlete days during the Rio 2016 Summer Paralympic Games. Injury data were obtained daily from teams with their own medical support. A total of 510 injuries were reported during the 14-day Games period, with an injury incidence rate (IR) of 10.0 injuries per 1000 athlete days (12.1% of all athletes surveyed). The highest IRs were reported for football 5-a-side (22.5), judo (15.5) and football 7-a-side (15.3) compared with other sports (pGames (IR of 5.5). The shoulder was the most common anatomical area affected by injury (IR of 1.8). The data from this study indicate that (1) IRs were lower than those reported for the London 2012 Summer Paralympic Games, (2) the sports of football 5-a-side, judo and football 7-a-side were independent risk factors for injury, (3) precompetition injuries had a higher IR than competition period injuries, (4) injuries to the shoulder were the most common. These results would allow for comparative data to be collected at future editions of the Games and can be used to inform injury prevention programmes. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  9. Negative Effects of a Nonhost Proteinase Inhibitor of ~19.8 kDa from Madhuca indica Seeds on Developmental Physiology of Helicoverpa armigera (Hübner)

    Science.gov (United States)

    Jamal, Farrukh; Singh, Dushyant; Pandey, Prabhash K.

    2014-01-01

    An affinity purified trypsin inhibitor from the seed flour extracts of Madhuca indica (MiTI) on denaturing polyacrylamide gel electrophoresis showed that MiTI consisted of a single polypeptide chain with molecular mass of ~19.8 kDa. MiTI inhibited the total proteolytic and trypsin-like activities of the midgut proteinases of Helicoverpa armigera larvae by 87.51% and 76.12%, respectively, at concentration of 5 µg/mL with an IC50 of 1.75 µg/mL against trypsin like midgut proteinases. The enzyme kinetic studies demonstrated that MiTI is a competitive inhibitor with a K i value of 4.1 × 10−10 M for Helicoverpa trypsin like midgut proteinases. In vivo experiments with different concentrations of MiTI in artificial diet (0.5, 1.0, and 1.5% w/w) showed an effective downfall in the larval body weight and an increase in larval mortality. The concentration of MiTI in the artificial diet to cause 50% mortality (LD50) of larvae was 1.5% w/w and that to cause reduction in mass of larvae by 50% (ED50) was 1.0% w/w. Nutritional indices observations suggest the toxic and adverse effects of MiTI on the growth and development of H. armigera larvae. The results suggest a strong bioinsecticidal potential of affinity purified MiTI which can be exploited in insect pest management of crop plants. PMID:25298962

  10. Negative Effects of a Nonhost Proteinase Inhibitor of ~19.8 kDa from Madhuca indica Seeds on Developmental Physiology of Helicoverpa armigera (Hübner

    Directory of Open Access Journals (Sweden)

    Farrukh Jamal

    2014-01-01

    Full Text Available An affinity purified trypsin inhibitor from the seed flour extracts of Madhuca indica (MiTI on denaturing polyacrylamide gel electrophoresis showed that MiTI consisted of a single polypeptide chain with molecular mass of ~19.8 kDa. MiTI inhibited the total proteolytic and trypsin-like activities of the midgut proteinases of Helicoverpa armigera larvae by 87.51% and 76.12%, respectively, at concentration of 5 µg/mL with an IC50 of 1.75 µg/mL against trypsin like midgut proteinases. The enzyme kinetic studies demonstrated that MiTI is a competitive inhibitor with a Ki value of 4.1×10−10 M for Helicoverpa trypsin like midgut proteinases. In vivo experiments with different concentrations of MiTI in artificial diet (0.5, 1.0, and 1.5% w/w showed an effective downfall in the larval body weight and an increase in larval mortality. The concentration of MiTI in the artificial diet to cause 50% mortality (LD50 of larvae was 1.5% w/w and that to cause reduction in mass of larvae by 50% (ED50 was 1.0% w/w. Nutritional indices observations suggest the toxic and adverse effects of MiTI on the growth and development of H. armigera larvae. The results suggest a strong bioinsecticidal potential of affinity purified MiTI which can be exploited in insect pest management of crop plants.

  11. Comparative genomics of the dairy isolate Streptococcus macedonicus ACA-DC 198 against related members of the Streptococcus bovis/Streptococcus equinus complex.

    Science.gov (United States)

    Papadimitriou, Konstantinos; Anastasiou, Rania; Mavrogonatou, Eleni; Blom, Jochen; Papandreou, Nikos C; Hamodrakas, Stavros J; Ferreira, Stéphanie; Renault, Pierre; Supply, Philip; Pot, Bruno; Tsakalidou, Effie

    2014-04-08

    Within the genus Streptococcus, only Streptococcus thermophilus is used as a starter culture in food fermentations. Streptococcus macedonicus though, which belongs to the Streptococcus bovis/Streptococcus equinus complex (SBSEC), is also frequently isolated from fermented foods mainly of dairy origin. Members of the SBSEC have been implicated in human endocarditis and colon cancer. Here we compare the genome sequence of the dairy isolate S. macedonicus ACA-DC 198 to the other SBSEC genomes in order to assess in silico its potential adaptation to milk and its pathogenicity status. Despite the fact that the SBSEC species were found tightly related based on whole genome phylogeny of streptococci, two distinct patterns of evolution were identified among them. Streptococcus macedonicus, Streptococcus infantarius CJ18 and Streptococcus pasteurianus ATCC 43144 seem to have undergone reductive evolution resulting in significantly diminished genome sizes and increased percentages of potential pseudogenes when compared to Streptococcus gallolyticus subsp. gallolyticus. In addition, the three species seem to have lost genes for catabolizing complex plant carbohydrates and for detoxifying toxic substances previously linked to the ability of S. gallolyticus to survive in the rumen. Analysis of the S. macedonicus genome revealed features that could support adaptation to milk, including an extra gene cluster for lactose and galactose metabolism, a proteolytic system for casein hydrolysis, auxotrophy for several vitamins, an increased ability to resist bacteriophages and horizontal gene transfer events with the dairy Lactococcus lactis and S. thermophilus as potential donors. In addition, S. macedonicus lacks several pathogenicity-related genes found in S. gallolyticus. For example, S. macedonicus has retained only one (i.e. the pil3) of the three pilus gene clusters which may mediate the binding of S. gallolyticus to the extracellular matrix. Unexpectedly, similar findings were

  12. ESR1 and ESR2 polymorphisms in the BIG 1-98 trial comparing adjuvant letrozole versus tamoxifen or their sequence for early breast cancer.

    Science.gov (United States)

    Leyland-Jones, Brian; Gray, Kathryn P; Abramovitz, Mark; Bouzyk, Mark; Young, Brandon; Long, Bradley; Kammler, Roswitha; Dell'Orto, Patrizia; Biasi, Maria Olivia; Thürlimann, Beat; Harvey, Vernon; Neven, Patrick; Arnould, Laurent; Maibach, Rudolf; Price, Karen N; Coates, Alan S; Goldhirsch, Aron; Gelber, Richard D; Pagani, Olivia; Viale, Giuseppe; Rae, James M; Regan, Meredith M

    2015-12-01

    Estrogen receptor 1 (ESR1) and ESR2 gene polymorphisms have been associated with endocrine-mediated physiological mechanisms, and inconsistently with breast cancer risk and outcomes, bone mineral density changes, and hot flushes/night sweats. DNA was isolated and genotyped for six ESR1 and two ESR2 single-nucleotide polymorphisms (SNPs) from tumor specimens from 3691 postmenopausal women with hormone receptor-positive breast cancer enrolled in the BIG 1-98 trial to receive tamoxifen and/or letrozole for 5 years. Associations with recurrence and adverse events (AEs) were assessed using Cox proportional hazards models. 3401 samples were successfully genotyped for five SNPs. ESR1 rs9340799(XbaI) (T>C) variants CC or TC were associated with reduced breast cancer risk (HR = 0.82,95% CI = 0.67-1.0), and ESR1 rs2077647 (T>C) variants CC or TC was associated with reduced distant recurrence risk (HR = 0.69, 95% CI = 0.53-0.90), both regardless of the treatments. No differential treatment effects (letrozole vs. tamoxifen) were observed for the association of outcome with any of the SNPs. Letrozole-treated patients with rs2077647 (T>C) variants CC and TC had a reduced risk of bone AE (HR = 0.75, 95% CI = 0.58-0.98, P interaction = 0.08), whereas patients with rs4986938 (G>A) genotype variants AA and AG had an increased risk of bone AE (HR = 1.37, 95% CI = 1.01-1.84, P interaction = 0.07). We observed that (1) rare ESR1 homozygous polymorphisms were associated with lower recurrence, and (2) ESR1 and ESR2 SNPs were associated with bone AEs in letrozole-treated patients. Genes that are involved in estrogen signaling and synthesis have the potential to affect both breast cancer recurrence and side effects, suggesting that individual treatment strategies can incorporate not only oncogenic drivers but also SNPs related to estrogen activity.

  13. Simultaneous quantification of alleles E198A and H6Y in the β-tubulin gene conferring benzimidazole resistance in Monilinia fructicola using a duplex real-time (TaqMan) PCR.

    Science.gov (United States)

    Fan, Jinyan; Luo, Yong; Michailides, Themis J; Guo, Liyun

    2014-02-01

    The benzimidazole fungicide thiophanate-methyl is commonly used for the control of brown rot of stone fruits. Low and high levels of resistance to this fungicide have been found in field isolates of the causal pathogen Monilinia fructicola. The minor groove binding (MGB) TaqMan probes specific for alleles E198A and H6Y conferring the high and low levels of resistance in the β-tubulin gene of M. fructicola were designed. A duplex real-time PCR assay based on these probes was developed for simultaneous quantification of both mutations in a pathogen population. The specificity tests for the primers and probes were conducted using different fungal species of stone and pome fruit pathogens. Similar results were obtained between the duplex real-time (TaqMan) PCR assay and the conventional method to quantify the frequencies of alleles E198A and H6Y of eight samples from different peach orchards. The MGB TaqMan probe based duplex real-time PCR provides a useful tool for simultaneous quantification of both alleles, E198A and H6Y, conferring high and low resistance, and has a potential in monitoring the benzimidazole-resistance in M. fructicola populations in stone and pome fruit orchards. © 2013 Society of Chemical Industry.

  14. Effect of Some External Crosswise Stiffeners on the Heat Transfer and Pressure Distribution on a Flat Plate at Mach Numbers of 0.77, 1.39, and 1.98. Coord. No. AF-AM-69

    Science.gov (United States)

    Carter, Howard S.

    1957-01-01

    The heat transfer and pressures on the surfaces of several flat-plate models with various external crosswise stiffener arrangements are presented. The tests were made in a free jet at Mach numbers of 0.77, 1.39, and 1.98 for Reynolds numbers of 3 x 10(exp 6), 7 x 10(exp 6), and 14 x 10(exp 6), respectively, based on a length of 1 foot. The addition of external crosswise stiffeners to the flat-plate models caused large pressure and heat-transfer variations on the surfaces of the models.

  15. Validation of absolute axial neutron flux distribution calculations with MCNP with 197Au(n,γ)198Au reaction rate distribution measurements at the JSI TRIGA Mark II reactor.

    Science.gov (United States)

    Radulović, Vladimir; Štancar, Žiga; Snoj, Luka; Trkov, Andrej

    2014-02-01

    The calculation of axial neutron flux distributions with the MCNP code at the JSI TRIGA Mark II reactor has been validated with experimental measurements of the (197)Au(n,γ)(198)Au reaction rate. The calculated absolute reaction rate values, scaled according to the reactor power and corrected for the flux redistribution effect, are in good agreement with the experimental results. The effect of different cross-section libraries on the calculations has been investigated and shown to be minor. Copyright © 2013 Elsevier Ltd. All rights reserved.

  16. Features of the structural and magnetic properties of Pb(TixZr1–xO3-NiFe1.98Co0.02O4 in the polarized state

    Directory of Open Access Journals (Sweden)

    Baev Vadim

    2017-06-01

    Full Text Available Composites with a 90%Pb(TixZr1-xO3-10%NiFe1.98Co0.02O4 composition have been synthesized. It has been established that the polarization of samples resulting from exposure to an electric field for 1 hour of 4 kV/mm in strength at a temperature of 400 K leads to crystal structure deformation. The compression of elementary crystal cells in some areas during polarization of the sample creates conditions suitable for the enhancement of magnetic exchange interactions. It has been found that the polarization process of such compositions leads to increases in specific magnetization and magnetic susceptibility. The analysis of Mössbauer spectra has shown that the polarization of the 90%Pb(TixZr1-xO3-10%NiFe1.98Co0.02O4 composite leads to significant changes in the effective magnetic fields of iron subspectra in various positions.

  17. Effect of fluorine and cerium substitutions on the properties of the Tl{sub 2}Ba{sub 2}CaCu{sub 1.98}Fe{sub 0.02}O{sub 8} superconductor

    Energy Technology Data Exchange (ETDEWEB)

    Akimov, A.I. [Institute of Solid State and Semiconductor Physics, National Academy of Sciences of Belarus P, Brovki 19, Minsk 220072 (Belarus); Ksenofontov, V. [Institute of Solid State and Semiconductor Physics, National Academy of Sciences of Belarus P, Brovki 19, Minsk 220072 (Belarus); Lebedev, S.A. [Johannes Gutenberg-Universitaet, Staudinger Weg 9, D-55099 Mainz (Germany)]. E-mail: lebedev@ifttp.bas-net.by; Tkachenka, T.M. [Institute of Solid State and Semiconductor Physics, National Academy of Sciences of Belarus P, Brovki 19, Minsk 220072 (Belarus)

    2006-09-01

    Fluorine and cerium substituted Tl-2212 high-T {sub c} superconductors were produced. X-ray diffraction, Mossbauer effect method, temperature measuring of the resistances and a.c. susceptibilities for all Tl{sub 2}Ba{sub 2}Ca{sub 1-y}Ce {sub y}Cu{sub 1.98}Fe{sub 0.02}O{sub 8-x/2}F {sub x} (0 {<=} x {<=} 0.2 and 0 {<=} y {<=} 0.1) were applied. It was found that the cerium admixture does not affect significantly the Tl-2212 superconductor properties. Fluorine admixture alone appreciably affects the value of superconducting transition temperature. The biggest increase in T {sub c} is 10 K and is realised for x = 0.10-0.20. Substituting admixtures are not clearly exhibited in Mossbauer parameters, i.e. do not influence Fe-O bonding tangibly.

  18. SIMS U-Pb, Sm-Nd isotope and geochemical study of an arkosite-amphibolite suite, Peräpohja Schist Belt: evidence for ca. 1.98 Ga A-type felsic magmatism in northern Finland

    Directory of Open Access Journals (Sweden)

    Eero Hanski

    2005-01-01

    Full Text Available In the northern and north-eastern part of the Peräpohja Schist Belt, northern Finland, an extensive supracrustal rock unit has been identified which is composed of alternating amphibolitic and arkositic components. The amphibolites form layers whose thickness varies from one millimeter to some tens of meters, being most often a few tens of centimeters. They represent mafic tuff beds deposited concurrently with more abundant arkositic rocks. Most of the arkosites have a modal and major and trace element compositionsimilar to that of A2-type granites. For example, they exhibit high LREE/HREE, negative Eu anomalies, and flat HREE and are moderately enriched in Nb, Zr, and Y. The genesis of the arkosites is enigmatic as they show features supporting either a volcaniclastic or an epiclastic origin. In the latter case, they were derived via erosion of a source dominated by A2-type granitic rocks. Previous conventional ID-TIMS and new SIMS U-Pb dating of zircons from two arkosite samples and one mica schist sample, all three picked from the northern part of the schist belt, indicate that these rocks contain a single population of zircons with an age of ca. 1975 Ma suggesting that they are among the youngest supracrustal rocks in the schist belt. In contrast, one mica schist sample from the western part of the belt revealed only the presence of Archean zircons. The samples do not differ markedly in terms of their Nd isotopecomposition as they all have a moderately negative εNd(1900 Ma. Regardless of the genesis of the arkosites, their isotopic and geochemical data suggest a previously unknown occurrence of extensive A-type felsic magmatism at ca. 1.98 Ga, contemporaneously withsome continental flood basalts. However, concrete evidence for this felsic A-type magmatism in the form of ca. 1.98 Ga felsic plutonic rocks is virtually absent in the presently exposed Fennoscandian Shield.

  19. Publications | Page 198 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  20. 21 CFR 558.198 - Diclazuril.

    Science.gov (United States)

    2010-04-01

    ... million (ppm)) Broiler chickens: For the prevention of coccidiosis caused by Eimeria tenella, E. necatrix... Indications for use Limitations Sponsor (i) 0.91 (1 ppm) Growing turkeys: For the prevention of coccidiosis...

  1. Reference: 198 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ols pollen tube growth by regulating apical F-actin dynamics. This paper shows that ROP1 activates two counter...namics in eukaryotic cells. A Rho family GTPase controls actin dynamics and tip growth via two counteracting

  2. 198 EAST AFRICAN MEDICAL JOURNAL Apr!

    African Journals Online (AJOL)

    Addis Ababa. Ethiopia. CONTROL OF SCHISTOSOMA MANSON] BY THE SOAPBERRY ENDOD (PH YTOLACCA ... Objectives: To record the effect of Endod soap and spraying of soaked Endod suspension on the prevalence of human ..... deliver the soap powder. On the other hand. spraying approach involved only two.

  3. Publications | Page 198 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books ... Multi-faceted approach to promote knowledge translation platforms in eastern Mediterranean countries: climate for evidence-informed policy (open access). Objectives: ...

  4. Soviet Succession 198?; Continuity or Change.

    Science.gov (United States)

    1981-06-01

    within the society would be to overlook considerable linkages with other signifi- cant constituencies. The military, as Roman Kolkowicz states, is perhaps...1968. Trofimenko , Henry, "The ’Theology’ of Strategy," Orbis, Fall 1977. U.S. Army Institute for Advanced Russian and East European Studies, The

  5. Basic residues in the 74-83 and 191-198 segments of protein kinase CK2 catalytic subunit are implicated in negative but not in positive regulation by the beta-subunit

    DEFF Research Database (Denmark)

    Sarno, S; Vaglio, P; Marin, O

    1997-01-01

    by the beta-subunit many fold more than that of alpha wild type, while extrastimulation by beta mutant D55L56E57A, observable with alpha wild type, is abolished with these mutants. These data support the conclusion that down regulation by the acidic residues clustered in the N-terminal moiety of beta......Protein kinase CK2 is a ubiquitous pleiotropic serine/threonine protein kinase whose holoenzyme is comprised of two catalytic (alpha and/or alpha') and two non-catalytic, beta-subunits. The beta-subunit possesses antagonist functions that can be physically dissected by generating synthetic...... fragments encompassing its N-terminal and C-terminal domains. Here we show that by mutating basic residues in the 74-77 and in the 191-198 regions of the alpha-subunit, the negative regulation by the beta-subunit and by its N-terminal synthetic fragment CK2beta-(1-77), which is observable using calmodulin...

  6. A compact sup 3 H(p,gamma) sup 4 He 19.8 MeV gamma-ray source for energy calibration at the Sudbury Neutrino Observatory

    CERN Document Server

    Poon, A W P; Waltham, C E; Browne, M C; Robertson, R G H; Kherani, N P; Mak, H B

    2000-01-01

    The Sudbury Neutrino Observatory (SNO) is a new 1000-t D sub 2 O Cherenkov solar neutrino detector. A high-energy gamma-ray source is needed to calibrate SNO beyond the sup 8 B solar neutrino endpoint of 15 MeV. This paper describes the design and construction of a source that generates 19.8 MeV gamma rays using the sup 3 H(p,gamma) sup 4 He reaction (''pT''), and demonstrates that the source meets all the physical, operational and lifetime requirements for calibrating SNO. An ion source was built into this unit to generate and to accelerate protons up to 30 keV, and a high-purity scandium tritide target with a scandium-tritium atomic ratio of 1 : 2.0+-0.2 was included. This pT source is the first self-contained, compact, and portable high-energy gamma-ray source (E subgamma>10 MeV). (authors)

  7. Progress in biological threat agent vaccine development: a repeat-dose toxicity study of a recombinant ricin toxin A-chain (rRTA) 1-33/44-198 vaccine (RVEc) in male and female New Zealand white rabbits.

    Science.gov (United States)

    McLain, Daniel E; Horn, Thomas L; Detrisac, Carol J; Lindsey, Changhong Y; Smith, Leonard A

    2011-03-01

    A recombinant ricin toxin A-chain 1-33/44-198 vaccine (RVEc) was administered to male and female New Zealand white (NZW) rabbits (10/sex/group) in a repeat-dose toxicity study. The RVEc vaccine was administered on study days 1, 29, 57, and 85 via intramuscular (IM) injection (0, 100, or 200 μg/dose). All study animals were observed throughout treatment until euthanized and submitted for necropsy on study day 88 or 99 (recovery period). There were no treatment-related or toxicologically significant effects observed. There were no statistically significant differences noted in the antibody titers and/or concentrations in 100 μg RVEc-treated animals when compared to 200 μg RVEc-treated animals, suggesting that both doses produced comparable antibody titers/concentrations during the study. The highest immune response was observed on study day 99 (ie, 2 weeks after the last dose). The immune response observed demonstrated that RVEc is biologically active in the rabbit model, with no apparent marked sex differences.

  8. LÓPEZ VALERO, A.; ENCABO FERNÁNDEZ, E. Y JEREZ MARTÍNEZ, I. (2017: Didáctica de la lengua y la literatura en ESO, innovación e investigación. Madrid: Síntesis, 198 páginas, ISBN 978-84-9077-453-3

    Directory of Open Access Journals (Sweden)

    Aurora Martínez-Ezquerro

    2017-05-01

    Full Text Available LÓPEZ VALERO, A.; ENCABO FERNÁNDEZ, E. Y JEREZ MARTÍNEZ, I. (2017: Didáctica de la lengua y la literatura en ESO, innovación e investigación. Madrid: Síntesis, 198 páginas, ISBN 978-84-9077-453-3

  9. Assessment of letrozole and tamoxifen alone and in sequence for postmenopausal women with steroid hormone receptor-positive breast cancer: the BIG 1-98 randomised clinical trial at 8·1 years median follow-up.

    Science.gov (United States)

    Regan, Meredith M; Neven, Patrick; Giobbie-Hurder, Anita; Goldhirsch, Aron; Ejlertsen, Bent; Mauriac, Louis; Forbes, John F; Smith, Ian; Láng, István; Wardley, Andrew; Rabaglio, Manuela; Price, Karen N; Gelber, Richard D; Coates, Alan S; Thürlimann, Beat

    2011-11-01

    Postmenopausal women with hormone receptor-positive early breast cancer have persistent, long-term risk of breast-cancer recurrence and death. Therefore, trials assessing endocrine therapies for this patient population need extended follow-up. We present an update of efficacy outcomes in the Breast International Group (BIG) 1-98 study at 8·1 years median follow-up. BIG 1-98 is a randomised, phase 3, double-blind trial of postmenopausal women with hormone receptor-positive early breast cancer that compares 5 years of tamoxifen or letrozole monotherapy, or sequential treatment with 2 years of one of these drugs followed by 3 years of the other. Randomisation was done with permuted blocks, and stratified according to the two-arm or four-arm randomisation option, participating institution, and chemotherapy use. Patients, investigators, data managers, and medical reviewers were masked. The primary efficacy endpoint was disease-free survival (events were invasive breast cancer relapse, second primaries [contralateral breast and non-breast], or death without previous cancer event). Secondary endpoints were overall survival, distant recurrence-free interval (DRFI), and breast cancer-free interval (BCFI). The monotherapy comparison included patients randomly assigned to tamoxifen or letrozole for 5 years. In 2005, after a significant disease-free survival benefit was reported for letrozole as compared with tamoxifen, a protocol amendment facilitated the crossover to letrozole of patients who were still receiving tamoxifen alone; Cox models and Kaplan-Meier estimates with inverse probability of censoring weighting (IPCW) are used to account for selective crossover to letrozole of patients (n=619) in the tamoxifen arm. Comparison of sequential treatments to letrozole monotherapy included patients enrolled and randomly assigned to letrozole for 5 years, letrozole for 2 years followed by tamoxifen for 3 years, or tamoxifen for 2 years followed by letrozole for 3 years

  10. Evaluating Letrozole and Tamoxifen Alone and in Sequence for Postmenopausal Women with Steroid Hormone Receptor-Positive Breast Cancer: the BIG 1-98 Randomized Clinical Trial at 8.1 years Median Follow-Up

    Science.gov (United States)

    Regan, Meredith M.; Neven, Patrick; Giobbie-Hurder, Anita; Goldhirsch, Aron; Ejlertsen, Bent; Mauriac, Louis; Forbes, John F.; Smith, Ian; Láng, István; Wardley, Andrew; Rabaglio, Manuela; Price, Karen N.; Gelber, Richard D.; Coates, Alan S.; Thürlimann, Beat

    2011-01-01

    Background Postmenopausal women with hormone receptor-positive early breast cancer have persistent, long-term risk of breast cancer recurrence and death. Therefore, trials evaluating endocrine therapies for this patient population require extended follow-up. We present an update of efficacy outcomes in the Breast International Group (BIG) 1-98 study at 8.1 years median follow-up. Methods BIG 1-98 is a randomized, phase III, double-blind trial of 8010 postmenopausal women with hormone receptor-positive early breast cancer that compares five years of tamoxifen or letrozole monotherapy or sequential treatment with two years of one of these agents followed by three years of the other. The primary efficacy endpoint is disease-free survival (DFS: events comprise invasive breast cancer relapse, second primaries [contralateral breast and non-breast], or death without prior cancer event), and secondary endpoints are overall survival (OS), distant recurrence-free interval (DRFI) and breast cancer-free interval (BCFI). The monotherapy comparison includes patients randomized to tamoxifen × 5 years (n=2459) or letrozole × 5 years (n=2463). In 2005, after significant DFS benefit was reported for letrozole as compared with tamoxifen, a protocol amendment facilitated the crossover to letrozole of patients who were still receiving tamoxifen alone; Cox models and Kaplan-Meier estimates with inverse probability of censoring weighting (IPCW) are used to account for selective crossover to letrozole of 619 patients in the tamoxifen arm. The comparison of sequential treatments to letrozole monotherapy includes patients enrolled in the four-arm option of the trial and randomized to letrozole × 5 years (n=1546), letrozole × 2 years followed by tamoxifen × 3 years (n=1540), or tamoxifen × 2 years followed by letrozole × 3 years (n=1548). All patients have completed study treatment; follow up is continuing for those enrolled in the four-arm option. BIG 1-98 is registered at

  11. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  12. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  13. HER2 status predicts for upfront AI benefit: A TRANS-AIOG meta-analysis of 12,129 patients from ATAC, BIG 1-98 and TEAM with centrally determined HER2.

    Science.gov (United States)

    Bartlett, John M S; Ahmed, Ikhlaaq; Regan, Meredith M; Sestak, Ivana; Mallon, Elizabeth A; Dell'Orto, Patrizia; Thürlimann, Beat; Seynaeve, Caroline; Putter, Hein; Van de Velde, Cornelis J H; Brookes, Cassandra L; Forbes, John F; Viale, Giuseppe; Cuzick, Jack; Dowsett, Mitchell; Rea, Daniel W

    2017-07-01

    A meta-analysis of the effects of HER2 status, specifically within the first 2-3 years of adjuvant endocrine therapy, has the potential to inform patient selection for upfront aromatase inhibitor (AI) therapy or switching strategy tamoxifen followed by AI. The pre-existing standardisation of methodology for HER2 (immunohistochemistry/fluorescence in situ hybridization) facilitates analysis of existing data for this key marker. Following a prospectively designed statistical analysis plan, patient data from 3 phase III trials Arimidex, Tamoxifen, Alone or in Combination Trial (ATAC), Breast International Group (BIG) 1-98 and Tamoxifen Exemestane Adjuvant Multicentre Trial (TEAM)] comparing an AI to tamoxifen during the first 2-3 years of adjuvant endocrine treatment were collected and a treatment-by-marker analysis of distant recurrence-free interval-censored at 2-3 years treatment - for HER2 status × AI versus tamoxifen treatment was performed to address the clinical question relating to efficacy of 'upfront' versus 'switch' strategies for AIs. A prospectively planned, patient-level data meta-analysis across 3 trials demonstrated a significant treatment (AI versus tamoxifen) by marker (HER2) interaction in a multivariate analysis; (interaction hazard ratio [HR] = 1.61, 95% CI 1.01-2.57; p HER2 negative (HER2-ve) group gained greater benefit from AI versus tamoxifen (HR = 0.70, 95% CI 0.56-0.87) than the HER2-positive (HER2+ve) group (HR = 1.13, 95% CI 0.75-1.71). However, the small number of HER2+ve cases (n = 1092 across the 3 trials) and distant recurrences (n = 111) may explain heterogeneity between trials. A patient-level data meta-analysis demonstrated a significant interaction between HER2 status and treatment with AI versus tamoxifen in the first 2-3 years of adjuvant endocrine therapy. Patients with HER2-ve cancers experienced improved outcomes (distant relapse) when treated with upfront AI rather than tamoxifen, whilst patients with HER2+ve

  14. Spin-isospin strength distributions in [ital f]-[ital p] shell nuclei: A study of the [sup 51]V([ital n],[ital p]) and [sup 59]Co([ital n],[ital p]) reactions at 198 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Alford, W.P.; Brown, B.A.; Burzynski, S.; Celler, A.; Frekers, D.; Helmer, R.; Henderson, R.; Jackson, K.P.; Lee, K.; Rahav, A.; Trudel, A.; Vetterli, M.C. (University of Western Ontario, London, Ontario, N6A 3K7 (Canada) Department of Physcis and Astronomy, Michigan State University, East Lansing, Michigan 48824 (United States) Simon Fraser University, Burnaby, British Columbia, V5A 1S6 (Canada) TRIUMF, 4004 Wesbrook Mall, Vancouver, British Columbia, V6T 2A3 (Canada) University of Melbourne, Parkville, Victoria, Australia 3052 (Australia) Tel Aviv University, 69978 Ramat Aviv (Israel))

    1993-12-01

    The ([ital n],[ital p]) reaction has been studied on the nuclei [sup 51]V and [sup 59]Co at an energy of 198 MeV. Spectra were measured at laboratory angles of 0[degree], 4[degree], 8[degree], 12[degree], 16[degree], and 20[degree] up to an excitation energy of 35 MeV in the final nuclei [sup 51]Ti and [sup 59]Fe. A multipole analysis of the data up to 30 MeV was carried out to identify Gamow-Teller ([Delta][ital L]=0,[Delta][ital J][sup [pi

  15. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  16. 38 CFR 21.198 - “Discontinued” status.

    Science.gov (United States)

    2010-07-01

    ...) VOCATIONAL REHABILITATION AND EDUCATION Vocational Rehabilitation and Employment Under 38 U.S.C. Chapter 31... proposed discontinuance action. The Vocational Rehabilitation and Employment (VR&E) Officer shall review... rated 50 percent or more disabling. The VR&E Officer may utilize exisitng resources to assist in the...

  17. 37 CFR 1.98 - Content of information disclosure statement.

    Science.gov (United States)

    2010-07-01

    ... information, of each patent, publication, or other information listed that is not in the English language. The... copy of the translation if a written English-language translation of a non-English-language document... statement. (2) A legible copy of: (i) Each foreign patent; (ii) Each publication or that portion which...

  18. Southern Forests: a Journal of Forest Science - Vol 198 (2003)

    African Journals Online (AJOL)

    Reverting urban exotic pine forests to Macchia and indigenous forest vegetation, using cable-yarders on the slopes of Table Mountain, South Africa: management paper · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Pierre Ackerman, Bruce Talbot, 35-44 ...

  19. 198 A Critical Analysis of Dramaturgy and Theatricality in Okwe ...

    African Journals Online (AJOL)

    RESOURCE CENTRE

    essential tool a writer uses to convey his message to the readers or audience. In order words, it is the writer's primary means of expression. It is observed that Okwe Agbaala is written in Igbo language, but due to the nature of the work, the playwright mainly used “Igbonization” which is the spelling of English words in Igbo.

  20. All projects related to | Page 198 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results. Displaying 1971 - 1980 of 6834. Measuring Entrepreneurial Activity in Egypt and Tunisia. Project. This project ... Region: North of Sahara, South of Sahara, Tunisia, Egypt. Program: Employment and Growth ... RIMISP: Core Support for Rural Development Research Phase 2. Project. Territorial inequalities persist in ...

  1. 1935 15' Quad #198 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  2. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  3. Statistical Abstract of Higher Education in North Carolina, 1997-98. Research Report 1-98.

    Science.gov (United States)

    Balfour, Linda F., Comp.

    This report presents comprehensive data on higher education activities in North Carolina in 84 tables and 17 graphs. Data were compiled from forms completed by the individual institutions in the summer and fall of 1997. Data are usually presented separately for individual institutions by institution type--public institutions, private institutions,…

  4. SU-F-T-198: Dosimetric Comparison of Carbon and Proton Radiotherapy for Recurrent Nasopharynx Carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Sheng, Y; Zhao, J; Wang, W; Lin, L; Liu, X; Shahnazi, K [Shanghai Proton and Heavy Ion Center, Shanghai (China)

    2016-06-15

    Purpose: Various radiotherapy planning methods for locally recurrent nasopharynx carcinoma (R-NPC) have been proposed. The purpose of this study was to compare carbon and proton therapy for the treatment of R-NPC in terms of dose coverage for target volume and sparing for organs at risk (OARs). Methods: Six patients who were suffering from R-NPC and treated using carbon therapy were selected for this study. Treatment plans with a total dose of 57.5Gy (RBE) in 23 fractions were made using SIEMENS Syngo V11. An intensity-modulated radiotherapy optimization method was chosen for carbon plans (IMCT) while for proton plans both intensity-modulated radiotherapy (IMPT) and single beam optimization (proton-SBO) methods were chosen. Dose distributions, dose volume parameters, and selected dosimetric indices for target volumes and OARs were compared for all treatment plans. Results: All plans provided comparable PTV coverage. The volume covered by 95% of the prescribed dose was comparable for all three plans. The average values were 96.11%, 96.24% and 96.11% for IMCT, IMPT, and proton-SBO respectively. A significant reduction of the 80% and 50% dose volumes were observed for the IMCT plans compared to the IMPT and proton-SBO plans. Critical organs lateral to the target such as brain stem and spinal cord were better spared by IMPT than by proton-SBO, while IMCT spared those organs best. For organs in the beam path, such as parotid glands, the mean dose results were similar for all three plans. Conclusion: Carbon plans yielded better dose conformity than proton plans. They provided similar or better target coverage while significantly lowering the dose for normal tissues. Dose sparing for critical organs in IMPT plans was better than proton-SBO, however, IMPT is known to be more sensitive to range uncertainties. For proton plans it is essential to find a balance between the two optimization methods.

  5. Yeast Interacting Proteins Database: YGL161C, YGL198W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGL161C YIP5 Protein that interacts with Rab GTPases, localized to late Golgi vesicles; computational...that interacts with Rab GTPases, localized to late Golgi vesicles; computational ...eracts with Rab GTPases, localized to late Golgi vesicles; computational analysis of large-scale protein-pro...ized to late Golgi vesicles; computational analysis of large-scale protein-protein interaction data suggests

  6. Yeast Interacting Proteins Database: YDR084C, YGL198W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available with Rab GTPases, localized to late Golgi vesicles; computational analysis of lar...gene name YIP4 Prey description Protein that interacts with Rab GTPases, localized to late Golgi vesicles; computational

  7. Yeast Interacting Proteins Database: YPL095C, YGL198W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available d to late Golgi vesicles; computational analysis of large-scale protein-protein interaction data suggests a ...gene name YIP4 Prey description Protein that interacts with Rab GTPases, localized to late Golgi vesicles; computational

  8. 198 "Viviendas dinámicas sin deuda" en Valdivia, X Región, Chile

    Directory of Open Access Journals (Sweden)

    Bonet Miró, Ana

    2007-06-01

    Full Text Available The purpose of the competition as well as the project developed in response to the social, constructive and climate specific conditions of Valdivia, X Region, Chile, is the design and construction of experimental social housing, whose cost, including land and services, would not exceed 7,500 $ per unit. The housing units should be designed in order to grow and to be adapted by owners and should allow for achieving higher urban density as average so to reduce the burden of costs derived from land acquisition and services. The project adopts a three-storey compact typology such as a “big house”, with 2 units on ground floor and 4 duplex on upper floors. The local wood construction tradition and the good level of acceptance of it within the context of Valdivia, bring us to develop a mixed construction system, concrete and wood, which not only is suitable to the geotechnical and seismic conditions of the ground, but also to the economical restrictions and to the requirements of spatial flexibility so necessary when designing a minimal housing unit.El objetivo del concurso y del proyecto desarrollado posteriormente, adaptado a los condicionantes sociales, constructivos y climatológicos de Valdivia, X Región, Chile, es el diseño y construcción de unas viviendas sociales experimentales, cuyo coste, incluida la repercusión del suelo no exceda de 7.500 $ por unidad. Dichas viviendas tienen que ser aptas para su crecimiento y adaptación posterior y lograr una mayor densidad que las habitualmente conseguidas en estos programas con el fin de abaratar los costos derivados de la compra del terreno. Se adopta una tipología compacta de “casa grande”, de tres alturas, con 2 viviendas en planta baja y 4 dúplex en las plantas superiores. La tradición constructiva local en madera y la buena aceptación que la misma tiene en el contexto de Valdivia han llevado a proponer un sistema mixto, hormigón y madera que no sólo responde bien a los condicionantes geotécnicos y sísmicos del solar y a las limitaciones económicas sino también a la flexibilidad espacial necesaria en un proyecto de vivienda mínima.

  9. Home Language Survey Data Quality Self-Assessment. REL 2017-198

    Science.gov (United States)

    Henry, Susan F.; Mello, Dan; Avery, Maria-Paz; Parker, Caroline; Stafford, Erin

    2017-01-01

    Most state departments of education across the United States recommend or require that districts use a home language survey as the first step in a multistep process of identifying students who qualify for English learner student services. School districts typically administer the home language survey to parents and guardians during a student's…

  10. Page 1 198 R Srinivasan and M L Munjal Then, following Munjal ...

    Indian Academy of Sciences (India)

    {F} comes only from the surface Si at the inlet of the muffler assuming constant velocity source and contribution to the damping matrix {D} comes from the only surface Sz at the outlet of the muffler (see figure 1). 3. Muffler performance using FEM. Higher order modes or 3-D effects are generally limited to expansion chambers ...

  11. Ce que nous faisons | Page 198 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    action d'Affaires mondiales Canada et d'autres ministères et organismes du gouvernement .... Ce projet appuiera l'engagement de l'Initiative de recherche concertée sur l'adaptation en Afrique et en Asie (IRCAAA) envers la formation continue et ...

  12. 198. Extubación inmediata tras cirugía de aorta ascendente

    Directory of Open Access Journals (Sweden)

    J.A. Arnaldo

    2010-01-01

    Conclusiones: La extubación inmediata en pacientes sometidos a cirugía de aorta ascendente es viable y segura, incluso en pacientes intervenidos con parada cardiocirculatoria. La necesidad de reintubación es rara, y está relacionada con el sangrado. Facilita la deambulación precoz y disminuye el tiempo de estancia en UCI.

  13. International Spread of an Epidemic Population of Salmonella enterica Serotype Kentucky ST198 Resistant to Ciprofloxacin

    National Research Council Canada - National Science Library

    Simon Le Hello; Rene S. Hendriksen; Benoît Doublet; Ian Fisher; Eva Møller Nielsen; Jean M. Whichard; Brahim Bouchrif; Kayode Fashae; Sophie A. Granier; Nathalie Jourdan-Da Silva; Axel Cloeckaert; E. John Threlfall; Frederick J. Angulo; Frank M. Aarestrup; John Wain; François-Xavier Weill

    2011-01-01

    National Salmonella surveillance systems from France, England and Wales, Denmark, and the United States identified the recent emergence of multidrug-resistant isolates of Salmonella enterica serotype...

  14. FCJ-198 New International Information Order (NIIO Revisited: Global Algorithmic Governance and Neocolonialism

    Directory of Open Access Journals (Sweden)

    Danny Butt

    2016-03-01

    Full Text Available The field of Internet governance has been dominated by Euro-American actors and has largely resisted consideration of a holistic and integrative rights-based agenda, confining itself to narrow discussions on the technical stability of Internet Protocol resources and debates about nation-state involvement in multistakeholder governance of those resources. In light of the work of Edward Snowden documenting the close relationship between government security agencies and dominant social media platforms, this paper revisits the relevance of the New International Information Order (NIIO, a conceptualisation of the global politics of information described at the 1973 Fourth Summit Conference of the Non-Aligned Movement of nations in Algiers. This paper argues that critical analysis of the oligopolistic structure of “platforms” and their algorithmic forms of governance can build a more inclusive movement toward social justice by extending the NIIO framework’s emphasis on decolonisation, collective ownership of strategic information resources, and documentation of powerful transnational entities.

  15. : tous les projets | Page 198 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    End Date: 19 mars 2015. Sujet: NUTRITION, Disease control, RESEARCH, CHILDREN, TELEVISION, FOOD CONSUMPTION, PERU. Région: Peru, South America, North and Central America. Programme: Alimentation, environnement et santé. Financement total : CA$ 215,000.00. Examen des liens entre la télévision et les ...

  16. Ce que nous faisons | Page 198 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI finance des études de recherche dans les pays en voie de développement en vue de produire un changement durable à grande échelle. Pour que le savoir devienne un outil permettant de résoudre des problèmes urgents :

  17. Monolithic High Strength Aluminum Bottom Carriage Structure for 155mm Howitzer, XM198

    Science.gov (United States)

    1974-05-01

    values calculated from the above equation is shown on sheet 26. 35 o,, N O LO V) N C1 V’ CO 0 t- 0 -1- CD V mD N f CD tD - a, N1 t- Nl CD V - M vO q CD C... 0LY ’ 1/- V0 (5 y V.. PM1 os 10 Dl*I0 0sA -TO PM w n s C! 5 T~ U U W Figur 5 #432 98oVE rhNl,; LINE. - -~ .3%R ,g-A ,iwv >qP4’ BY D j ~~ )P 2

  18. Leonurine (SCM-198) improves cardiac recovery in rat during chronic infarction.

    Science.gov (United States)

    Liu, XinHua; Pan, LiLong; Gong, QiHai; Zhu, YiZhun

    2010-12-15

    Leonurine, an alkaloid typically found in Herba leonuri, is known to have both antioxidant and cardioprotective properties. In the present study, we investigated the cardioprotective mechanism of leonurine the in vivo rat model of chronic myocardial ischemia and in vitro H9c2 cardiac myocyte model of oxidative stress. Myocardial ischemia was induced by ligating the left anterior descending coronary artery. Rats were divided into sham, myocardial ischemia+saline, and myocardial ischemia+leonurine (15 mg/kg/day). Cardiac function was recorded by catheterization. Apoptosis-related factor vascular endothelial growth factor (VEGF), survivin, Bcl-2 and Bax and pro-survival signaling pathways Akt, hypoxia inducible factor (HIF)-1α were measured by Western blotting or RT-PCR. Our results showed leonurine significantly improved myocardial function as evidenced by the decreased left ventricle end-diastolic pressure and the increased +dP/dt. Interestingly, leonurine increased the phosphorylation of Akt, the protein and gene expression of Bcl-2, but it reduced the protein and gene expression of Bax in vivo. Meanwhile leonurine significantly increased Akt phosphorylation in a concentration-dependent manner in H9c2 cardiac myocyte induced by oxidative stress in vitro, which was abolished by a phosphoinositide 3-kinase (PI3K) inhibitor, LY294002. Furthermore, leonurine not only increased the expression of HIF-1α but also the expression of survivin and VEGF. The results of present study demonstrated, for the first time that leonurine has potent anti-apoptotic effects after chronic myocardial ischemia mediated by activating the PI3K/Akt signaling pathway. Angiogenic mechanisms may be partially responsible for such an effect, which needs to be studied further. Copyright © 2010 Elsevier B.V. All rights reserved.

  19. Leonurine (SCM-198) attenuates myocardial fibrotic response via inhibition of NADPH oxidase 4.

    Science.gov (United States)

    Liu, Xin-Hua; Pan, Li-Long; Deng, Hai-Yan; Xiong, Qing-Hui; Wu, Dan; Huang, Guo-Ying; Gong, Qi-Hai; Zhu, Yi-Zhun

    2013-01-01

    In our previous studies, we have reported that leonurine, a plant phenolic alkaloid in Herba leonuri, exerted cardioprotective properties in a number of preclinical experiments. Herein, we investigated the roles and the possible mechanisms of leonurine for reducing fibrotic responses in angiotensin II (Ang II)-stimulated primary neonatal rat cardiac fibroblasts and post-myocardial infarction (MI) rats. In in vitro experiments performed in neonatal rat cardiac fibroblasts, leonurine (10-20 μM) pretreatment attenuated Ang II-induced activation of extracellular signal-regulated kinase 1/2, production of intracellular reactive oxygen species (ROS), expression and activity of matrix metalloproteinase (MMP)-2/9, and expression of α-smooth muscle actin and types I and III collagen. A small interfering RNA-mediated knockdown strategy for NADPH oxidase 4 (Nox4) revealed that Nox4 was required for Ang II-induced activation of cardiac fibroblasts. In vivo studies using a post-MI model in rats indicated that administration of leonurine inhibited myocardial fibrosis while reducing cardiac Nox4 expression, ROS production, NF-κB activation, and plasma MMP-2 activity. In conclusion, our results provide the first evidence that leonurine could prevent cardiac fibrosis and the activation of cardiac fibroblasts partly through modulation of a Nox4-ROS pathway. Copyright © 2012 Elsevier Inc. All rights reserved.

  20. International Spread of an Epidemic Population of Salmonella enterica Serotype Kentucky ST198 Resistant to Ciprofloxacin

    DEFF Research Database (Denmark)

    Le Hello, Simon; Hendriksen, Rene S.; Doublet, Benoit

    2011-01-01

    National Salmonella surveillance systems from France, England and Wales, Denmark, and the United States identified the recent emergence of multidrug-resistant isolates of Salmonella enterica serotype Kentucky displaying high-level resistance to ciprofloxacin. A total of 489 human cases were...... be implemented by national and international authorities to limit the spread of this strain....

  1. α decay of the very neutron-deficient isotopes 197-199Fr

    Science.gov (United States)

    Kalaninová, Z.; Andreyev, A. N.; Antalic, S.; Heßberger, F. P.; Ackermann, D.; Andel, B.; Drummond, M. C.; Hofmann, S.; Huyse, M.; Kindler, B.; Lane, J. F. W.; Liberati, V.; Lommel, B.; Page, R. D.; Rapisarda, E.; Sandhu, K.; Šáro, Š.; Thornthwaite, A.; Van Duppen, P.

    2013-04-01

    Decay properties of the very neutron-deficient isotopes 197-199Fr were studied at the velocity filter Separator for Heavy Ion reaction Products (SHIP) at GSI in Darmstadt. The isotopes were produced in the 2n-4n evaporation channels of the fusion-evaporation reaction 60Ni+141Pr → 201Fr*. Improved α-decay properties of 199Fr were determined and the possible existence of two α-decaying states in this nucleus is discussed. For the isotope 198Fr a broad α-decay energy distribution was detected in the range of (7470-7930) keV and two α-decaying states were observed with half-lives of 1.1(7) and 15(3) ms. The new isotope 197Fr was identified based on the observation of one α-decay chain yielding Eα=7728(15) keV and T1/2=0.6-0.3+3.0 ms. The systematics of reduced α-decay widths are presented for neutron-deficient francium, radon, and astatine isotopes.

  2. 198 Contribution à l'étude de la salinisation de la nappe côtière de ...

    African Journals Online (AJOL)

    MB Pro

    Foum El Oued (Laayoune) au Maroc ... Maroc.Elle circule dans des formations calcaires fissurées du Cénomanien et dans des formations détritiques du Plioquaternaire. Ces derniers favorisent le transit des ..... La corrélation des différents éléments chimiques avec la conductivité donne une idée précise sur les couples en.

  3. Disruption of the Putative Vascular Leak Peptide Sequence in the Stabilized Ricin Vaccine Candidate RTA1-33/44-198

    Science.gov (United States)

    2013-01-29

    U.S. Navy, the U.S. Department of Defense, or the NIH. References 1. Audi , J.; Belson, M.; Patel, M.; Schier, J.; Osterloh, J. Ricin poisoning: A...Clin. 2005, 21, 815–824. Toxins 2013, 5 247 4. Marsden, C.J.; Smith, D.C.; Roberts , L.M.; Lord, J.M. Ricin: Current understanding and prospects

  4. 198 Contribution à l'étude de la salinisation de la nappe côtière de ...

    African Journals Online (AJOL)

    MB Pro

    2008). [10] - A. LALLEMEND-BARRES and J. C. ROUX,“ Guide méthodologique d'établissement des périmètres de protection des captages d'eau souterraine destinée à la consommation humaine”, Ed. BRGM,. Paris(1989). [11] - N. CHABOUR ...

  5. The global establishment of a highly-fluoroquinolone resistant Salmonella enterica serotype Kentucky ST198 strain

    DEFF Research Database (Denmark)

    Le Hello, Simon; Bekhit, Amany; Granier, Sophie A.

    2013-01-01

    While the spread of Salmonella enterica serotype Kentucky resistant to ciprofloxacin across Africa and the Middle-East has been described recently, the presence of this strain in humans, food, various animal species (livestock, pets, and wildlife) and in environment is suspected in other countrie...

  6. Relative Effectiveness of Letrozole Compared With Tamoxifen for Patients With Lobular Carcinoma in the BIG 1-98 Trial

    DEFF Research Database (Denmark)

    Metzger Filho, Otto; Giobbie-Hurder, Anita; Mallon, Elizabeth

    2015-01-01

    PURPOSE: To evaluate the relative effectiveness of letrozole compared with tamoxifen for patients with invasive ductal or lobular carcinoma. PATIENTS AND METHODS: Patients diagnosed with early-stage invasive ductal carcinoma (IDC) or classic invasive lobular carcinoma (ILC) who were randomly assi...

  7. 198 AAAAI Survey on Immunotherapy Practice Patterns Concerning Dosing, Dose-Adjustment after Missed Doses and Duration of Immunotherapy

    Science.gov (United States)

    Linnemann, Désirée Larenas; Gupta, Payel; Mithani, Sima; Ponda, Punita

    2012-01-01

    Background Several practical issues dealing with the exact application of allergen immunotherapy (AIT) among European and US allergists are not well known. Guidelines on AIT give recommendations and suggestions for only some of them. We present this unique survey with worldwide response. Methods The AAAAI immunotherapy committee conducted a web-based practice patterns survey (program: Survey Monkey) among all members in&outside US on dosing, dose-adjustment after missed doses and duration of AIT. Results 1201 Returned questionnaires (almost 25% response rate). 21% were non-US-Canada members. Maintenance doses in USCan are (mean/median): Dermatophagoides farinae (Df) combined with Dermatophagoides pteronyssinus (Dpt): 2155/1000AU; Df solo 2484/1000AU. Dpt when combined with Df 1937/1000AU; Dpt solo: 2183/1000AU.Cat 3224/2000BAU. Grass 11,410/4000BAU. 57-65% of the dosing falls within the recommended Practice Parameters recommended ranges. Non-USCan allergists expressed maintenance doses in many different units making analysis impossible. Dose-adjustment after missed doses is based on ‘time elapsed since the last applied dose’ by 77% of USCan and 58% of non-USCan allergists and on ‘time since missed scheduled dose’ by the rest. Doses are adjusted when a patient comes in more than 14 d/5 wk after the last administration at build-up/maintenance by both USCan and non-USCan colleagues. The mostly followed dose-adjustment schedules after 1, 2, 3 missed doses are: Build-up: repeat last dose, reduce by one dose, reduce by 2 doses; maintenance: reduce by one dose, reduce by 2 doses, reduce by 3 doses. 26% uses a different approach reducing doses by a certain percentage or volume. AIT is restarted after a gap in build-up of >30 days and of >12 weeks during maintenance in both groups (median). Outside USCan AIT is prescribed for 3 years (Median). However, 75% of USCan allergists prescribes AIT for 5 years. Main reasons why to continue AIT beyond 5 years: ‘symptoms came back after stopping’ or “patient afraid to relapse.” Conclusions These results show regional differences on some points (especially AIT duration) and they suggest in which direction to plan further research in 2 areas to establish universal dose-adjustment plans for missed applications and define the usefulness (or lack of) of long-term AIT. Moreover, there is still room for improvement in the way AIT is dosed.

  8. Comparative genomics of the dairy isolate Streptococcus macedonicus ACA-DC 198 against related members of the Streptococcus bovis/Streptococcus equinus complex.

    OpenAIRE

    Papadimitriou, Konstantinos; Anastasiou, Rania; Mavrogonatou, Eleni; Blom, Jochen; Papandreou, Nikos; Hamodrakas, Stavros; Ferreira, Stéphanie; Renault, Pierre; Supply, Philip; Pot, Bruno; Tsakalidou, Effie

    2014-01-01

    International audience; BACKGROUND: Within the genus Streptococcus, only Streptococcus thermophilus is used as a starter culture in food fermentations. Streptococcus macedonicus though, which belongs to the Streptococcus bovis/Streptococcus equinus complex (SBSEC), is also frequently isolated from fermented foods mainly of dairy origin. Members of the SBSEC have been implicated in human endocarditis and colon cancer. Here we compare the genome sequence of the dairy isolate S. macedonicus ACA-...

  9. Health hazard evaluation report HETA 84-198-1560, Division of Public Health Laboratories, State of Ohio, Columbus, Ohio. [Ethylene oxide and organic-solvent vapors

    Energy Technology Data Exchange (ETDEWEB)

    Behrens, V.; Burroughs, G.E.

    1985-02-01

    Breathing-zone and environmental samples were analyzed for ethylene oxide and organic-solvent vapors at the Public Health Laboratory, State of Ohio, Columbus, Ohio, on March 26 and 27, 1984. The evaluation was requested because of employee complaints of mucous membrane and skin irritation while they poured gonorrhea culture media into petri dishes that had been sterilized with ethylene oxide. The authors conclude that the environmental cause of the health problems cannot be determined due to the lack of symptoms on the days of the survey. Without taking measurements on the exact day when conspicuous symptoms occur, it is difficult to determine the source of the problem. General recommendations include checking the general air circulation in the media laboratory and encouraging employees to wear gloves that protect hands and wrists while pouring culture media.

  10. Acontece que chove ... em vista de um fim. Aristóteles, Phys. II 8, 198b16-199a8

    Directory of Open Access Journals (Sweden)

    Barbara Botter

    2010-06-01

    Full Text Available Aristotle’s defense of natural teleology in Physica II 8, and in particular the aporia he raises in this context with regard to the proper explanation of rainfall and the coming to be of animal parts are among the most disputed passages in the whole Aristotelian Corpus. In my account , I will first offer a general outline of the passage and indicate the problems involved. Then, I will offer my solutions to them.

  11. Analyses adjusting for selective crossover show improved overall survival with adjuvant letrozole compared with tamoxifen in the BIG 1-98 study

    DEFF Research Database (Denmark)

    Colleoni, Marco; Giobbie-Hurder, Anita; Regan, Meredith M

    2011-01-01

    Among postmenopausal women with endocrine-responsive breast cancer, the aromatase inhibitor letrozole, when compared with tamoxifen, has been shown to significantly improve disease-free survival (DFS) and time to distant recurrence (TDR). We investigated whether letrozole monotherapy prolonged...

  12. The AFGL Four Color Infrared Sky Survey: Catalog of Observations at 4. 2, 11.0, 19.8 and 27.4 micrometers

    Science.gov (United States)

    1976-09-17

    Cld n N *0 -, f N n n *- Clr- N- N,6NOlbf6I Cl-ftn 6606ft CV al l ft CO"ln~ lO cc a 0 2. 2402 a Z am -20 iS- arN ftUO 000; a~ mr fts 2 10a 4N2 hi hiQ -0...Z ma UQ.~ft %.# v ftt 0 M. cc 0 uM 2CA " cmu cf ADN LJ w tuWm00wOw 0m Ul, C VIVaI’ 0 LeO u D 4 O x r 1fl 0 x D0 inv)Lainc- in 3 in 2 a x0 X 06.~~C U

  13. Duhamel, Jérémie (2016. Les Vertus de la liberté. Machiavel et la critique de la domination. Paris, Francia: Classiques Garnier. 198 pp.

    Directory of Open Access Journals (Sweden)

    Diego Vernazza

    2017-06-01

    Full Text Available Los golpes de la historia parecieran, en los últimos tiempos, endurecerse. O es quizá la manera insistente que tienen de amontonarse, uno tras otro, la que los vuelve más agudos. Entretanto, hay respiros, y preguntas. Sobre cómo actuar políticamente en este contexto, sobre cómo sostener la apuesta por la igualdad democrática en un mundo que frente al caos se debate entre la restauración y el conformismo.En eso y mucho más pensé al leer el libro de Jérémie Duhamel, Les vertus de la liberté. Machiavel et la critique de la domination, publicado recientemente en París, en Classiques Garnier. No pretendo dar aquí una lectura exhaustiva de la obra, tampoco proponer un ejercicio crítico. Intento, simplemente, articular una breve reflexión, lateral, aunque comprometida, sobre aquello que el Maquiavelo de Jérémie Duhamel puede aportarnos para pensar (en la situación actual...

  14. SU-E-T-198: Hippocampal-Sparing Radiotherapy (HSRT) for Patients with Head and Neck Cancer (HNC) Using Intensity-Modulated Radiation Therapy (IMRT)

    Energy Technology Data Exchange (ETDEWEB)

    Dunlop, A; Welsh, L; Nutting, C; Harrington, K; Bhide, S; Newbold, K

    2014-06-01

    Purpose: There is increasing evidence that decline in cognitive function following brain radiotherapy (RT) is related to the radiation dose delivered to the hippocampi. In this work we evaluate the feasibility of using IMRT to generate HSRT plans in HNC. Methods: A planning study was undertaken for ten representative patients with HNC previously treated with radical (chemo)-RT using standard IMRT techniques. The hippocampi were delineated according to the RTOG hippocampal contouring atlas, on a T1w- MRI scan that was registered with the RT planning CT. LINAC-based, clinically acceptable, HSRT plans were generated and assessed using the Pinnacle3 treatment planning system. Results: Using a VMAT technique, a reduction in hippocampal dose was achievable in six cases. For these cases, the EQD2-D40% of the bilateral hippocampi was significantly reduced by HSRT (p = 0.006) from a median of 18.8Gy (range 14.4–34.6) to 6.5 Gy (4.2–9.5) for the delivered and HSRT plans respectively. Plans were also generated using a fixed-field IMRT technique with non-coplanar beams that were designed to avoid the bilateral hippocampi, resulting in a median EQD2-D40% of 11.2Gy (8.0–14.5). Both HSRT techniques also resulted in lower doses to the whole brain, brain stem, and cerebellum. The HSRT plans resulted in higher doses to some regions of non-contoured normaltissue, but the magnitude of these dose differences is unlikely to be of clinical significance in terms of acute and late toxicity. Conclusion: This study has demonstrated that it is possible, in many cases, to adapt treatment plans for HNC to significantly reduce dose to the hippocampi. This reduction in dose would be predicted to Resultin a significant reduction in the probability of subsequent decline in cognitive function following RT. Our results point towards the need for the collection of prospective data on cognitive outcomes for the HNC patient population treated with radical (chemo)-RT.

  15. Performance Characteristics of Automotive Engines in the United States : Second Series - Report No. 6 - 1976 Nissan Diesel 198 CID (3.2 Liters), F.I.

    Science.gov (United States)

    1978-05-01

    Experimental data were obtained in dynamometer tests of a 1976 Nissan diesel engine, Model SD-33 CN6-33, to determine fuel consumption and emissions (hydrocarbon, carbon monoxide, oxides of nitrogen) at steady-state engine-operating modes. The object...

  16. 4-Guanidino-n-butyl syringate (Leonurine, SCM 198) protects H9c2 rat ventricular cells from hypoxia-induced apoptosis.

    Science.gov (United States)

    Liu, Xin-hua; Chen, Pei-fang; Pan, Li-long; Silva, Ranil De; Zhu, Yi-zhun

    2009-11-01

    In the present study, we examined the ability of a chemically synthesized compound based on the structure of leonurine, a phytochemical component of Herba leonuri, to protect H9c2 rat ventricular cells from apoptosis induced by hypoxia and serum deprivation, as a model of ischemia. The results revealed a concentration-dependent increase in cell viability associated with leonurine treatment, accompanied by a consistent decline in lactate dehydrogenase leakage into the culture medium. The fraction of annexin V-fluorescein isothiocyanate-positive cells was increased by hypoxia but reduced by leonurine. These changes were associated with increased expression of the antiapoptotic gene, Bcl-2, and reduced expression of the proapoptotic gene, Bax. Leonurine also reduced the cytosolic Ca overload induced by hypoxia. These results suggest that leonurine elicits potent cardioprotective effects in H9c2 cells, and these effects may be mediated by inhibition of intracellular Ca overload and apoptosis during hypoxia.

  17. Characterization of metabolites of leonurine (SCM-198) in rats after oral administration by liquid chromatography/tandem mass spectrometry and NMR spectrometry.

    Science.gov (United States)

    Zhu, Qing; Zhang, Jinlian; Yang, Ping; Tan, Bo; Liu, Xinhua; Zheng, Yuanting; Cai, Weimin; Zhu, Yizhun

    2014-01-01

    Leonurine, a major bioactive component from Herba Leonuri, shows therapeutic potential for cardiovascular disease and stroke prevention in some preclinical experiments. The aim of this study is to characterize metabolites of leonurine in rats using high performance liquid chromatography coupled with tandem mass spectrometry (HPLC/MS/MS). The chromatographic separation was performed on an Agilent ZORBAX SB-C18 column using a gradient elution with acetonitrile/ammonium acetate buffer (10 mM, pH 4.0) solvent system. An information dependent acquisition (IDA) method was developed for screening and identifying metabolites of leonurine under positive ion mode. Compared with control, the interesting compound in the extracted ion chromatogram (XIC) of the in vivo samples was chosen and further identified by analyzing their retention times, changes in observed mass (Δm/z), and spectral patterns of product ion utilizing advanced software tool. For the first time, a total of three metabolites were identified, including two phase II metabolites generated by glucuronidation (M1) and sulfation (M2) and one phase I metabolite formed by O-demethylation (M3). Finally, the lead metabolite M1 was isolated from urine and its structure was characterized as leonurine-10-O- β-D-glucuronide by NMR spectroscopy (¹H, ¹³C, HMBC, and HSQC).

  18. Treatment Adherence and Its Impact on Disease-Free Survival in the Breast International Group 1-98 Trial of Tamoxifen and Letrozole, Alone and in Sequence

    DEFF Research Database (Denmark)

    Chirgwin, Jacquie H; Giobbie-Hurder, Anita; Coates, Alan S

    2016-01-01

    -positive early breast cancer in the four-arm option to 5 years of tamoxifen (Tam), letrozole (Let), or the agents in sequence (Let-Tam, Tam-Let). This analysis included 6,144 women who received at least one dose of study treatment. Conditional landmark analyses and marginal structural Cox proportional hazards...

  19. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  20. δ37Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.

  1. δ³⁷Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine

  2. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  3. Effective height development of four co-occurring species in the gap-phase regeneration of Douglas fir monocultures under nature-oriented conversion. Forest Ecology and Management, Pages 189-198

    NARCIS (Netherlands)

    Dekker, M.; Breugel, van M.; Sterck, F.J.

    2007-01-01

    Natural regeneration in gaps in Douglas fir forest stands in the Netherlands mainly consists of Betula pendula (Roth.), Pinus sylvestris (L.), Larix kaempferi (Carr.), and Pseudotsuga menziesii (Mirb. Franco). Even though these species are well known, the autogenic development of these species in an

  4. Thermosalinograph Data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT189-198 during 2007 (NODC Accession 0048896)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  5. Addition of Work Rate and Temperature Information to the Augmented NMRI Standard (ANS) Data Files in the NMR198 Subset of the USN N2-O2 Primary Data Set

    Science.gov (United States)

    2011-01-01

    conducted (personal communication, Keith Gault; 2 May 2006). These dives appeared to be excluded from analysis in the reports because of deviation from the...named EDU545SURWET.dat. Weightlifting work was performed on the bottom, details of which are given in the section on data set EDU545 on page 12...192 (EDU545sur data file dive profile 54). Our interpretation is that the investigator decided to remove 192c from analysis for NEDU TR 5-45 and do a

  6. Niskin Bottle Data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT189-198 during 2007 (NCEI Accession 0048660)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  7. CTD Data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT189-198 during 2007 (NCEI Accession 0048725)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  8. Land cover and forest formation distributions for St. Kitts, Nevis, St. Eustatius, Grenada and Barbados from decision tree classification of cloud-cleared satellite imagery. Caribbean Journal of Science. 44(2):175-198.

    Science.gov (United States)

    E.H. Helmer; T.A. Kennaway; D.H. Pedreros; M.L. Clark; H. Marcano-Vega; L.L. Tieszen; S.R. Schill; C.M.S. Carrington

    2008-01-01

    Satellite image-based mapping of tropical forests is vital to conservation planning. Standard methods for automated image classification, however, limit classification detail in complex tropical landscapes. In this study, we test an approach to Landsat image interpretation on four islands of the Lesser Antilles, including Grenada and St. Kitts, Nevis and St. Eustatius...

  9. Perfil antropométrico e risco cardiovascular de idosos institucionalizados na cidade de Pelotas
    doi: 10.12662/2317-3076jhbs.v3i4.198.p195-201.2015

    OpenAIRE

    Francine Silva dos Santos; Gicele Costa Mintem

    2015-01-01

    Introdução: Devido ao aumento da população idosa, é necessário verificar as características dos indivíduos nesta faixa etária, incluindo os institucionalizados, por sua maior vulnerabilidade aos distúrbios nutricionais. Objetivo: Identificar o perfil antropométrico e o risco cardiovascular de idosos institucionalizados. Métodos: Realizou-se o estudo em três Instituições de Longa Permanência, com indivíduos de 60 anos, ou mais, residentes em tempo integral nos locais participantes. Foram aferi...

  10. Assessment of letrozole and tamoxifen alone and in sequence for postmenopausal women with steroid hormone receptor-positive breast cancer: the BIG 1-98 randomised clinical trial at 8·1 years median follow-up

    DEFF Research Database (Denmark)

    Regan, Meredith M; Neven, Patrick; Giobbie-Hurder, Anita

    2011-01-01

    Postmenopausal women with hormone receptor-positive early breast cancer have persistent, long-term risk of breast-cancer recurrence and death. Therefore, trials assessing endocrine therapies for this patient population need extended follow-up. We present an update of efficacy outcomes in the Brea...

  11. Who, What and How? Commentary on Cheney, F. N. (1963) the Teaching of Reference in American Library Schools. (Journal of Education for Librarianship, 3(3), 188-198)

    Science.gov (United States)

    Smith, Linda C.

    2015-01-01

    Cheney's paper was the first major article on the subject of teaching reference in American library schools. In the article, she addressed three questions: (1) Who is teaching reference?; (2) What is being taught?; and (3) How is it being taught? In this article, Linda Smith discusses how the teaching of reference has changed in the more than 50…

  12. Amplification of the discharge current density of lithium-ion batteries with spinel phase Li(PtAu)0.02Mn1.98O4 nano-materials

    CSIR Research Space (South Africa)

    Ross, N

    2014-05-01

    Full Text Available capacity retention of 99% after 50 cycles. Faster charge transportation at high current rates proved to prevent the pronounced pile-up of Li(sup+) ions and undesired Mn(sup3+) ions on the surfaces. The electrochemical impedance spectroscopy (EIS) results...

  13. ORF Alignment: NC_002936 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available PLYRQKYTLVTSRAVADMATLAELTLPFCAVGGRVVAPKKGDIEEEMDR 198 ... ISQRAEDAAQNPLYRQKYTLVTSRAVADMATLAELTLPFCAVGGRVVAPKKGDIEEEMDR... Sbjct: 121 ISQRAEDAAQNPLYRQKYTLVTSRAVADMATLAELTLPFCAVGGRVVAPKKGDIEEEMDR 180 ...

  14. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  15. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  16. Production cross section of At radionuclides from 7Li+natPb and 9Be+natTl reactions

    Science.gov (United States)

    Maiti, Moumita; Lahiri, Susanta

    2011-12-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from 6,7Li- and 9Be-induced reactions on natural lead and thallium targets, respectively. The production of astatine radionuclides were investigated experimentally with two heavy-ion-induced reactions: 9Be + natTl and 7Li + natPb. Formation cross sections of the evaporation residues, 207,208,209,210At, produced in the (HI,xn) channel, were measured by the stacked-foil technique followed by off-line γ spectrometry at low incident energies (<50 MeV). Measured excitation functions were interpreted in terms of a compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach models. Measured cross-section values are lower than the respective theoretical predictions.

  17. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Koziorowski, J

    1998-10-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on {sup 211}At and {sup 124}I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[{sup 211}At]astato-2`-deoxyuridine (AUdR) and N-succinimidyl-4-[{sup 211}At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [{sup 124}I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[{sup 124}I]iodo-2`-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for

  18. Synthesis, characterization and comparison of Li{sub 1,05}M{sub 0,02}Mn{sub 1,98}O{sub 4} (M = Al{sup 3+} or + Ga{sup 3+}) obtained by calcination in muffle and microwave; Sintese, caracterizacao e comparacao dos Li{sub 1,05}Mn{sub 1,98}M{sub 0,02}O{sub 4} (M= Al{sup 3+} ou GA{sup 3+}) obtidos por calcinacao em mufla e microondas

    Energy Technology Data Exchange (ETDEWEB)

    Santana, L.K.; Canobre, S.C.; Amaral, F.A., E-mail: fabioamaral@yahoo.com.br [Universidade Federal de Uberlandia (UFU), MG (Brazil). Instituto de Quimica. Laboratorio de Armazenamento de Energia e Tratamento de Efluentes

    2014-07-01

    Due to the economic and environmental importance of using LiMn{sub 2}O{sub 4} as cathode batteries, the goal of this work was to synthesize LiMn{sub 2}O{sub 4} doped and undoped, comparing methods of calcination kiln and microwave. The precursors were obtained by Pechini method. The resulting samples were structurally characterized by XRD, morphology by SEM and area by B.E.T. XRD results were compared to card JCPDS 35-0782 regarding the pure LiMn{sub 2}O{sub 4}. The DRX results indicate that the calcination furnace was more efficient for obtaining doped oxides. However, the use of microwave was effective for rapid attainment of non-doped spinel close to those found for the pure spinel structural features. The surface area values confirm the existence of clusters and particles with nanometric features. Oxides synthesized in both procedures showed small, organized and highly crystalline particles, demonstrating the efficiency of the methodology and Pechini methods of calcination compared. (author)

  19. Didáctica Geográfica nº 17-2016. ISSN: 0210-492-X 277 SCOFFHAM, S. (EDITOR (2013 Teaching Geography Creatively. Learning to teach in the Primary School series. 198 pp. ISBN: 978-0-415-50819-3

    Directory of Open Access Journals (Sweden)

    ADELA TORRES MARTÍNEZ

    2016-12-01

    Full Text Available  El libro Teaching Geography Creatively, editado por Stephen Scoffham, supone una fuente de recursos y orientaciones didácticas fundamentadas en investigaciones recientes de gran interés para aquellos docentes de Infantil y Primaria que hayan decidido apostar por la creatividad en sus aulas. Estas orientaciones no solo buscan la motivación del alumnado sino que, en la línea del constructivismo, defienden la necesidad de fomentar un pensamiento crítico en ellos para construir aprendizajes con sentido y conectados realmente con su mundo. Se pretende así acabar con la idea que asocia la enseñanza de la geografía con el aprendizaje memorístico y pasivo, dentro de cuatro paredes. Tal y como hacen otros títulos de la serie en la que se integra, Learning to Teach in the Primary School, esta monografía defiende también una comunicación bidireccional en la transmisión del conocimiento (alumno-profesor, alumno-alumno y un currículo flexible que permita un aprendizaje creativo, donde el centro de atención sea el proceso de enseñanza-aprendizaje y no los resultados. 

  20. El controvertido desarrollo del deporte durante la transición democrática española (1975-1982. una aproximación a sus limitaciones y principales condicionantes = The controversial development of sport during the spanish democratic transition (1975-198

    Directory of Open Access Journals (Sweden)

    Sixte Abadía i Naudí

    2013-03-01

    Full Text Available Tras un periodo como el de la dictadura franquista (1939-1975, en el cual la actuación gubernamental en relación al fenómeno deportivo había sido, como mínimo, controvertida, la transición democrática (1975-1982 estableció un nuevo marco de actuación de los poderes públicos que posibilitaría, conjuntamente con la acción de los movimientos asociativos, la definitiva emergencia de un proceso de generalización del deporte entre la ciudadanía. Este desarrollo del deporte se contagió de la coyuntura social, política y económica característica de la transición democrática. De este modo, su evolución puede explicarse tanto a partir de los avances, acuerdos e iniciativas fruto de las políticas deportivas implementadas, como por la falta de consenso, críticas y limitaciones que constataron los movimientos asociativos y los medios de comunicación, y que explican una expansión no lineal del deporte español durante este periodo.--------------------------------------------------------------------------------After the period of Franco’s dictatorship (1939-1975, during which government action in relation to sports was to say controversial at least, democratic transition (1975-1982 established a new framework for the public authorities which allowed, in collaboration with the action of associations, the final appearance of a process of bringing sports to the masses. The development of sports was conditioned by the social, political and economical situation characteristic of the democratic transition. Thus, its evolution can be explained from the result of the sports policies implemented and from the lack of consensus, criticism and limitations found by associations and the media, and which explain a nonlinear and difficult sports development during this period.

  1. Young People and the Aesthetics of Health Promotion: Beyond Reason, Rationality and Risk Montero Kerry and Kelly Peter Young People and the Aesthetics of Health Promotion: Beyond Reason, Rationality and Risk 198pp £95 Routledge 9781138898059 1138898058 [Formula: see text].

    Science.gov (United States)

    2016-10-07

    Describing the experiences of a group of young people in Australia, this book presents different innovative perspectives on health promotion. It emphasises social theory, and offers an in-depth exploration of risk, rationality and reasoning.

  2. Assédio moral: o caso dos funcionários terceirizados de manutenção da Universidade Federal de Uberlândia http://dx.doi.org/10.15601/1983-7631/rt.v8n15p184-198

    Directory of Open Access Journals (Sweden)

    Filipe Fagundes

    2015-12-01

    Full Text Available Com um ambiente de trabalho cheio de pressão, a violência entre os trabalhadores vê seu desenvolvimento em resultados crescentes. O assédio moral, forma mais sutil de violência no trabalho, toma forma, ocasionando diversos danos ao indivíduo e à organização. O objetivo deste trabalho foi realizar um estudo sobre a presença do assédio moral no trabalho dos funcionários terceirizados, responsáveis pela limpeza e manutenção da Universidade Federal de Uberlândia, buscando descobrir a ocorrência desses assédios de acordo com o gênero, para verificar possíveis relações. A coleta dos dados foi realizada por meio de um questionário, aplicado com 40 funcionários. Foi possível verificar que mais de 50% dos funcionários questionados sofrem assédio moral em algum grau, sendo a maioria do sexo feminino. Em relação aos agentes agressores, verificou-se que os alunos eram os principais agressores, tendo atitudes de indiferença, humilhação pública e até violência. Já os outros agressores identificados foram os supervisores e os professores. Há a necessidade de educar todos dentro da instituição no sentido do conhecimento do que é o assédio moral, investigar os problemas e intensificar a divulgação de normas e valores sociais que regem as boas maneiras. Palavras-chave: assédio moral; saúde do trabalhador; gestão de recursos humanos.

  3. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...

  4. ORF Alignment: NC_004663 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TSGRLGVLD 60 ... Query: 139 SGTTPYVIGAMRTAREHGILTGCITSNPNSPMATEADVPIEVIVGPEYVTGSSRMKSGTA 198 ... SGTTPYV...IGAMRTAREHGILTGCITSNPNSPMATEADVPIEVIVGPEYVTGSSRMKSGTA Sbjct: 121 SGTTPYVIGAMRTAREHGILTGCITSNPNSPMATEADVPIEVIVGPEYVTGSSRMKSGTA 180 ...

  5. ORF Alignment: NC_000919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available AVCELKKGRVEFRADKTGVVHLAVGKTTMDSAQIVENVDVFLSEMDRKKPV 198 ... GTVSADLGAAVCELKKGRVEFRADKTGVVHLAVGKTTMDSAQIVENVDVFLSEMDR...KKPV Sbjct: 121 GTVSADLGAAVCELKKGRVEFRADKTGVVHLAVGKTTMDSAQIVENVDVFLSEMDRKKPV 180 ...

  6. Gclust Server: 122321 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences Related Sequences(17) 198 Tripartite ATP-independent periplasmic transporter, DctQ component 1 1.00e-99...198 Representative annotation Tripartite ATP-independent periplasmic transporter, DctQ component Number

  7. Un cas d’infection à Dracunculoidea en Polynésie française

    Czech Academy of Sciences Publication Activity Database

    Bercion, R.; Heaulme, M.; Viant, E.; Moravec, František; Bain, O.

    2010-01-01

    Roč. 70, č. 2 (2010), s. 198-198 ISSN 0025-682X Institutional research plan: CEZ:AV0Z60220518 Keywords : Dracunculoidea * acute arthritis * French Polynesia Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 198 of 198 ... Vol 15, No 1 (2015), Performance Evaluation of a Mobile Wireless Computational Grid ... Wireless Network Platforms to Support Emerging Applications. ... of Bingham University Library Management System, Abstract PDF.

  9. ORF Alignment: NC_006814 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GIEFTDAINSKNEMTS Sbjct: 14 ... TLAKFLASKNEEVLVIEKSNQMYGGTCINIACLPSKRLIIEAANGIEFTDAINSKNEMTS 73 ... Query: 139 IPGLIESNKVINSTEAM...DQTEMPKKLTIIGSGYIGLEFASMFANYGTKVTVLDNHRDFLP 198 ... IPGLIESNKVINSTEAMDQTEMPKKLTIIGSGYIGL...EFASMFANYGTKVTVLDNHRDFLP Sbjct: 134 IPGLIESNKVINSTEAMDQTEMPKKLTIIGSGYIGLEFASMFANY

  10. ORF Alignment: NC_006138 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available bjct: 1 ... PDLVIKNAKVVDVFNARVIQGDIAIVDGLIAGVGDYSCKNELDAEGQYAAPGFIDSHIHI 60 ... Query: 139 PATPFEHSGANIDAREMEKPIT...YDEVLGLGEFMDFPGVINGVDATIEKLLVAKRAGKPID 198 ... PATPFEHSGANIDAREMEKPITYDEVL...GLGEFMDFPGVINGVDATIEKLLVAKRAGKPID Sbjct: 121 PATPFEHSGANIDAREMEKPITYDEVLGLGEFMDFPGVINGVDATIEKLLVAKRAGKPID 18

  11. ORF Alignment: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available D100] ... Length = 198 ... Query: 22 ... RHFLVTAYKVPTGSMQPALKPGDFIFASRVSYGVQIPFASKRWNLTLPARGDIVVFSYPN 81 ... ... ... RHFLVTAYKVPTGSMQPALKPGDFIFASRVSYGVQIPFASKRWNLTLPARGDIVVFSYPN Sbjct: 1 ... ...RHFLVTAYKVPTGSMQPALKPGDFIFASRVSYGVQIPFASKRWNLTLPARGDIVVFSYPN 60 ... Query: 142 WRVIFQKTPDDKDFGPLVVPPGEVFLLGDNRD

  12. EST Table: CN378859 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available unit 1 [Semaeopus sp. illimitataDHJ02] 10/09/01 57 %/198 aa FBpp0100176|mt:CoI-PA 10/08/28 44 %/198 aa MTCE....CN378859 rzhswbb0_005540 10/09/28 63 %/198 aa gb|ADE49659.1| cytochrome oxidase sub

  13. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  14. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  15. Nuclear and in-source laser spectroscopy with the ISAC yield station

    Energy Technology Data Exchange (ETDEWEB)

    Kunz, Peter, E-mail: pkunz@triumf.ca; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning [TRIUMF, 4004 Wesbrook Mall, Vancouver, British Columbia V6T 2A3 (Canada); Andreoiu, Corina; Wong, Fiona [Department of Chemistry, Simon Fraser University, Burnaby, British Columbia V5A 1S6 (Canada)

    2014-05-15

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10{sup 11} ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of {sup 46}K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  16. Nuclear and in-source laser spectroscopy with the ISAC yield station.

    Science.gov (United States)

    Kunz, Peter; Andreoiu, Corina; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning; Wong, Fiona

    2014-05-01

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10(11) ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of (46)K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  17. Radiopharmaceutical chemistry of targeted radiotherapeutics, part 4: Strategies for211At labeling at high activities and radiation doses of211At α-particles.

    Science.gov (United States)

    Pozzi, Oscar R; Zalutsky, Michael R

    2017-03-01

    Alpha particles are radiation of high energy and short range, properties that can lead to radiolysis-mediated complications in labeling chemistry at the high radioactivity levels required for clinical application. In previous papers in this series, we have shown that radiation dose has a profound effect on the astatine species that are present in the labeling reaction and their suitability for the synthesis of N-succinimidyl 3-[ 211 At]astatobenzoate. The purpose of this study was to evaluate the effects of adding N-chlorosuccinimide (NCS) to the methanol solution used for initial isolation of 211 At after distillation, a process referred to as 211 At stabilization, on 211 At chemistry after exposure to high radiation doses. High performance liquid chromatography was used to evaluate the distribution of 211 At species present in methanol in the 500-65,000Gy radiation dose range and the synthesis of SAB from N-succinimidyl 3-(tri-n-butylstannyl)benzoate in the 500-120,000Gy radiation dose range using different 211 At timeactivity combinations under conditions with/without 211 At stabilization. In the absence of NCS stabilization, a reduced form of astatine, At(2), increased with increasing radiation dose, accounting for about half the total activity by about 15,000Gy, while with stabilization, At(2) accounted for 60,000Gy. SAB yields without stabilization rapidly declined with increasing dose, falling to ~20% at about 5000Gy while with stabilization, yields >80% were obtained with 211 At solutions stored for more than 23h and receiving radiation doses >100,000Gy. Adding NCS to the methanol solution used for initial isolation of 211 At is a promising strategy for countering the deleterious effects of radiolysis on 211 At chemistry. This strategy could facilitate the ability to perform 211 At labeling at sites remote from its production and at the high activity levels required for clinical applications. Copyright © 2016 Elsevier Inc. All rights reserved.

  18. Contrasting ion-association behaviour of Ta and Nb polyoxometalates.

    Science.gov (United States)

    Fullmer, Lauren B; Molina, Pedro I; Antonio, Mark R; Nyman, May

    2014-11-07

    Small-angle X-ray scattering (SAXS) studies of aqueous [Ta6O19](8-) compared to prior studies of aqueous [Nb6O19](8-) reveals key differences in behaviour, which is likely at the root of the difficultly in developing polyoxotantalate chemistry. Specifically, where contact ion-pairing dominates between [Nb6O19](8-) and its counterions, solvent-separated ion-pairing between [Ta6O19](8-) and its counterions has been unveiled in the current study.

  19. ORF Alignment: NC_003272 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available PCC 7120] ... Length = 146 ... Query: 198 KPPELVVNVTGLQYAWIFTYPESGITTGELHVPIG...REVQINMTANDVIHAFWVPEFRLKQ 257 ... KPPELVVNVTGLQYAWIFTYPESGITTGELHVPIGREVQINMTANDVIHAFWVPEFRLKQ Sbjct:... 1 ... KPPELVVNVTGLQYAWIFTYPESGITTGELHVPIGREVQINMTANDVIHAFWVPEFRLKQ 60 ... Query: 318 TLNQAVAVNPTDLTPDEFLAPYTKEM

  20. EST Table: CK561416 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK561416 rswpb0_003938.y1 10/09/29 88 %/198 aa ref|NP_001040385.1| pelota-like prot...ein [Bombyx mori] gb|ABF51295.1| pelota-like protein [Bombyx mori] 10/09/01 66 %/198 aa FBpp0169228|DmojGI20...1|gene:AGAP008269 10/09/10 64 %/198 aa gnl|Amel|GB10750-PA 10/09/10 63 %/198 aa gi|91095145|ref|XP_967126.1| PREDICTED: similar to pelota [Tribolium castaneum] FS917768 swp ...

  1. DMPD: A Toll-like receptor in horseshoe crabs. [Dynamic Macrophage Pathway CSML Database

    Lifescience Database Archive (English)

    Full Text Available mmunol Rev. 2004 Apr;198:106-15. (.png) (.svg) (.html) (.csml) Show A Toll-like receptor in horseshoe crabs....blication Immunol Rev. 2004 Apr;198:106-15. Pathway - PNG File (.png) SVG File (.svg) HTML File (.html

  2. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 198 of 198 ... Vol 9, No 4 (2017), Socio-ecological impacts of invasive alien cactus (Opuntia) in the rangelands of Narok County, Kenya, Abstract PDF. E.W. Githae .... Vol 8, No 2 (2016), Willingness to pay for captive wildlife tourism at the university of Ibadan Zoological Garden, Nigeria, Abstract PDF. B.O. Adetola ...

  3. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 198 of 198 ... Vol 17, No 1 (2017), Multi-Class load balancing scheme for QoS and energy conservation in cloud computing, Abstract PDF. Olasupo O. Ajayi, Florence A. Oladeji, Charles O. Uwadia. Vol 12, No 1 (2014), Multimodal Authentication Techniques For Staff Identification And Tracking, Abstract PDF.

  4. 76 FR 585 - In the Matter of Certain Handbags, Luggage, Accessories and Packaging Thereof; Notice of...

    Science.gov (United States)

    2011-01-05

    ... infringement of U.S. Trademark Registration No. 297,594 (``the `594 trademark''); U.S. Trademark Registration No. 1,643,625 (``the `625 trademark''); U.S. Trademark Registration No. 1,653,663 (``the `663 trademark''); U.S. Trademark Registration No. 1,875,198 (``the `198 trademark''); U.S. Trademark...

  5. Polynomial Iteration for Nonsymmetric Indefinite Linear Systems.

    Science.gov (United States)

    1985-03-01

    the Fourth IIMAS Workshop on Numerical Analysis held in Guanajuato , Mexico , July 1984. March4- 198 D 11MLLECT APR 29 198 CJC Abstract - We examine...eliminated from these estimates by exploiting the special structure of the dual. These economies leave unaltered the sequence of basic feasible

  6. Breeding potential of the basmati rice germplasm under water stress ...

    African Journals Online (AJOL)

    From Griffing analysis, genotypes CB-17, CB-32 and Basmati-198 were found to be good general combiners for productive tillers per plant, primary branches per panicle and yield per plant, especially under water stress condition. Also, maximum specific combining ability was found in Basmati-198 × CB-17 for productive ...

  7. Draft Genome Sequences of 64 Salmonella enterica subsp. enterica Enteritidis Isolates from Mice in US

    Science.gov (United States)

    A ciprofloxacin resistant (CipR) Salmonella enterica subsp. enterica serovar Kentucky ST198 has rapidly and extensively disseminated globally to become a major food-safety and public health concern. Here, we report a complete genome sequence of a CipR S. Kentucky ST198 strain PU131 isolated from a ...

  8. EST Table: FS848732 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS848732 E_FL_fner_33A19_F_0 10/09/28 39 %/198 aa ref|XP_971046.2| PREDICTED: similar to antolefin... %/152 aa gnl|Amel|GB16043-PA 10/09/10 39 %/198 aa gi|189240340|ref|XP_971046.2| PREDICTED: similar to antolefinin [Tribolium castaneum] FS921551 fner ...

  9. EST Table: FS918193 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS918193 E_FL_fufe_43J18_F_0 10/09/28 39 %/198 aa ref|XP_971046.2| PREDICTED: similar to antolefin... %/152 aa gnl|Amel|GB16043-PA 10/09/10 39 %/198 aa gi|189240340|ref|XP_971046.2| PREDICTED: similar to antolefinin [Tribolium castaneum] FS921551 fufe ...

  10. EST Table: FS867121 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS867121 E_FL_fner_33A19_R_0 10/09/28 39 %/198 aa ref|XP_971046.2| PREDICTED: similar to antolefin... %/152 aa gnl|Amel|GB16043-PA 10/09/10 39 %/198 aa gi|189240340|ref|XP_971046.2| PREDICTED: similar to antolefinin [Tribolium castaneum] FS752084 fner ...

  11. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 198 of 198 ... A Retrospective Analysis of 15 cases, Seen at the Pulmonology Unit of an Urban Tertiary Centre in Lagos, South West, Nigeria. Abstract. OO Adeyeye ... Vol 3, No 6 (2009), The Clinical Pattern and Complications of Severe Malaria in Parts of the Imo River Basin of Nigeria, Abstract. UM Chukwuocha ...

  12. Is parental age related to the risk of Alzheimer's disease

    NARCIS (Netherlands)

    C.M. van Duijn (Cornelia); W. Schulte (Wim); T.A. Tanja (Teun); R. Haaxma (Rob); A.J. Lameris; R.J. Saan; A. Hofman (Albert)

    1990-01-01

    textabstractAdvanced maternal and paternal age were investigated as putative risk factors for AD in 198 clinically diagnosed Alzheimer patients and in 198 randomly selected healthy controls. No significant differences in average age of fathers and of mothers at birth of the subject were observed.

  13. 30 CFR 250.1202 - Liquid hydrocarbon measurement.

    Science.gov (United States)

    2010-07-01

    ... Section 250.1202 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL... the API MPMS as incorporated by reference in 30 CFR 250.198, when obtaining net standard volume and... with the API MPMS as incorporated by reference in 30 CFR 250.198); (ii) The sample container is vapor...

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 198 of 198 ... Vol 2, No 2 (2004), Vulnerability, resilience and coping of communities and health systems in responding to infectious diseases in the context of war/conflict: Kandy, Sri Lanka, Abstract. S Bulbulia, F Alvarez-Castillo. Vol 2, No 1 (2004), WHO Communique on Violence and Health, Abstract. WHO.

  15. EST Table: CK490600 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 22(intracellular)|GO:0008270(zinc ion binding) 10/09/29 73 %/198 aa ref|XP_973800.1| PREDICTED: similar to crook...63-PA 10/09/10 73 %/198 aa gi|91089385|ref|XP_973800.1| PREDICTED: similar to crooked legs CG14938-PA [Tribolium castaneum] CK490600 swa ...

  16. Homeotic-like modification of stamens to petals is associated with ...

    Indian Academy of Sciences (India)

    RLM198. While Og1 displayed normal flower morphology comparable to that of its euplasmic B. juncea counterpart except for sterile anthers, Og2 retained homeotic-like floral modification of stamens to petal-like structures and several other floral deformities observed in the chlorotic (Ogu) B. juncea cv. RLM198 (or OgRLM).

  17. The Impact of Locus of Control on Language Achievement

    Science.gov (United States)

    Nodoushan, Mohammad Ali Salmani

    2012-01-01

    This study hypothesized that students' loci of control affected their language achievement. 198 (N = 198) EFL students took the Rotter's (1966) locus of control test and were classified as locus-internal (ni = 78), and locus-external (ne = 120). They then took their ordinary courses and at the end of the semester, they were given their exams.…

  18. A journey through the stylistics of poetry

    DEFF Research Database (Denmark)

    Jensen, Kim Ebensgaard

    2015-01-01

    Review of Peter Verdonk, The Stylistics of Poetry: Context, Cognition, Discourse, History. (Series: Advances in Stylistics). London: Bloomsbury, 2013, xi + 198 pp., ISBN 978-1-4411-5878-9.......Review of Peter Verdonk, The Stylistics of Poetry: Context, Cognition, Discourse, History. (Series: Advances in Stylistics). London: Bloomsbury, 2013, xi + 198 pp., ISBN 978-1-4411-5878-9....

  19. A critical analysis of the new equal pay provisions relating to atypical ...

    African Journals Online (AJOL)

    International labour law will also be referred to. Keywords: Equal pay; Labour Relations Act; equal pay for atypical employees; atypical employment; sections 198A-198D of the Labour Relations Act; Agency Workers Regulations 2010; Fixed-term Employees (Prevention of Less Favourable Treatment) Regulations 2002; ...

  20. Alpha particle emitters in medicine

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, D.R.

    1989-09-01

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ({sup 211}At) and natural bismuth-212 ({sup 212}Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ({sup 223}Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs.

  1. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Directory of Open Access Journals (Sweden)

    Sherif S Nafee

    Full Text Available Thallium (81(217Tl, Bismuth (83(217Bi, Astatine (85(217At, Francium (87(217Fr, Actinium (89(217Ac and Protactinium (91(217Pa are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221Fr-, (221Ac- and (221Pa-α-decays.

  2. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Science.gov (United States)

    Nafee, Sherif S; Shaheen, Salem A; Al-Ramady, Amir M

    2016-01-01

    Thallium (81(217)Tl, Bismuth (83(217)Bi), Astatine (85(217)At), Francium (87(217)Fr), Actinium (89(217)Ac) and Protactinium (91(217)Pa) are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α) has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF) calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221)Fr-, (221)Ac- and (221)Pa-α-decays.

  3. On the theory of time dilation in chemical kinetics

    Science.gov (United States)

    Baig, Mirza Wasif

    2017-10-01

    The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

  4. SPECT assay of radiolabeled monoclonal antibodies. Progress report, September 1, 1992--August 24, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1993-08-20

    The overall goal of this project is to improve the effectiveness of single photon emission computed tomography (SPECT) to image and quantify radiolabeled monoclonal antibodies. During the past year, we have made significant progress toward this goal, and this report summarizes that work. Our efforts have been mainly directed along three fronts. First, we have developed and tested new reconstruction methods including three-dimensional iterative algorithms that model non-uniform attenuation and distance-dependent detector response. Both fan beam and parallel beam collimator geometries have been modeled and novel ways of improving the efficiency of the computationally intensive methods have been introduced. Second, an ultra-high resolution, small field-of-view pinhole collimator has been constructed and evaluated. Reconstructed spatial resolution of 1 to 3 mm (FWHM) has been achieved in phantom scans with a useful field-of-view of 9 to 10 cm. Finally, we have investigated the ability of SPECT to image and quantify astatine-211 distributions. Reconstructed images of phantom data demonstrated quantitative accuracy to within 10% with proper attenuation and scatter compensation.

  5. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Science.gov (United States)

    Marsh, B. A.; Andel, B.; Andreyev, A. N.; Antalic, S.; Atanasov, D.; Barzakh, A. E.; Bastin, B.; Borgmann, Ch.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Dehairs, M.; Derkx, X.; De Witte, H.; Fedorov, D. V.; Fedosseev, V. N.; Focker, G. J.; Fink, D. A.; Flanagan, K. T.; Franchoo, S.; Ghys, L.; Huyse, M.; Imai, N.; Kalaninova, Z.; Köster, U.; Kreim, S.; Kesteloot, N.; Kudryavtsev, Yu.; Lane, J.; Lecesne, N.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Molkanov, P. L.; Nicol, T.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Schweikhard, L.; Seliverstov, M. D.; Sels, S.; Sjödin, A. M.; Truesdale, V.; Van Beveren, C.; Van Duppen, P.; Wendt, K.; Wienholtz, F.; Wolf, R. N.; Zemlyanoy, S. G.

    2013-12-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  6. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  7. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  8. Evaluating 99mTc Auger electrons for targeted tumor radiotherapy by computational methods.

    Science.gov (United States)

    Tavares, Adriana Alexandre S; Tavares, João Manuel R S

    2010-07-01

    Technetium-99m (99mTc) has been widely used as an imaging agent but only recently has been considered for therapeutic applications. This study aims to analyze the potential use of 99mTc Auger electrons for targeted tumor radiotherapy by evaluating the DNA damage and its probability of correct repair and by studying the cellular kinetics, following 99mTc Auger electron irradiation in comparison to iodine-131 (131I) beta minus particles and astatine-211 (211At) alpha particle irradiation. Computational models were used to estimate the yield of DNA damage (fast Monte Carlo damage algorithm), the probability of correct repair (Monte Carlo excision repair algorithm), and cell kinetic effects (virtual cell radiobiology algorithm) after irradiation with the selected particles. The results obtained with the algorithms used suggested that 99mTc CKMMX (all M-shell Coster-Kroning--CK--and super-CK transitions) electrons and Auger MXY (all M-shell Auger transitions) have a therapeutic potential comparable to high linear energy transfer 211At alpha particles and higher than 131I beta minus particles. All the other 99mTc electrons had a therapeutic potential similar to 131I beta minus particles. 99mTc CKMMX electrons and Auger MXY presented a higher probability to induce apoptosis than 131I beta minus particles and a probability similar to 211At alpha particles. Based on the results here, 99mTc CKMMX electrons and Auger MXY are useful electrons for targeted tumor radiotherapy.

  9. Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

    Energy Technology Data Exchange (ETDEWEB)

    Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se

    2005-08-01

    Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

  10. Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

  11. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  12. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  13. Novel Therapeutic Effects of Leonurine On Ischemic Stroke: New Mechanisms of BBB Integrity

    Directory of Open Access Journals (Sweden)

    Qiu-Yan Zhang

    2017-01-01

    Full Text Available Stroke is a leading cause of morbidity and mortality globally. Leonurine (also named SCM-198, a compound extracted from Herba leonuri, was effective on the prevention of various cardiovascular and brain diseases. The purpose of this study was to explore the possible therapeutic potential of SCM-198 against ischemia reperfusion injury and underlying mechanisms. In the in vivo transient middle cerebral artery occlusion (tMCAO rat model, we found that treatment with SCM-198 could decrease infarct volume and improve neurological deficit by protecting against blood-brain barrier (BBB breakdown. In the in vitro model of cell oxygen-glucose deprivation and reoxygenation (OGD/R, consistent results were obtained with decreased reactive oxygen species (ROS production and maintained the BBB integrity. Further study demonstrated that SCM-198 increased the expression of histone deacetylase- (HDAC- 4 which could inhibit NADPH oxidase- (NOX- 4 and matrix metalloproteinase- (MMP- 9 expression, resulting in the elevation of tight junction proteins, including claudin-5, occludin, and zonula occluden- (ZO- 1. These results indicated SCM-198 protected BBB integrity by regulating the HDAC4/NOX4/MMP-9 tight junction pathway. Our findings provided novel insights into the protective effects and mechanisms of SCM-198 on ischemic stroke, indicating SCM-198 as a new class of potential drug against acute onset of ischemic stroke.

  14. Novel Therapeutic Effects of Leonurine On Ischemic Stroke: New Mechanisms of BBB Integrity

    Science.gov (United States)

    Wang, Zhi-Jun; Sun, De-Miao; Xu, Peng; Wu, Wei-Jun; Liu, Xin-Hua

    2017-01-01

    Stroke is a leading cause of morbidity and mortality globally. Leonurine (also named SCM-198), a compound extracted from Herba leonuri, was effective on the prevention of various cardiovascular and brain diseases. The purpose of this study was to explore the possible therapeutic potential of SCM-198 against ischemia reperfusion injury and underlying mechanisms. In the in vivo transient middle cerebral artery occlusion (tMCAO) rat model, we found that treatment with SCM-198 could decrease infarct volume and improve neurological deficit by protecting against blood-brain barrier (BBB) breakdown. In the in vitro model of cell oxygen-glucose deprivation and reoxygenation (OGD/R), consistent results were obtained with decreased reactive oxygen species (ROS) production and maintained the BBB integrity. Further study demonstrated that SCM-198 increased the expression of histone deacetylase- (HDAC-) 4 which could inhibit NADPH oxidase- (NOX-) 4 and matrix metalloproteinase- (MMP-) 9 expression, resulting in the elevation of tight junction proteins, including claudin-5, occludin, and zonula occluden- (ZO-) 1. These results indicated SCM-198 protected BBB integrity by regulating the HDAC4/NOX4/MMP-9 tight junction pathway. Our findings provided novel insights into the protective effects and mechanisms of SCM-198 on ischemic stroke, indicating SCM-198 as a new class of potential drug against acute onset of ischemic stroke. PMID:28690765

  15. Aging changes in the breast

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/003999.htm Aging changes in the breast To use the sharing ... chap 198. Walston JD. Common clinical sequelae of aging. In: Goldman L, Schafer AI, eds. Goldman-Cecil ...

  16. Quantifying Savanna Woody Cover in the Field and on Historical ...

    African Journals Online (AJOL)

    jed1z

    , and low fertility ... influenced by the geology, with the basalts predominated by more open short tree cover and sweet grass, and ..... 198-210. McGlynn, IO & Okin, GS 2006, 'Characterization of shrub distribution using high spatial resolution.

  17. Red Yeast Rice: An Introduction

    Science.gov (United States)

    ... mg twice daily) in patients with previous statin intolerance . American Journal of Cardiology . 2010;105:198–204. ... to Avoid Red Yeast Rice Products Promoted on Internet as Treatments for High Cholesterol: Products Found to ...

  18. Bifunctional chelates of RH-105 and AU199 as potential radiotherapeutic agents

    Energy Technology Data Exchange (ETDEWEB)

    Droege, P.

    1997-03-01

    Research is presented on new bifunctional chelating ligand systems with stability on the macroscopic and radiochemical levels. The synthesis of the following complexes are described: rhodium 105, palladium 109, and gold 198.

  19. Is the motivation to become a teacher related to pre-service teachers' intentions to remain in the profession?

    NARCIS (Netherlands)

    Bruinsma, Marjon; Jansen, Ellen P. W. A.

    2010-01-01

    This study investigated 198 pre-service teachers' intrinsic and extrinsic motivation for becoming teachers and focused on the distinction between adaptive motives, which promote lasting and effective engagement, and maladaptive motives, which promote superficial engagement. We examined the

  20. South African Journal of Education - Vol 23, No 3 (2003)

    African Journals Online (AJOL)

    The jagged paths to multicultural education: international experiences and South Africa's response in the new dispensation · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Saloshna Vandeyar, 193-198 ...

  1. Evaluation of an Implementation Model : A National Investigation of VA Residential Programs

    NARCIS (Netherlands)

    Cook, Joan M.; Dinnen, Stephanie; Coyne, James C.; Thompson, Richard; Simiola, Vanessa; Ruzek, Josef; Schnurr, Paula P.

    This national investigation utilizes qualitative data to evaluate an implementation model regarding factors influencing provider use of two evidence-based treatments for posttraumatic stress disorder (PTSD). Semi-structured qualitative interviews with 198 mental health providers from 38 Department

  2. SwissProt search result: AK241670 [KOME

    Lifescience Database Archive (English)

    Full Text Available ubunit P (EC 2.4.1.198) (Phosphatidylinositol-glycan biosynthesis, class P protein) (PIG-P) (Down syndrome critical... region protein 5) (Down syndrome critical region protein C) PIGP_HUMAN 1e-13 ...

  3. CTX-M extended-spectrum β-lactamase-producing Klebsiella spp, Salmonella spp, Shigella spp and Escherichia coli isolates in Iranian hospitals

    National Research Council Canada - National Science Library

    Bialvaei, Abed Zahedi; Kafil, Hossein Samadi; Asgharzadeh, Mohammad; Aghazadeh, Mohammad; Yousefi, Mehdi

    2016-01-01

    .... From January 2012 to December 2013, totally 198 E. coli, 139 Klebsiella spp, 54 Salmonella spp and 52 Shigella spp from seven hospitals of six provinces in Iran were screened for resistance to extended-spectrum cephalosporins...

  4. African Zoology - Vol 28, No 4 (1993)

    African Journals Online (AJOL)

    Exposure to wave action: some consequences for the sea urchin Stomopneustes variolaris on the Natal coast · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A.E. Drummond, 198-201 ...

  5. Long-lasting imprint of former glassworks on vegetation pattern in an extremely species-rich grassland: A battle of species pools on mesic soils

    Czech Academy of Sciences Publication Activity Database

    Hájek, M.; Dresler, P.; Hájková, Petra; Hettenbergerová, E.; Milo, P.; Plesková, Z.; Pavonič, M.

    2017-01-01

    Roč. 20, č. 7 (2017), s. 1233-1249 ISSN 1432-9840 Institutional support: RVO:67985939 Keywords : biodiversity * phosphorus * soil magnetims * archaeology Subject RIV: EH - Ecology, Behaviour Impact factor: 4.198, year: 2016

  6. GETDB: 103690 [GETDB

    Lifescience Database Archive (English)

    Full Text Available Link to cluster table 198 1 Request - oenocyte, broad epi - sg, tr (all) - semi lethal - - d1 - - - Show...Request Request - Embryonic Expression oenocyte, broad epi Larval GFP - Larval X-gal sg, tr (all) Adult

  7. Comparing Aphidius colemani and Aphidius matricariae on Myzus persicae ssp. nicotianae in sweet pepper

    NARCIS (Netherlands)

    Schelt, van J.; Hoogerbrugge, H.; Becker, N.; Messelink, G.J.; Bolckmans, K.

    2011-01-01

    Working Group “Integrated Control in Protected crops, Temperate Climate”. Preceedings of the Meeting at Sutton Scotney (United Kingdom), 18 – 22 September, 2011. Editor: Irene Vänninen. ISBN 978-92-9067-245-6 [VIII + 198 pp.].

  8. Survey of tarsonemid mites in greenhouse grown gerberas in The Netherlands

    NARCIS (Netherlands)

    Pijnakker, J.; Leman, A.

    2011-01-01

    Working Group “Integrated Control in Protected crops, Temperate Climate”. Preceedings of the Meeting at Sutton Scotney (United Kingdom), 18 – 22 September, 2011. Editor: Irene Vänninen. ISBN 978-92-9067-245-6 [VIII + 198 pp.].

  9. Biological control of tarsonemid mites in greenhouse grown gerberas

    NARCIS (Netherlands)

    Pijnakker, J.; Leman, A.

    2011-01-01

    Working Group “Integrated Control in Protected crops, Temperate Climate”. Preceedings of the Meeting at Sutton Scotney (United Kingdom), 18 – 22 September, 2011. Editor: Irene Vänninen. ISBN 978-92-9067-245-6 [VIII + 198 pp.].

  10. Combined use of a mulch layer and the soil-dwelling predatory mite Macrocheles robustulus (Berlese) enhance the biological control of sciarids in potted plants

    NARCIS (Netherlands)

    Grosman, A.H.; Messelink, G.J.; Groot, de E.B.

    2011-01-01

    Working Group “Integrated Control in Protected crops, Temperate Climate”. Preceedings of the Meeting at Sutton Scotney (United Kingdom), 18 – 22 September, 2011. Editor: Irene Vänninen. ISBN 978-92-9067-245-6 [VIII + 198 pp.].

  11. Generalist predatory bugs control aphids in sweet pepper

    NARCIS (Netherlands)

    Messelink, G.J.; Bloemhard, C.M.J.; Kok, L.W.; Janssen, A.

    2011-01-01

    Working Group “Integrated Control in Protected crops, Temperate Climate”. Preceedings of the Meeting at Sutton Scotney (United Kingdom), 18 – 22 September, 2011. Editor: Irene Vänninen. ISBN 978-92-9067-245-6 [VIII + 198 pp.].

  12. Alcohol Use and Binge Drinking Among Women of Childbearing Age: United States, 2011-2013

    Science.gov (United States)

    ... and Mortality Weekly Report ( MMWR ) MMWR Share Compartir Alcohol Use and Binge Drinking Among Women of Childbearing ... 44 years (N = 198,098) who reported any alcohol use or binge drinking, † by selected characteristics — Behavioral ...

  13. 77 FR 62226 - Privacy Act of 1974; System of Records-Principal Investigator/Application File and Associated...

    Science.gov (United States)

    2012-10-12

    ... investigators, including their names, addresses, telephone numbers, titles, institutional or organizational..., including their names, addresses, telephone numbers, titles, institutional or organizational affiliations... [Federal Register Volume 77, Number 198 (Friday, October 12, 2012)] [Notices] [Pages 62226-62228...

  14. Effectiveness of pesticides and potential for biological control of the tomato leaf minerTuta absoluta (Meyrick) (Lepidoptera: Gelechiidae) in Europe

    NARCIS (Netherlands)

    Linden, van der A.; Staaij, van der M.

    2011-01-01

    Working Group “Integrated Control in Protected crops, Temperate Climate”. Preceedings of the Meeting at Sutton Scotney (United Kingdom), 18 – 22 September, 2011. Editor: Irene Vänninen. ISBN 978-92-9067-245-6 [VIII + 198 pp.].

  15. Journal of Sustainable Development Law and Policy (The) - Vol 5 ...

    African Journals Online (AJOL)

    Achieving Excellence in the Legal Profession in a Globalized World: Imperatives for Developing Economies · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. F Eimunjeze, 198-218 ...

  16. English in the Czech Republic: Linguists’ perspectives

    Czech Academy of Sciences Publication Activity Database

    Kaderka, Petr; Prošek, Martin

    -, č. 28 (2014), s. 173-198 ISSN 0933-1883 Institutional support: RVO:68378092 Keywords : language situation * English as a global language * attitudes towards English * national language institution * sociolinguistics * Czech Republic Subject RIV: AI - Linguistics

  17. An internal pilot study for a randomized trial aimed at evaluating the effectiveness of iron interventions in children with non-anemic iron deficiency: the OptEC trial

    National Research Council Canada - National Science Library

    Abdullah, Kawsari; Thorpe, Kevin E; Mamak, Eva; Maguire, Jonathon L; Birken, Catherine S; Fehlings, Darcy; Hanley, Anthony J; Macarthur, Colin; Zlotkin, Stanley H; Parkin, Patricia C

    2015-01-01

    ...). The initial sample size calculated for the OptEC trial ranged from 112-198 subjects. Given the uncertainty regarding the parameters used to calculate the sample, an internal pilot study was conducted...

  18. Linn maksab suulise nõuande eest 200 000 krooni / Askur Alas

    Index Scriptorium Estoniae

    Alas, Askur, 1973-

    2005-01-01

    Tallinna linnavalitsus eraldab MTÜ-le Eesti Tuleviku-uuringute Instituut rahvusvahelise koostöö ja strateegia alase konsultatsiooni eest 198 240 krooni. Tallinna linnapea nõuniku Jaano-Martin Otsa selgitus

  19. 75 FR 6239 - Self-Regulatory Organizations; The NASDAQ Stock Market LLC; Notice of Filing and Immediate...

    Science.gov (United States)

    2010-02-08

    ... Sciences 154 URE ProShares Ultra Inc Real Estate. 198 GLW Corning Inc 180 UTX United Technologies Corp. 170... Select Inc Sector SPDR Fund. 206 HON Honeywell 173 XRX Xerox Corp. International Inc 210 JOYG Joy Global...

  20. 75 FR 6233 - Self-Regulatory Organizations; NASDAQ OMX PHLX, Inc.; Notice of Filing and Immediate...

    Science.gov (United States)

    2010-02-08

    ... Gilead Sciences 154 URE ProShares Ultra Inc. Real Estate. 198 GLW Corning Inc. 180 UTX United... Materials Select Inc. Sector SPDR Fund. 206 HON Honeywell 173 XRX Xerox Corp. International Inc. 210 JOYG...

  1. Cattle Rustling and Banditry in North-Western Kenya

    African Journals Online (AJOL)

    the basis of land use and whether the pastoralists are mounted or pedestrian: mounted flat land nomads, pedestrian flat land nomads and mountain dwelling pastoral- ists” (Khan 1994:198). Various forms of pastoral systems react differently to.

  2. The impact of changes in labour broking on an integrated petroleum and chemical company

    Directory of Open Access Journals (Sweden)

    Yvonne T. Joubert

    2017-05-01

    Contribution / value-add: The study represents original research, extending the current body of knowledge on the perceptions of employees in the human resources department regarding the changes to section 198 of the LRA.

  3. Revitalisasi Tauhid, Menghadang Pluralisme Agama

    OpenAIRE

    Nurdin, Bahren

    2013-01-01

    Judul Buku : Islam dan Pluralisme Agama: Memperkukuh Tawhid di Zaman Kekeliruan Penulis : Khalif Muammar | Penerbit : Center for Advanced Studies on Islam, Science and Civilization (CASIS), Universiti Teknologi Malaysia | Tahun : 2013 | Jumlah Hal : 198 hal

  4. 78 FR 28023 - National Vaccine Injury Compensation Program; List of Petitions Received

    Science.gov (United States)

    2013-05-13

    ... behalf of Cooper Lee Tindal, Omaha, Nebraska, Court of Federal Claims No: 09-0396V. 198. Angelica Driggs..., Wisconsin, Court of Federal Claims No: 09-0474V. 236. Rachel A. Rivera, Houston, Texas, Court of Federal...

  5. 77 FR 33769 - Notice of Lodging of Second Amendment to First Amended Consent Decree Under the Clean Water Act

    Science.gov (United States)

    2012-06-07

    ... (``Amendment'') in United States and State of Georgia v. City of Atlanta, Civil Action No. 1:98- CV-1956-TWT...-1956-TWT, Financial Capability-Based Amendment & Schedule Extension Request. Further information...

  6. Serum 25-hydroxyvitamin d and the incidence of acute viral respiratory tract infections in healthy adults

    National Research Council Canada - National Science Library

    Sabetta, James R; DePetrillo, Paolo; Cipriani, Ralph J; Smardin, Joanne; Burns, Lillian A; Landry, Marie L

    2010-01-01

    .... In this prospective cohort study serial monthly concentrations of 25-hydroxyvitamin D were measured over the fall and winter 2009-2010 in 198 healthy adults, blinded to the nature of the substance being measured...

  7. Residence Times of Juvenile Salmon and Steelhead in Off-Channel Tidal Freshwater Habitats, Columbia River, USA

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Gary E.; Ploskey, Gene R.; Sather, Nichole K.; Teel, D. J.

    2015-05-01

    We estimated seasonal residence times of acoustic-tagged juvenile salmonids in off-channel, tidal freshwater habitats of the Columbia River near the Sandy River delta (rkm 198; 2007, 2008, 2010, and 2011) and Cottonwood Island (rkm 112; 2012).

  8. Production and modeling of radioactive gold nanoparticles in Tehran research reactor.

    Science.gov (United States)

    Hosseini, Seyedeh Fatemeh; Sadeghi, Mahdi; Aboudzadeh, Mohammad Reza; Mohseni, Morteza

    2016-12-01

    Gold has two medically useful radioactive isotopes, 198Au and 199Au, for locally irradiating and killing tumor cells. 198Au radionuclide has been produced through the irradiation of the pure gold via 197Au(n,γ)198Au reaction in the Tehran Research Reactor at a thermal neutron flux of 4.5×1013ncm-2s-1 for the different irradiation times. In this paper, the activity of 198Au radionuclide has been determined using MCNPX-2.6 and TALYS-1.6 codes and also the theoretical approach. The calculated results were compared with the corresponding experimental values. The calculated results were in good agreement with the experimental data, thus the used codes can be used as a powerful tool to predict and optimize production conditions in reactor. Copyright © 2016 Elsevier Ltd. All rights reserved.

  9. [Jörg Driesner, Robert Riemen. Spiegel und Bilder in den Nachlassinventaren deutscher Kaufleute in Reval im 18. Jahrhundert] / Paul Kaegbein

    Index Scriptorium Estoniae

    Kaegbein, Paul

    2006-01-01

    Arvustus: Jörg Driesner u. Robert Riemen. Spiegel und Bilder in den Nachlassinventaren deutscher Kaufleute in Reval im 18. Jahrhundert. In: Land und Meer. Köln, Weimar, Wien: Böhlau 2004. S. 165-198.

  10. Kunstivaldkonna tähtsus : seos avalike eesmärkidega / Alberta Arthurs, Frank Hodsoll ; tõlk. Johanna Ross

    Index Scriptorium Estoniae

    Arthurs, Alberta

    2008-01-01

    Originaali pealkiri: The importance of the arts sector : how it relates to the public purpose // The Journal of Arts Management, Law and Society. Vol. 28, nr. 2, lk. 102-108. Lühidalt autoritest lk. 198

  11. 76 FR 11464 - Sunshine Act Meeting; Open Commission Meeting; Thursday, March 3, 2011

    Science.gov (United States)

    2011-03-02

    ... broadcasters and multichannel video programming distributors. 5 Wireline Competition. Title: Federal-State... Act of 1996 (WT Docket No. 96-198) and Accessible Mobile Phone Options for People who are Blind, Deaf...

  12. Dicty_cDB: Contig-U06303-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t1= VSA725Z ,1,198 Translated Amino Acid sequence ksvs*KIISIICYISHCRKKKLMISLFYLKIRILKTIKKNCKLFFFFI*kkkklinci...kkinklyii cklif Frame C: ksvs*KIISIICYISHCRKKKLMISLFYLKIRILKTIKKNCKLFFFFI*kkkklincily vn*yf own update 2004.

  13. Comparison of physiotherapy, manipulation, and corticosteroid injection for treating shoulder complaints in general practice : Randomised, single blind study

    NARCIS (Netherlands)

    Winters, Jan C.; Sobel, J.S.; Groenier, Klaas H.; Arendzen, J.H.; Meyboom-de Jong, B.

    1997-01-01

    Objective: To compare the efficacy of physiotherapy, manipulation, and corticosteroid injection for treating patients with shoulder complaints in general practice. Design: Randomised, single blind study. Setting: Seven general practices in the Netherlands. Subjects: 198 patients with shoulder

  14. The Effect of Detergent Effluent on the Physico-Chemical ...

    African Journals Online (AJOL)

    MICHAEL HORSFALL

    4.35±0.09. Chloride (mg/L). 1.98±0.60 2.00±0.54. 1.98±0.50. Water temperature was within range as stipulated for aquatic organisms. The slightly alkaline values in pH might be caused by the industrial effluent entering the water body. Dissolved oxygen was low, while. Biological oxygen demand values were very high at.

  15. Dynamic Response of Concrete and Concrete Structures

    Science.gov (United States)

    1984-01-26

    low - . AFOSR-T... 84-0.165 DYNAMIC RESPONSE OF CONCRETE AND CONCRETE STRUCTURES FIRST ANNUAL TECHNICAL REPORT LAWRENCE E. 14ALVERN C. ALLEN ROSS...and Subtitle) S. TYPE OF REPORT I PERIOD COVERED DYNAMIC RESPONSE OF CONCRETE 1 DEC 1982 - 30 NOV 1983 AND CONCRETE STRUCTURES I_____198__-__0_NOV_198...Bar Dynamic Loads Fracture Materials Testing Dynamic Properties Impact Rate Effects Dynamic Testing Hopkinson Bar Reinforced Concrete Structures 20

  16. EST Table: FS899341 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS899341 E_FL_ftes_34E24_R_0 10/09/28 39 %/198 aa ref|XP_971046.2| PREDICTED: similar to antolefin...0 low homology 10/09/10 39 %/152 aa gnl|Amel|GB16043-PA 10/09/10 39 %/198 aa gi|189240340|ref|XP_971046.2| PREDICTED: similar to antolefinin [Tribolium castaneum] FS752084 ftes ...

  17. EST Table: FY749873 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY749873 E_FL_famL_43G14_F_0 11/11/04 39 %/198 aa ref|XP_971046.2| PREDICTED: similar to antolefin... %/152 aa gnl|Amel|GB16043-PA 11/11/04 39 %/198 aa gi|189240340|ref|XP_971046.2| PREDICTED: similar to antolefinin [Tribolium castaneum] FS921551 famL ...

  18. EST Table: FY761959 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY761959 E_FL_famL_43G14_R_0 11/11/04 39 %/198 aa ref|XP_971046.2| PREDICTED: similar to antolefin... %/152 aa gnl|Amel|GB16043-PA 11/11/04 39 %/198 aa gi|189240340|ref|XP_971046.2| PREDICTED: similar to antolefinin [Tribolium castaneum] FS752084 famL ...

  19. EST Table: FS864234 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS864234 E_FL_fner_24L14_R_0 10/09/28 38 %/198 aa ref|XP_971046.2| PREDICTED: similar to antolefin...0 low homology 10/09/10 39 %/152 aa gnl|Amel|GB16043-PA 10/09/10 38 %/198 aa gi|189240340|ref|XP_971046.2| PREDICTED: similar to antolefinin [Tribolium castaneum] FS752084 fner ...

  20. The Strategic Petroleum Reserve.

    Science.gov (United States)

    1994-05-01

    was estimated at $8 billion. Historically, the SPPR hus hd a colorful past. It has experienced management problems, construction delays and been...crude oil for the reserve. 61 The Food Security Act (Public Law 99-198) was signed into law on December 23, 1985 by President Reagan . Public Law 99-198...Kuwait, and Saudi Arabia are good examples. Loans to these countries often have to be , estructured because of the country’s inability to pay their

  1. Optimizing MIBG therapy of neuroendocrine tumors: preclinical evidence of dose maximization and synergy

    Energy Technology Data Exchange (ETDEWEB)

    Mairs, Rob J. [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)], E-mail: r.mairs@beatson.gla.ac.uk; Boyd, Marie [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)

    2008-08-15

    [{sup 131}I]meta-Iodobenzylguanidine ([{sup 131}I]MIBG) has been used for the therapy of tumors of neuroectodermal origin since the 1980s. Its role in the management of these malignancies remains controversial because of the large variation in response rates. Appreciation of the mode of conveyance of [{sup 131}I]MIBG via the noradrenaline transporter into malignant cells and of factors that influence the activity of the uptake mechanism has indicated various ways in which the effectiveness of this type of targeted radiotherapy may be improved. Experimental observations indicate that radiolabeling of MIBG to high specific activity reduced the amount of cold competitor, thereby increasing tumor dose and minimizing pressor effects. We observed supra-additive tumor cell kill and inhibition of tumor growth following combined topotecan and [{sup 131}I]MIBG treatment. The improved efficacy is related to topotecan's increased disruption of DNA repair. Radiation damage to targeted tumors may also be enhanced by the use of the {alpha}-particle emitter [{sup 211}At]astatine rather than {sup 131}I as radiolabel. Furthermore, recent experimental findings indicate that [{sup 123}I]MIBG may have therapeutic potential over and above its utility as an imaging agent. It has recently been demonstrated that potent cytotoxic bystander effects were induced by the intracellular concentration of [{sup 131}I]MIBG, [{sup 123}I]MIBG or meta-[{sup 211}At]astatobenzylguanidine. Identification of the nature of bystander factors could be exploited to maximize the specificity and potency of MIBG-targeted radiotherapy. By employing a range of strategies, there are good prospects for the improvement of the [{sup 131}I]MIBG therapy of neuroectodermal tumors.

  2. Immuno-vectorization of radioelements emitters of alpha particles: a new therapy in cancerology; Immunovectorisation de radioelements emetteurs de particules alpha: une nouvelle voie therapeutique en cancerologie

    Energy Technology Data Exchange (ETDEWEB)

    Bourgeois, M

    2007-05-15

    The radio-immunotherapy is an anti cancerous therapy which consists in vectorising with immuno-specific agents very radio toxic radioelements on tumors or in their environment to destroy them. The first part of this report presents the different characteristics of antibodies as well as their means of production under monoclonal shapes specifically steered against a tumoral antigen of interest. The second part of this report replaces the importance of the immunological vectors in the context of the nuclear medicine. It is notably described that the different methods which allow to radio-label the vector, as well as the different ways of optimization which were envisaged to improve the targeting of radioelements on a tumor. These different developments allow to define the potential place of the alpha radio-immunotherapy in treatments and so re-place the interest of the experimental part. If the radio-immunotherapy, using beta emitters isotopes as the {sup 131}iodine or the{sup 90}yttrium, is today current in anti cancerous therapy, it finds limits because of the disintegration characteristics of the isotopes it uses. Indeed, compared with alpha particles, the beta particles deposit less energy by unit of length in the crossed material.The experimental part of this report aims at studying the feasibility of the coupling between an immunological vector and an alpha emitter isotope.The different tests led on the bismuth 213, the bismuth 212, the lead 212 and the astatine 211 demonstrated that the fixation of these radionuclides was possible. This research theme is strengthened by the construction in Nantes of a cyclotron with high energy ( A.R.R.O.N.A.X.) and the optimization of the obtained promising results should allow a therapeutic use in oncology of the alpha radio-immunotherapy. (N.C.)

  3. Locoregional therapy with α-emitting trastuzumab against peritoneal metastasis of human epidermal growth factor receptor 2-positive gastric cancer in mice.

    Science.gov (United States)

    Li, Huizi Keiko; Morokoshi, Yukie; Nagatsu, Kotaro; Kamada, Tadashi; Hasegawa, Sumitaka

    2017-08-01

    Peritoneal metastasis of gastric cancer (PMGC) is incurable and thus has an extremely poor prognosis. We have found, however, that locoregionally administered trastuzumab armed with astatine-211 ((211) At-trastuzumab) is effective against human epidermal growth factor receptor 2 (HER2)-positive PMGC in a xenograft mouse model. We first observed that (211) At-trastuzumab can specifically bind and effectively kill NCI-N87 (N87) cells, which are HER2-positive human metastatic GC cells, both in vitro and in s.c. tumors. We established a PMGC mouse model using N87 xenografts stably expressing luciferase to test α-particle radioimmunotherapy with (211) At-trastuzumab against PMGC. Biodistribution analysis in this PMGC mouse model revealed that the i.p. administration of (211) At-trastuzumab (1 MBq) was a more efficient means of delivery of (211) At into metastatic tumors than i.v. injection; the maximum tumor uptake with i.p. administration was over 60% injected dose per gram of tissue (%ID/g) compared to approximately 18%ID/g with i.v. injection. Surprisingly, a single i.p. injection of (211) At-trastuzumab (1 MBq) was sufficient to completely eradicate intraperitoneally disseminated HER2-positive GC xenografts in two of six treated mice by inducing DNA double-strand breaks, and to drastically reduce the tumor burden in another three mice. No bodyweight loss, leukocytopenia, or significant biochemical changes in liver or kidney function were observed in the treatment group. Accordingly, locoregionally administered (211) At-trastuzumab significantly prolonged the survival time of HER2-positive PMGC mice compared with control treatments. Our results provide a proof-of-concept demonstration that locoregional therapy with (211) At-trastuzumab may offer a new treatment option for HER2-positive PMGC. © 2017 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.

  4. A single mutation in the envelope protein modulates flavivirus antigenicity, stability, and pathogenesis.

    Directory of Open Access Journals (Sweden)

    Leslie Goo

    2017-02-01

    Full Text Available The structural flexibility or 'breathing' of the envelope (E protein of flaviviruses allows virions to sample an ensemble of conformations at equilibrium. The molecular basis and functional consequences of virus conformational dynamics are poorly understood. Here, we identified a single mutation at residue 198 (T198F of the West Nile virus (WNV E protein domain I-II hinge that regulates virus breathing. The T198F mutation resulted in a ~70-fold increase in sensitivity to neutralization by a monoclonal antibody targeting a cryptic epitope in the fusion loop. Increased exposure of this otherwise poorly accessible fusion loop epitope was accompanied by reduced virus stability in solution at physiological temperatures. Introduction of a mutation at the analogous residue of dengue virus (DENV, but not Zika virus (ZIKV, E protein also increased accessibility of the cryptic fusion loop epitope and decreased virus stability in solution, suggesting that this residue modulates the structural ensembles sampled by distinct flaviviruses at equilibrium in a context dependent manner. Although the T198F mutation did not substantially impair WNV growth kinetics in vitro, studies in mice revealed attenuation of WNV T198F infection. Overall, our study provides insight into the molecular basis and the in vitro and in vivo consequences of flavivirus breathing.

  5. Free and Ca-Alginate Beads Immobilized Horseradish Peroxidase for the Removal of Reactive Dyes: an Experimental and Modeling Study.

    Science.gov (United States)

    Farias, Simone; Mayer, Diego A; de Oliveira, Débora; de Souza, Selene M A Guelli U; de Souza, Antônio Augusto Ulson

    2017-08-01

    The aim of this work was to remove the dyes Reactive Blue 221 (RB 221) and Reactive Blue 198 (RB 198) of synthetic effluent using the immobilized enzyme horseradish peroxidase (HRP) in Ca-alginate beads. Experimental parameters affecting the dye removal process such as the effect of pH, temperature, hydrogen peroxide concentration, mass capsules, and reuse were evaluated, and a numerical model of mass transfer was developed. A maximum removal of 93 and 75%, respectively, for the dyes RB 221 and RB 198, at pH 5.5 and temperature of 30 °C, concentration of hydrogen peroxide of 43.75 μM for dye RB 221 and 37.5 μM for the dye of RB 198 was obtained. A removal reaction of 180 min for RB 221 and 240 min for RB 198 was observed. Three reuse cycles of use of immobilized enzyme were achieved for both dyes. The numerical model proposed led to a good fit compared to experimental data. The HRP enzyme immobilized in Ca-alginate capsules showed a great potential for biotechnological applications, especially for the removal of reactive dyes.

  6. Readaptation of a low-virulence influenza H9 escape mutant in mice: the role of changes in hemagglutinin as revealed by site-specific mutagenesis.

    Science.gov (United States)

    Ilyushina, N A; Rudneva, I A; Khalenkov, A M; Timofeeva, T A; Krylov, P S; Webster, R G; Kaverin, N V

    2010-01-01

    In our earlier studies, we showed that an escape mutant of mouse-adapted H9N2 influenza virus carrying a T198N amino acid change in heamagglutinin (HA) has a lowered virulence for mice. The readaptation of this mutant to mice was associated with N198S or N198D reverse mutations. In this study, single-gene reassortants having HA gene of the wild-type virus, its low-virulence escape mutant, or a readapted variant were generated by site-specific mutagenesis and assayed for virulence. The results showed that antibody-selected mutations in the HA of H9 influenza virus can decrease mortality and virus accumulation in mouse lungs, though not in nasal turbinates, and the effect may be compensated by reverse mutations in the course of passaging.

  7. EST Table: DC532432 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DC532432 E_ET_J150_31D11_F_0 10/09/28 100 %/198 aa ref|NP_001091766.1| fructose 1,6...uctose-bisphosphate aldolase class- I#status:Confirmed#UniProt:P54216#protein_id:CAB032...92 aa gnl|Amel|GB19460-PA 10/09/10 79 %/198 aa gi|270008484|gb|EFA04932.1| hypothetical protein TcasGA2_TC014998 [Tribolium castaneum] FS797404 J150 ...

  8. Benthic Community Response to Hypoxia: Baseline Data

    Science.gov (United States)

    2009-01-01

    Sipuncula — — — — Molluscs 198.9 861.9 1259.7 2320.5 Hydroida 66.3 — 132.6 198.9 Crustaceans — 66.3 331.5 397.8 Echinoderms 132.6 132.6 729.3 994.5...followed by mollusks and echinoderms . The phylum Sipuncula was completely absent in this province. Station H03A has the highest abundance of organisms...followed by mollusks, echinoderms , crustaceans, sipunculids and hydroids. Station BH3B has the greatest abundance of organisms per unit area, followed by

  9. Stemcell Information: SKIP000844 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 370S 10001.198.01 10001.198.01 パーキンソン病 G20 Parkinson Disease 168600 ... 68 60-69 Male Ashkenazi Jewish ... ...Ashkenazi Jewish ... Yes No Transgene-free iPS cells from Parkinson Disease patient who has Monozygotic twin br....023 iPSC-derived dopamine neurons reveal differences between monozygotic twins discordant for Parkinson...other.Using CytoTune iPS Sendai reprogramming protocol (Life Technologies). 一卵性双生児のパーキンソン

  10. EST Table: FS921551 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available y 10/09/10 39 %/152 aa gnl|Amel|GB16043-PA 10/09/10 39 %/198 aa gi|189240340|ref|XP_971046.2| PREDICTED: similar to antolefinin [Tribolium castaneum] FS921551 fwgP ... ...FS921551 E_FL_fwgP_02A09_F_0 11/12/09 n.h 10/09/28 39 %/198 aa ref|XP_971046.2| PREDICTED: similar to antole...finin [Tribolium castaneum] 10/09/13 low homology 10/08/29 n.h 10/09/10 low homolog

  11. A summary of SAWTRI's research on wool and wool blends

    CSIR Research Space (South Africa)

    Hunter, L

    1987-11-01

    Full Text Available stream_source_info Hunter L_5.pdf.txt stream_content_type text/plain stream_size 501757 Content-Encoding ISO-8859-1 stream_name Hunter L_5.pdf.txt Content-Type text/plain; charset=ISO-8859-1 C O N T E N T S Page... . . . . . . . . . . . . . . . . . . . . . . 194 20 . WOOUSYNTHETIC B L ~ D S . . . . . . . . . . . . . . . . . . 198 20.1 The Production and Properties of Ring-spun Staple Yams . . . . . . . . . . . . . . . . . . . 198 20.2 Physical Properties of Commercial Wool'Polyester Yams...

  12. Dicty_cDB: Contig-U02319-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available of successful extensions: 41 Number of sequences better than 10.0: 2 length of query...: 198 length of database: 5,674,871 effective HSP length: 15 effective length of query: 183 effective le... of sequences better than 10.0: 0 Length of query: 198 Length of database: 101,790,757,118 Length adjustment...: 23 Effective length of query: 175 Effective length of database: 99,442,330,388 Effective search space: 174...d: 462 Number of HSP's successfully gapped: 0 Length of query: 66 Length of datab

  13. Directly-Modulated VCSELs for 2x2 MIMO-OFDM Radio over Fiber in WDM-PON

    DEFF Research Database (Denmark)

    Binti Othman, Maisara; Deng, Lei; Pang, Xiaodan

    2011-01-01

    We demonstrate directly- modulated VCSELs supporting 2x2 MIMO-OFDM 5.6-GHz radio over fiber signaling over 20-km WDM-PON. Error-free signal demodulation of 64-subcarrier 4-QAM signals modulated at 198.5-Mb/s is achieved after fiber and 2-m indoor wireless transmission.......We demonstrate directly- modulated VCSELs supporting 2x2 MIMO-OFDM 5.6-GHz radio over fiber signaling over 20-km WDM-PON. Error-free signal demodulation of 64-subcarrier 4-QAM signals modulated at 198.5-Mb/s is achieved after fiber and 2-m indoor wireless transmission....

  14. Urine lipoarabinomannan point-of-care testing in patients affected by pulmonary nontuberculous mycobacteria - experiences from the Danish Cystic Fibrosis cohort study

    DEFF Research Database (Denmark)

    Qvist, Tavs; Johansen, Isik S.; Pressler, Tania

    2014-01-01

    . We set forth to investigate if the test detects LAM in urine from a Danish cystic fibrosis (CF) population characterized by a high NTM prevalence and negligible TB exposure. Method: Patients followed at the Copenhagen CF Center were comprehensively screened for pulmonary NTM infection between May...... 2012 and December 2013. Urine samples were tested for LAM using the 2013 Determine™ TB LAM Ag strip test. Results: Three-hundred and six patients had a total of 3,322 respiratory samples cultured for NTM and 198 had urine collected (65%). A total of 23/198 (12%) had active pulmonary NTM infection. None...

  15. Quantitative Single-Particle Digital Autoradiography with α-Particle Emitters for Targeted Radionuclide Therapy using the iQID Camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W.; Frost, Sophia; Frayo, Shani; Kenoyer, Aimee L.; Santos, E. B.; Jones, Jon C.; Green, Damian J.; Hamlin, Donald K.; Wilbur, D. Scott; Fisher, Darrell R.; Orozco, Johnnie J.; Press, Oliver W.; Pagel, John M.; Sandmaier, B. M.

    2015-07-01

    Abstract Alpha emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm) causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with alpha emitters may inactivate targeted cells with minimal radiation damage to surrounding tissues. For accurate dosimetry in alpha-RIT, tools are needed to visualize and quantify the radioactivity distribution and absorbed dose to targeted and non-targeted cells, especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, iQID (ionizing-radiation Quantum Imaging Detector), for use in alpha-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection technology that images and identifies charged-particle and gamma-ray/X-ray emissions spatially and temporally on an event-by-event basis. It employs recent advances in CCD/CMOS cameras and computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, we evaluated this system’s characteristics for alpha particle imaging including measurements of spatial resolution and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 (211At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ~20 μm full width at half maximum (FWHM) and the alpha particle background was measured at a rate of (2.6 ± 0.5) × 10–4 cpm/cm2 (40 mm diameter detector area). Simultaneous imaging of multiple tissue sections was performed using a large-area iQID configuration (ø 11.5 cm

  16. Quantitative single-particle digital autoradiography with α-particle emitters for targeted radionuclide therapy using the iQID camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W., E-mail: brian.miller@pnnl.gov [Pacific Northwest National Laboratory, Richland, Washington 99354 and College of Optical Sciences, The University of Arizona, Tucson, Arizona 85719 (United States); Frost, Sofia H. L.; Frayo, Shani L.; Kenoyer, Aimee L.; Santos, Erlinda; Jones, Jon C.; Orozco, Johnnie J. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 (United States); Green, Damian J.; Press, Oliver W.; Pagel, John M.; Sandmaier, Brenda M. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 and Department of Medicine, University of Washington, Seattle, Washington 98195 (United States); Hamlin, Donald K.; Wilbur, D. Scott [Department of Radiation Oncology, University of Washington, Seattle, Washington 98195 (United States); Fisher, Darrell R. [Dade Moeller Health Group, Richland, Washington 99354 (United States)

    2015-07-15

    Purpose: Alpha-emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm), causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with α emitters may thus inactivate targeted cells with minimal radiation damage to surrounding tissues. Tools are needed to visualize and quantify the radioactivity distribution and absorbed doses to targeted and nontargeted cells for accurate dosimetry of all treatment regimens utilizing α particles, including RIT and others (e.g., Ra-223), especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, the ionizing-radiation quantum imaging detector (iQID) camera, for use in α-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection system that images and identifies charged-particle and gamma-ray/x-ray emissions spatially and temporally on an event-by-event basis. It employs CCD-CMOS cameras and high-performance computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, the authors evaluated its characteristics for α-particle imaging, including measurements of intrinsic detector spatial resolutions and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 ({sup 211}At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ∼20 μm full width at half maximum and the α-particle background was measured at a rate as low as (2.6 ± 0.5) × 10{sup −4} cpm/cm{sup 2} (40 mm diameter detector area

  17. α-Imaging Confirmed Efficient Targeting of CD₄₅-Positive Cells After ²¹¹At-Radioimmunotherapy for Hematopoietic Cell Transplantation

    Energy Technology Data Exchange (ETDEWEB)

    Frost, Sophia; Miller, Brian W.; Back, Tom; Santos, E. B.; Hamlin, Donald K.; Knoblaugh, E.; Frayo, Shani; Kenoyer, Aimee L.; Storb, Rainer; Press, O. W.; Wilbur, D. Scott; Pagel, John M.; Sandmaier, B. M.

    2015-09-03

    Alpha-radioimmunotherapy (α-RIT) targeting CD45 may substitute for total body irradiation in hematopoietic cell transplantation (HCT) preparative regimens for lymphoma. Our goal was to optimize the anti-CD45 monoclonal antibody (MAb; CA12.10C12) protein dose for astatine-²¹¹(²¹¹At)-RIT, extending the analysis to include intra-organ ²¹¹At activity distribution and α-imaging-based small-scale dosimetry, along with imunohistochemical staining. Methods: Eight normal dogs were injected with either 0.75 (n=5) or 1.00 mg/kg (n=3) of ²¹¹At-B10-CA12.10C12 (11.5–27.6 MBq/kg). Two were euthanized and necropsied 19–22 hours postinjection (p.i.), and six received autologous HCT three days after ²¹¹At-RIT, following lymph node and bone marrow biopsies at 2–4 and/or 19 hours p.i. Blood was sampled to study toxicity and clearance; CD45 targeting was evaluated by flow cytometry. ²¹¹At localization and small scale dosimetry were assessed using two α-imaging : α-camera and iQID. Results: Uptake of ²¹¹At was highest in spleen (0.31–0.61 %IA/g), lymph nodes (0.02–0.16 %IA/g), liver (0.11–0.12 %IA/g), and marrow (0.06–0.08 %IA/g). Lymphocytes in blood and marrow were efficiently targeted using either MAb dose. Lymph nodes remained unsaturated, but displayed targeted ²¹¹At localization in T lymphocyte-rich areas. Absorbed doses to blood, marrow, and lymph nodes were estimated at 3.9, 3.0, and 4.2 Gy/210 MBq, respectively. All transplanted dogs experienced transient hepatic toxicity. Liver enzyme levels were temporarily elevated in 5 of 6 dogs; 1 treated with 1.00 mg MAb/kg developed ascites and was euthanized 136 days after HCT. Conclusion: ²¹¹At-anti-CD45 RIT with 0.75 mg MAb/kg efficiently targeted blood and marrow without severe toxicity. Dosimetry calculations and observed radiation-induced effects indicated that sufficient ²¹¹At-B10-CA12.10C12 localization was achieved for efficient conditioning for HCT.

  18. The role of alpha therapy for local and systemic treatment of cancer

    Energy Technology Data Exchange (ETDEWEB)

    Allen, B.J. [St George Hospital, Kogarah, NSW (Australia)

    1998-03-01

    Major problems in the management of cancer relate to the inability to control some primary lesions, e.g. glioblastoma multiforme (GBM), and the inability to deal with metastatic cancer arising from malignant cancers such as melanoma, breast and other cancers. Binary alpha therapy using neutron capture in boron-10 offers the potential for improved prognosis for high grade brain tumours such as GBM and melanoma metastases to the brain. Metastatic cancer proceeds through a number of quite separate stages in the development of lethal disease, i e. cells in transit, preangiogenic lesions, subclinical and clinical lesions. Early stages offer the potential for control if targeted alpha therapy is applied. However, the dose must be localised to the cancer cell and this requirement rules out beta-emitting radionuclides, which are more suited for clinical lesions. Alpha-emitting radionuclides are the most appropriate toxins, as their efficacy depends on the linear energy transfer (LET) and range of the alpha particles. After matching the cancer stage, radiolabel and carrier, we find that {sup 149}Tb is the radionuclide of choice for systemic therapy in all aspects except production. The production of {sup 149}Tb in {mu}Ci (kBq) quantities has been achieved using the heavy ion reaction at the ANU tandem accelerator at Canberra and in multi-mCi (MBq) quantities using the spallation reaction in combination with on-line isotope separation technology of ISOLDE at CERN. Terbium is ideally suited for chelation to monoclonal antibodies to produce stable radio-immunoconjugates (RIC). Astatine-211 is a halide and has potential for the elimination of early stage melanoma metastases as At-MTB. However, the availability of the alpha generators {sup 228}Th-{sup 212}Bi and {sup 225}Ac-{sup 213}Bi facilitates the use of Bi-RIC in clinical trials for acute myeloid leukaemia and cystic glioma. Alpha therapy has the potential to control refractory cancers when treated at the minimum residual

  19. Systematics of Alpha-Radioactivity

    Energy Technology Data Exchange (ETDEWEB)

    Perlman, I.; Ghiorso, A.; Seaborg, G.T.

    1949-09-12

    Correlations of alpha-decay energies in terms of mass number and atomic number have been made for all of the alpha-emitting species now numbering over 100. For each element isotopes show increase in alpha-energy with decrease in mass number except in the region of 126 neutrons where there is an explainable reversal. This reversal has the effect of creating a region of relatively low alpha-energy and long half-life at low mass numbers for such elements as astatine, emanation, francium, and possibly higher elements as had been noted already for bismuth and polonium. Methods and examples of using alpha-decay data to define the energy surface in the heavy element region are discussed. The regularities in alpha-decay are used for predictions of nuclear properties including prediction of the beta-stable nuclides among the heavy elements. The half-life vs. energy correlations show that the even-even nuclides conform well with existing alpha-decay theory, but all nuclear types with odd nucleons show prohibited decay. The reason for this prohibition is not found in spin changes in the alpha-emission but in the assembly of the components of the alpha particle, and this theory is discussed further in terms of observations made on nuclides having two or more alpha-groups. Using most of the even-even nuclei to define 'normal nuclear radius' calculations are now able to show the shrinkage in the regions of lead and of 126 neutrons to amount to about 10%. The much greater change in 'effective radius' for bismuth isotopes can be dissociated into the effects of odd nucleons superimposed on the actual decrease in nuclear radius. The simple expression r = 1.48 A{sup 1/3} {center_dot} 10{sup -13} cm seems to fit the data for the even-even nuclei outside of the region of 126 neutrons better than more complex functions.

  20. The relevance of pre-employment chest X-Ray examination in ...

    African Journals Online (AJOL)

    A major medical examination is the chest x-ray, which investigates the condition of the heart with respect to the size, shape and position and the lung fields in order to emphasize any pathology. There were no soft tissue lesions and the bony rib cages of the candidates were all normal. In the studies of 198 cases, chest ...

  1. Dual-Use Telemedicine Support System for Pathology.

    Science.gov (United States)

    1998-12-01

    51 CDRH Center for Devices and Radiological Health 52 CEA Carcino-Embroyonic Antigen 53 CEN European Standards Group 54 CEN/TC 251 Working on spec...Telemedicine and Hospital Information Related Systems Acronyms; 12/10/98 197 MDL MD Lookup 198 MDR MD Retrieval 199 MEDIX MEDical Data InterX (X stands for

  2. Nedestruktivní hodnocení a monitorování ocelových a betonových stavebních konstrukcí

    Czech Academy of Sciences Publication Activity Database

    Převorovský, Zdeněk; Kober, Jan; Krofta, Josef; Chlada, Milan

    2013-01-01

    Roč. 23, 1-2 (2013), s. 24-29 ISSN 1213-3825 R&D Projects: GA MPO(CZ) FR-TI1/198 Institutional support: RVO:61388998 Keywords : structural health monitoring * civil structures * nonlinear elastic wave spectroscopy * acoustic emission Subject RIV: JN - Civil Engineering

  3. AcEST: DK963190 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ein OS=Anaer... 36 1.3 tr|B4U7B8|B4U7B8_HYDS0 Hydroxylamine reductase OS=Hydrogen...AYERNKPTKKYSANQMS 195 Query: 47 PGQ 39 G+ Sbjct: 196 DGE 198 >tr|B4U7B8|B4U7B8_HYDS0 Hydroxylamine

  4. Perception and Practice of Emergency Contraception by Post ...

    African Journals Online (AJOL)

    A survey of 1500 students in post-secondary institutions in south west Nigeria showed that the concept of emergency contraception (EC) was well known. Respectively, 32.4%, 20.4% and 19.8% knew that combined pills, progesterone only pills and intrauterine contraceptive device (IUCD) were usable for EC, while 56.7% ...

  5. Technical Risk Assessment. The Status of Current DoD Efforts

    Science.gov (United States)

    1986-04-01

    current efforts to ’dentify the technical risks X X X of new sistems ) 5 How are efforts to identify technical risk implenientecr X X x 6 What information on...D).C., January 198:3. NECMAN, Frederick *Ilow DCAA-- Uses Risk Analysis in Planning and Programming Audits." Internal Auditor , 36:3 (June 1979). 32

  6. Gender Roles in Chika Unigwe's The Phoenix

    African Journals Online (AJOL)

    written that “gender is an identity one adopts or creates” (qtd in Buchanan 198). Invariably, the question is: who ... Wollstonecraft's book lends substantial support to literary critics when they are tracing the origin of feminism. ... more radical brand of feminism advocated by American feminist scholars. This, of course, has led to ...

  7. Prevalence of ovarian adrenal rest tumours and polycystic ovaries in females with congenital adrenal hyperplasia: results of ultrasonography and MR imaging.

    NARCIS (Netherlands)

    Stikkelbroeck, N.M.; Hermus, A.R.M.M.; Schouten, D.; Suliman, H.M.; Jager, G.J.; Braat, D.D.M.; Otten, B.J.

    2004-01-01

    The aim of the investigation was to assess the prevalence of ovarian adrenal rest tumours and polycystic ovaries in female patients with congenital adrenal hyperplasia (CAH). Thirteen female CAH patients (median age 19.8 years, range 14.8-23.5 years) underwent transvaginal (n=6) or transabdominal

  8. Gclust Server: 171769 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 171769 NCR_NCU07615 Cluster Sequences - 197 predicted protein (translation) (198 aa...); no annotation 1 1.00e-99 0.0 0.0 0.0 0.0 0.0 12.5 Show 171769 Cluster ID 171769 Sequence ID NCR_NCU07615

  9. Albendazole Microparticles Prepared by Spray Drying Technique ...

    African Journals Online (AJOL)

    The spray-dried particles were characterized for particle shape, and dissolution rate as well as by differential scanning calorimetry(DSC) and Fourier .... Thermal analysis. The DSC thermogram of pure ABZ (Fig. 2 A) shows an endothermic peak at 218 ºC with a shoulder at 198 oC due to drug melting [15], while KL exhibits a ...

  10. Simple sequence repeats in mycobacterial genomes

    Indian Academy of Sciences (India)

    Prakash

    alpha-ketoglutaratedecarboxylase, LpqZ, malatedehydrogenase. 289-290. 0.72. +. 7. 4 acyl-CoAsynthase ... proteasome[beta]-typesubunit2, proteasome[alpha]- typesubunit1. 164-165. 0.56. -. 1. 1. 198-199. 0.55 .... PE_PGRS (15840909), cytochrome c oxidase folding protein (15840911), PE_PGRS (15840912), quinone.

  11. EST Table: FS802796 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS802796 E_FL_fmgV_10K03_F_0 10/09/28 53 %/198 aa gb|AAC36150.1| chymotrypsinogen-like protein [Plodia... interpunctella] gb|AAC36149.1| chymotrypsinogen-like protein [Plodia interpunctella] 10/

  12. Use of standalone photovoltaic system for office building: the case ...

    African Journals Online (AJOL)

    , is considered as a cost effective system for the building, as compared to one in category 2 with the load of an average consumption of 198.1kWh/d. Keywords: Renewable Energy, Insolation, Electrical Load Demand, Self Sufficient, Grid ...

  13. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 198 ... T Maguembara, S Bawoubadi. Vol 4, No 1 (2012), Classification of Implemented Foreign Assisted Projects into Sustainable And Non-sustainable Groups: A Discriminant Analysis Approach, Abstract PDF. IC Chibuzo. Vol 9, No 1 (2013), Cloud Computing: Key to IT Development in West Africa, Abstract ...

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 198 ... Vol 15, No 1 (2015), Insight into the Utilization of Cloud and Mobile Computing in a service oriented world, Abstract PDF. N.C. Anujeonye, O.E. Okonta, E.E. Imiere, L. Uzomah, JohnBosco O.C Okekeokosisi. Vol 15, No 1 (2015), Integrating Virtual Reality (VR) into traditional instructional design ...

  15. Seasonal variability of heat flux divergence in the coastal waters of Visakhapatnam

    Digital Repository Service at National Institute of Oceanography (India)

    Rao, B.P.; Sadhuram, Y.

    in premonsoon seasons while it loses heat in the other seasons. The mean heat loss is found to be about 19.8 W/m super(2) annually. The magnitude of Qv is comparable with the net radiation at the sea surface (QR) during monsoon and post monsoon seasons, whereas...

  16. Molecular diagnostic of cytomegalovirus, Epstein Barr virus and ...

    African Journals Online (AJOL)

    Introduction: in most developing countries, Cytomegalovirus (CMV), Epstein Barr virus (EBV) and Herpes virus 6 (HHV-6) are not diagnosed in blood donors. The aim of this study is to determine the prevalence of these viruses in blood donors from the city of Ouagadougou, Burkina Faso. Methods: the study included 198 ...

  17. Dual Regulating Effect of Shaoyao-Gangcao-Tang on COX- 2 ...

    African Journals Online (AJOL)

    Prostaglandin E2 at new glance: novel insights in functional diversity offer therapeutic chances. Int J. Biochem Cell Biol 2010; 42: 198-201. 20. Ricote M, Li AC, Willson TM, Kelly CJ, Glass CK. The peroxisome proliferator-activated receptor-gamma is a negative regulator of macrophage activation. Nature 1998; 391: 79-82.

  18. Enhanced production of glucose oxidase from UV- mutant of ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-01-19

    Jan 19, 2009 ... UV rays were used as mutagen in wild type strain of Aspergillus niger for enhanced production of glucose oxidase. After mutangenization and selection, mutant A. niger strains, resistant to 2-deoxy-D- glucose were obtained. The mutants showed 1.57 and 1.98 fold increase in activities of extra and intra.

  19. Gene duplication as a major force in evolution

    Indian Academy of Sciences (India)

    2Department of Plant Molecular Biology and Biotechnology, 3Department of Environmental Sciences, and 4Centre for Plant. Breeding and Genetics, Tamil Nadu Agricultural University (TNAU), ...... Zhang J. 2003 Evolution by gene duplication: an update. Trends. Ecol. Evol. 18, 192–198. Received 19 May 2012; in revised ...

  20. Gclust Server: 198783 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 198783 Atu_Atu0439 Cluster Sequences - 303 hypothetical protein 1 1.00e-99 0.0 0.0 0.0 0.0 3.23 0.0 Show 198...783 Cluster ID 198783 Sequence ID Atu_Atu0439 Link to cluster sequences Cluster Seq

  1. Genetic transmission of Alzheimer disease among families in a Dutch population-based study

    NARCIS (Netherlands)

    C.M. van Duijn (Cornelia); L.A. Farrer (Lindsay); L.A. Cupples (Adrienne); A. Hofman (Albert)

    1993-01-01

    textabstractWe evaluated age at onset and transmission patterns of Alzheimer's disease (AD) in families of 198 patients who had onset of symptoms before the age of 65 years and were diagnosed before the age of 70 years. Patients were ascertained in a population based study in The Netherlands. The

  2. 76 FR 24522 - In the Matter of Certain Handbags, Luggage, Accessories, and Packaging Thereof; Notice of...

    Science.gov (United States)

    2011-05-02

    ... handbags, luggage, accessories, and packaging thereof by reason of infringement of certain claims of U.S. Trademark Registration Nos. 297,594; 1,643,625; 1,653,663; 1,875,198; 2,773,107; 2,177,828; 2,181,753; and 1...

  3. Neural Network Based Reactive Navigation for Mobile Robot in Dynamic Environment

    Czech Academy of Sciences Publication Activity Database

    Krejsa, Jiří; Věchet, S.; Ripel, T.

    2013-01-01

    Roč. 198, č. 2013 (2013), s. 108-113 ISSN 1012-0394 Institutional research plan: CEZ:AV0Z20760514 Institutional support: RVO:61388998 Keywords : mobile robot * reactive navigation * artificial neural networks Subject RIV: JD - Computer Applications, Robot ics

  4. Oral health-related quality of life in patients with tooth wear

    NARCIS (Netherlands)

    Papagianni, C.E.; van der Meulen, M.J.; Naeije, M.; Lobbezoo, F.

    2013-01-01

    The aim of this study was to investigate the impact of tooth wear (TW) on patients' oral health-related quality of life. A total of 198 participants were included in the study. They belonged to the following four different diagnostic categories: 51 patients with TW, 46 patients with painful

  5. 34 CFR 303.23 - Service coordination (case management).

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false Service coordination (case management). 303.23 Section... Service coordination (case management). (a) General. (1) As used in this part, except in § 303.12(d)(11... any other legislation that makes reference to “case management” services. See H.R. Rep. No. 198, 102d...

  6. Continuing Medical Education - Vol 28, No 5 (2010)

    African Journals Online (AJOL)

    The collapsed football player: The sight of a football player lying on the ground, surrounded by coaches and medics, is not uncommon. EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. S Motaung, 198-201 ...

  7. Effects of sweeteners on individual feed intake characteristics and performance in group-housed weanling pigs

    NARCIS (Netherlands)

    Sterk, A.R.; Schlegel, P.; Mul, A.J.; Ubbink-Blanksma, M.; Bruininx, E.M.A.M.

    2008-01-01

    To assess the effects of 2 high intensity sodium saccharine based sweeteners on individual feed intake characteristics and performance of group-housed weaned pigs, 198 26-d-old weanling pigs were given ad libitum access to 3 dietary treatments: containing no additional sweetener (Control), 150 mg

  8. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Issue front cover thumbnail Issue back cover thumbnail. Volume 12, Issue 3. March 2007, pages 1-98. pp 1-1 Editorial. Editorial · Vasant Natarajan · More Details Fulltext PDF. pp 2-3 Table of Contents. Table of Contents · More Details Fulltext PDF. pp 4-12 General Article. Nikola Tesla – The Creator of the Electric Age.

  9. Niveau de contamination des produits maraîchers par les ...

    African Journals Online (AJOL)

    ... agricoles et des pesticides a des effets sur la qualité des produits maraîchers. ... des produits maraîchers est élevé en zinc (198,84 mg/kg), en plomb (17,99 ... Mots clés : Substances toxiques, cultures maraîchères, milieu urbain, Bénin.

  10. 78 FR 59962 - Notice of Inventory Completion: University of Massachusetts Amherst, Department of Anthropology...

    Science.gov (United States)

    2013-09-30

    ... Chippewa Tribe, Minnesota; Forest County Potawatomi Community, Wisconsin; Grand Portage Band of Minnesota... projectile points, 61 stone tools, 1 stone pipe fragment, 106 bone tools, 40 bone beads, 5 bone tubes, 40... remains, 198 ] lots of pottery fragments, 164 lots of stone fragments, and 34 lots of shell fragments...

  11. Variations of the fatty acid composition in the oil from the larval ...

    African Journals Online (AJOL)

    The proximate fatty acid composition has now been determined by capillary GC for five oil samples from five batches of mophane caterpillar, ranging between early III and late V instars in order to investigate any differences in the nature of the lipid content due to age. The oil yield increased steadily from 19.8% (w/w) for early ...

  12. EST Table: FY025031 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY025031 bmte10l02 11/11/04 50 %/198 aa ref|XP_966817.2| PREDICTED: similar to sorting and assembly machine...6817.2| PREDICTED: similar to sorting and assembly machinery component 50 homolog [Tribolium castaneum] FS904485 bmte ...

  13. Chemical constituent analysis of the crown-of-thorns starfish ...

    African Journals Online (AJOL)

    The results showed that protein content of the starfish was 19.8 to 22.0% of dry weight and the amino acid composition was similar to that of fish meal. Though the starfish had little fatty acids (<1%), the fatty acids contained rich variety and unsaturated fatty acids on average accounted for more than 60% of total fatty acids.

  14. Children's Moral Self-Concept: The Role of Aggression and Parent-Child Relationships

    Science.gov (United States)

    Sengsavang, Sonia; Krettenauer, Tobias

    2015-01-01

    This study examined the role of aggressiveness and parenting in the development of children's moral self-concept. Participants were 198 elementary school children and their parents (M = 8.65 years, SD = 2.44). Participants completed a structured moral self puppet interview and a questionnaire about their relationship to parents. Parents completed…

  15. The prognostic significance of the axillary apex biopsy in clinically operable breast cancer

    NARCIS (Netherlands)

    van Tienhoven, G.; Borger, J. H.; Passchier, D. H.; Hart, A. A.; Rutgers, E. J.; van Dongen, J. A.; Bartelink, H.

    1995-01-01

    To evaluate the prognostic significance of the axillary apex biopsy and its impact on clinical practice, a retrospective analysis was performed in 875 patients with clinically operable breast cancer who underwent this procedure from 1977 to 1985 (165 TNM stage I; 512 TNM stage II; 198 TNM stage

  16. CHEK2 (∗) 1100delC Mutation and Risk of Prostate Cancer

    DEFF Research Database (Denmark)

    Hale, Victoria; Weischer, Maren; Park, Jong Y

    2014-01-01

    . Of the twelve prostate cancer studies, five studies had independent data to draw conclusive evidence from. The pooled results of OR and 95% CI were 1.98 (1.23-3.18) for unselected cases and 3.39 (1.78-6.47) for familial cases, indicating that CHEK2 (∗)1100delC mutation is associated with increased risk...

  17. Eragrostis Tef (Zucc.) Trotter

    African Journals Online (AJOL)

    reduction in grain yield with higher N and P levels beyond 46 kg N and 10 kg P ha-1 might be mainly related to the reductions observed .... The Nature and Properties of Soils (13th ed). Pearson education Ltd., USA. pp. 156-198. ... Manual. Completely revised edition, D.F. Mexico, 51p. Deckers JA, FO Nachtergaele, and OC ...

  18. Canonical Correlational Models of Students' Perceptions of Assessment Tasks, Motivational Orientations, and Learning Strategies

    Science.gov (United States)

    Alkharusi, Hussain

    2013-01-01

    The present study aims at deriving correlational models of students' perceptions of assessment tasks, motivational orientations, and learning strategies using canonical analyses. Data were collected from 198 Omani tenth grade students. Results showed that high degrees of authenticity and transparency in assessment were associated with positive…

  19. Plasma connective tissue growth factor is an independent predictor of end-stage renal disease and mortality in type 1 diabetic nephropathy

    DEFF Research Database (Denmark)

    Nguyen, Tri Q; Tarnow, Lise; Jorsal, Anders

    2008-01-01

    OBJECTIVE: We evaluated the predictive value of baseline plasma connective tissue growth factor (CTGF) in a prospective study of patients with type 1 diabetes. RESEARCH DESIGN AND METHODS: Subjects were 198 type 1 diabetic patients with established diabetic nephropathy and 188 type 1 diabetic...

  20. Global Overview of the Models of Physiotherapy Practice: A need for ...

    African Journals Online (AJOL)

    Bello

    Biomedical Material Research 95(4): 1270-9. Jette, A.M. 2005. The changing language of disablement. Physical. Therapy 85: 198-199. Jette, A.M. 1994. Physical disablement concept for physical research and practice. Physical Therapy 74:380. Karjalainen, K., A. Malvmivaara, M. van Tulder, R. Roine, M. 55. AJPARS Vol.

  1. Fe speciation and Fe/Al ratio in the sediments of southeastern Arabian Sea as an indicator of climate change

    Digital Repository Service at National Institute of Oceanography (India)

    Pattan, J.N.; Parthiban, G.; Gupta, S.M.; Mir, I.A.

    .98%), carbonate (1.98%), Fe–Mn oxide (30.8%), organic carbon (4.7%) and biogenic opal (11.4%) which together constitutes nearly 50% of the bulk Fe content. There is a good correlation between time series Fe/Al and differential solar insolation, suggesting warmer...

  2. Empathy, Self-Reflection, and Curriculum Choice

    Science.gov (United States)

    Grosseman, Suely; Hojat, Mohammadreza; Duke, Pamela M.; Mennin, Stewart; Rosenzweig, Steven; Novack, Dennis

    2014-01-01

    We administered the Jefferson Scale of Empathy and the Groningen Reflection Ability Scale to 61 of 64 entering medical students who self-selected a problem-based learning curricular track and to 163 of 198 who self-selected a lecture-based track (response rates of 95.3% and 82.3%, respectively, with no statistically significant differences in mean…

  3. An 18-Year Model of Family and Peer Effects on Adolescent Drug Use and Delinquency.

    Science.gov (United States)

    Garnier, Helen E.; Stein, Judith A.

    2002-01-01

    Studied the interrelationship of family and peer experiences in predicting adolescent problem behaviors in an 18-year longitudinal sample of 198 adolescents from conventional and nonconventional families. The most powerful predictors of teen drug use and delinquent behaviors were similar behaviors by peers, but peer behaviors were in turn…

  4. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. A Mukherjee. Articles written in Pramana – Journal of Physics. Volume 57 Issue 1 July 2001 pp 195-198 Contributed Papers : Nuclear reactions. Fusion around the barrier forLi +C · A Mukherjee M Dasgupta D J Hinde C R Morton A C Berriman R D Butt J O Newton H Timmers.

  5. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 198 ... Vol 8, No 3 (2016), Diversity and abundance of butterfly species (Lepidoptera) fauna in Federal University of Agriculture, Makurdi forestry nursery, Benue ... Vol 9, No 2 (2017), Effect of organic substrates on the propagation of Pleurotus ostreatus (Oyster Mushroom) in Obubra, Cross River State, Nigeria ...

  6. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. G Ambika. Articles written in Resonance – Journal of Science Education. Volume 20 Issue 3 March 2015 pp 198-205 General Article. Ed Lorenz: Father of the 'Butterfly Effect' · G Ambika · More Details Fulltext PDF ...

  7. 49 CFR 171.7 - Reference material.

    Science.gov (United States)

    2010-10-01

    ... Society of Mechanical Engineers, ASME International, 22 Law Drive, P.O. Box 2900, Fairfield, NJ 07007-2900... Petroleum (LP) Gases 180.209. ASTM D 1838-64 Copper Strip Corrosion by Liquefied Petroleum (LP) Gases 173... C-6, Standards for Visual Inspection of Steel Compressed Gas Cylinders, 1993 173.3, 173.198, 180.205...

  8. The Role of Parents and Parental Mediation on 0-3-Year Olds' Digital Play with Smart Devices: Estonian Parents' Attitudes and Practices

    Science.gov (United States)

    Nevski, Elyna; Siibak, Andra

    2016-01-01

    In this manuscript, we analyse the attitudes and practices of Estonian parents (N = 198) who allowed their 0-3-year olds to use smart devices. We aimed to discover if there was an interaction between parental use of smart technologies, parents' attitudes and the child's age that would predict young children's usage of smart devices. We also wanted…

  9. Emotional Intelligence and Leadership Success of Secondary ...

    African Journals Online (AJOL)

    This is an expost facto research designed to determine the influence of emotional intelligence on leadership success of secondary school principals in Rivers State of Nigeria. The population consisted 441 principals (243 in public and 198 in private) secondary schools in Rivers State. A sample of 208 principals drawn ...

  10. Excitation functions of deuteron-induced nuclear reactions on natural platinum up to 24 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Khandaker, Mayeen Uddin, E-mail: mu_khandaker@yahoo.com [Department of Physics, University of Malaya, 50603 Kuala Lumpur (Malaysia); Haba, Hiromitsu; Murakami, Masashi [Nishina Center for Accelerator-Based Science, RIKEN, Wako, Saitama 351-0198 (Japan); Otuka, Naohiko [Nuclear Data Section, Division of Physical and Chemical Sciences, Department of Nuclear Sciences and Applications, International Atomic Energy Agency, A-1400 Vienna (Austria); Kassim, Hasan Abu [Department of Physics, University of Malaya, 50603 Kuala Lumpur (Malaysia)

    2015-11-01

    Excitation functions of the {sup nat}Pt(d,x){sup 192,193,194,195,196m2,196,198m,198,199}Au, {sup 195m,197}Pt and {sup 190(g+m1+0.086m2),192(g+m1),194m}Ir nuclear reactions were measured from the respective threshold up to 24 MeV deuteron energy by using the stacked foil activation technique combined with HPGe gamma-ray spectrometry. Measured data were critically compared with the available literature data and theoretical data extracted from the TENDL-2013 library, and only partial agreement among them was found. Physical thick target yields for the investigated reaction products were also deduced and compared with the directly measured ones in the literature. The deduced yield curves indicate that a low energy cyclotron (<15 MeV) and a highly enriched {sup 198}Pt target could be used to obtain {sup 198,199}Au in no carrier added form. All cross-sections for {sup 190(g+m1+0.086m2),194m}Ir and those for {sup 193,194,196m2,196,199}Au, and {sup 195m,197}Pt in the lower energy region are reported for the first time.

  11. Relationship of Ethnic Identity and Spiritual Development: An Exploratory Study

    Science.gov (United States)

    Chae, Mark H.; Kelly, Deborah B.; Brown, Christa F.; Bolden, Mark A.

    2004-01-01

    The current investigation examined the relationship of ethnic identity and spiritual development. The Multigroup Ethnic Identity Measure (J. Phinney, 1992), Spirituality Ends Measure (B. Fiorito & L. Ryan, 1998), and Spirituality Means Measure (B. Fiorito & L. Ryan, 1998) were administered to 198 male and female college students from 4…

  12. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    February 2000, pages 1-98. pp 1-1 Editorial. Editorial / Associate Editor's Column · Rajaram Nityananda · More Details Fulltext PDF. pp 2-3 Table of Contents. Table of Contents · More Details Fulltext PDF. pp 4-11 Series Article. Science and Technology of Ceramics - Advanced Ceramics: Structural Ceramics and Glasses.

  13. 46 CFR 129.430 - Navigational lighting.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Navigational lighting. 129.430 Section 129.430 Shipping... INSTALLATIONS Lighting Systems § 129.430 Navigational lighting. (a) Each vessel of less than 100 gross tons and less than 19.8 meters (65 feet) in length must have navigational lighting in compliance with the...

  14. Children's Literature Book Apps: Exploring New Paths for Books and Literacy Development

    Science.gov (United States)

    Woote, Deborah A.; McCuiston, Kimberly F.

    2015-01-01

    Apps are no longer technical innovation but rather a cultural phenomenon that touches upon potentially every aspect of daily life in Western culture (Stichnothe, 2014, p.198). In this article, Colleen O'Connell, the director for digital books at HarperCollins, is interviewed about the background of book apps and their potential for teaching and…

  15. Systematic paleontology of Quaternary ostracode assemblages from the Gulf of Alaska; Part 3, Family Cytheruridae

    Science.gov (United States)

    Brouwers, E.M.

    1994-01-01

    Forty-six species of podocopid ostracodes, most belonging to the Family Cytheruridae, are reported from Quaternary continental-shelf sediments of the Gulf of Alaska. Descriptions and illustrations are provided for 27 new species, 11 previously described species, and 8 species retained in open nomenclature. This report is based on 198 bottom grab samples collected during 1975, 1979, and 1980.

  16. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 198 ... A Richters, E Sarabwe. Vol 13, No 1 (2015), Exclusionary violence and bullying in the playground: Football and gender 'policing' at school, Abstract PDF. E Mayeza. Vol 15, No 1 (2017), Exploring the heuristic value of nonpersonal data for sexual- and genderbased violence research and prevention in ...

  17. An Annotated Bibliography of United States Air Force Engineering Anthropometry - 1946 to 1988

    Science.gov (United States)

    1988-05-01

    Dimensions Churchill, E. A. Kuby & G.S. Daniels Abstract: The design of equipment which must fit closely a part of the user’s body calls for a...Krogman, W. M. Kroh, G. Kuby , A. 184 60, 69, 74, 84, 92, 102, 123, 124, 126, 128, 134, 143, 154, 155, 191, 210, 212 151, 152, 164, 198, 199

  18. The Relationships between Negative Life Events, Perceived Support in the School Environment and Depressive Symptoms among Norwegian Senior High School Students: A Prospective Study

    Science.gov (United States)

    Murberg, Terje A.; Bru, Edvin

    2009-01-01

    The present study prospectively explored the main and interactive effect of negative life events and social support from teachers and classroom peers on depressive symptoms in a sample of 198 (111 females, 87 males) students in a Norwegian senior high school. In the longitudinal multivariate analyses, self-reported depressive symptom levels at…

  19. Theoretical approach to the magnetic properties of Mn(II), Cr(III), and ...

    Indian Academy of Sciences (India)

    Srimath

    3+. , and Mn. 2+ ions in the newly reported. 12- and 15-membered macrocyclic complexes are analysed by a theoretical approach. The calculated magnetic ... Cr(III), and Mn(II) ions in 12-membered macrocyclic ligands are 1.98 BM, 3.72 .... and the results of the EPR spectroscopy, one can easily calculate the amount of.

  20. The Best and the Rest: Revisiting the Norm of Normality of Individual Performance

    Science.gov (United States)

    O'Boyle, Ernest, Jr.; Aguinis, Herman

    2012-01-01

    We revisit a long-held assumption in human resource management, organizational behavior, and industrial and organizational psychology that individual performance follows a Gaussian (normal) distribution. We conducted 5 studies involving 198 samples including 633,263 researchers, entertainers, politicians, and amateur and professional athletes.…

  1. Students' and teachers' cognitions about good teachers

    NARCIS (Netherlands)

    Beishuizen, J.J.; Hof, E.; van Putten, C.M.; Bouwmeester, S.; Asscher, J.J.

    2001-01-01

    Examined what students think about good teachers. 198 students of 4 age groups (7, 10, 13, and 16 yrs old) and teachers from primary and secondary schools were asked to write an essay on the good teacher. The correspondence between conceptual items in the essays was investigated. The analysis

  2. determination of neutron-induced activation cross sections using nirr ...

    African Journals Online (AJOL)

    DR. AMINU

    2010-06-01

    irradiated gold monitor. [197Au (n,γ) 198Au, Eγ=411.8 keV] and Np is the number of counts in the full energy peak, W the weight of the gold monitor, W the weight of the sample, S the saturation factor, D the decay factor, C.

  3. Ethiopian Journal of Development Research

    African Journals Online (AJOL)

    Socio-economic and environmental effects of tourism in Konso Terrace and cultural landscape, Ethiopia: perception of local communities · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Abdibeshir Said, Engdawork Assefa, 139-198 ...

  4. Patients with cancer on the ICU: the times they are changing

    NARCIS (Netherlands)

    de Jonge, Evert; Bos, Monique M.

    2009-01-01

    A recent paper by Taccone and coworkers showed that 15% of patients from 198 European intensive care units (ICUs) had a malignancy, mostly solid tumors but also hematological malignancies. Over the past years, the prognosis of cancer patients has improved significantly, even when ICU admission is

  5. EST Table: FS792084 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS792084 E_FL_ffbm_08L07_F_0 10/09/28 84 %/198 aa ref|NP_001040143.1| perilipin [Bo...mbyx mori] gb|ABD36152.1| perilipin [Bombyx mori] 10/09/09 36 %/199 aa FBpp0237003|DvirGJ22586-PA 10/08/29 n

  6. Dicty_cDB: VHK274 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -28 CP000087_1092( CP000087 |pid:none) Rickettsia bellii RML369-C, com... 129 2e-28 CP000683_198( CP000683 |pid:none) Rickettsia mass...iliae MTU5, compl... 128 3e-28 CP001503_2917( CP001503 |

  7. Dicty_cDB: VHL846 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |pid:none) Rickettsia massiliae MTU5, compl... 226 2e-57 CP001635_813( CP001635 |pid:none) Variovorax parad...Value CP000087_1092( CP000087 |pid:none) Rickettsia bellii RML369-C, com... 229 2e-58 CP000683_198( CP000683

  8. Dicty_cDB: VHH355 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |pid:none) Rickettsia massiliae MTU5, compl... 97 9e-19 CP000446_3340( CP000446 |pid:none) Shewanella sp. MR...3e-19 CP000503_703( CP000503 |pid:none) Shewanella sp. W3-18-1, complete... 97 7e-19 CP000683_198( CP000683

  9. Analysis of mtDNA hypervariable region II for increasing the ...

    African Journals Online (AJOL)

    aghomotsegin

    2015-03-11

    Mar 11, 2015 ... positions G92C, C113G, C150G, T156A, C194G, C198G, G207C, G225C and G228C are described and may in future be suitable sources for identification purpose. The data obtained can be used to identify variable nucleotide positions characterized by frequent occurrence most promising for identification.

  10. Bachelor of Social Work Students and Mental Health Stigma: Understanding Student Attitudes

    Science.gov (United States)

    Zellmann, Karen T.; Madden, Elissa E.; Aguiniga, Donna M.

    2014-01-01

    Bachelor-level social work students (n = 198) at a midsized Midwestern public university were surveyed to evaluate their attitudes toward those with mental health concerns. Additionally, students were surveyed regarding their willingness to seek treatment for their own mental health needs. Results of the analyses suggest that the majority of…

  11. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. S Mazumdar. Articles written in Sadhana. Volume 26 Issue 1-2 February-April 2001 pp 179-198. Solidification control in continuous casting of steel · S Mazumdar S K Ray · More Details Abstract Fulltext PDF. An integrated understanding of heat transfer during solidification, friction/lubrication at ...

  12. Cryptosporidiosis among animal handlers and their Livestock in ...

    African Journals Online (AJOL)

    Objective: To investigate the prevalence of cryptosporidiosis among groups at risk (animal handlers) and among domestic animals. Design: Comparative study with zoonotic aspect. Method: Stool samples were collected from 60 animal handlers, 175 nonanimal handlers and 198 domestic animals (60 cows, 45 sheep, ...

  13. An investigation of the chromium oxidation state of a monoanionic chromium tris(catecholate) complex by X-ray absorption and EPR spectroscopies

    DEFF Research Database (Denmark)

    Pattison, D I; Levina, A; Davies, Michael Jonathan

    2001-01-01

    The well-known monoanionic Cr tris(3,5-di-tert-butylcatecholato) complex, [Cr(DTBC)3]-, has been studied by X-ray absorption spectroscopy. The multiple-scattering fit to the XAFS gave good correlation (R = 19.8%) and good values for all of the bond lengths, angles, and Debye-Waller factors. The p...

  14. The influence of maternal socio-economic status on infant feeding ...

    African Journals Online (AJOL)

    Nearly twice as many infants (49.6%) of the single mothers were underweight as compared to infants (19.8%) whose parents were married. Similarly, twice as many infants (50%) were underweight if their mothers walked to the health facility compared to 23.8% of infants' whose mothers' used taxis. Education and ...

  15. Drug: D00862 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D00862 Drug Nitrofurazone (USP); Nitrofural (INN); Furacin (TN) C6H6N4O4 198.0389 1... CAS: 59-87-0 PubChem: 7847927 DrugBank: DB00336 PDB-CCD: NFZ LigandBox: D00862 NIKKAJI: J1.921F ATOM 14 1 C

  16. Drug: D03409 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03409 Drug Caroxazone (USAN/INN) C10H10N2O3 206.0691 206.198 D03409.gif Antidepres...tabolism hsa00380(4128+4129) Tryptophan metabolism hsa00982(4128+4129) Drug metabolism - cytochrome P450 hsa

  17. Occurrence of bovine mastitis and isolation of Staphyloccocus

    African Journals Online (AJOL)

    A study was conducted on 360 dairy cows (1440 quarters) to determine the prevalence of mastitis by California Mastitis Test (CMT) and Staphylococci in ... Similar pattern of occurrence was recorded for both clinical and subclinical mastitis as the adults had 21.8% and 3.4 %, young adults had 19.8% and 0.4% and old cows ...

  18. short communication regioselective iodination of aryl amines using 1

    African Journals Online (AJOL)

    B. S. Chandravanshi

    . Hamel, E.; Jung, M.K.; Kremmidiotis, G. J. Med. Chem. 2011, 54, 6014. 26. Kanıskan, N.; Kökten, S.; Çelik, I. ARKIVOC 2012, 8, 198. 27. Xiao, W.J.; Alper, H. J. Org. Chem. 1999, 64, 9646. 28. Lizos, D.E.; Murphy, J.A. Org. Biomol. Chem. 2003 ...

  19. Materialistic Thinking and Its Mental-Hygienic Implications among Students of Budapest Business School

    Science.gov (United States)

    Gombás, Judit

    2015-01-01

    Previous research with extrinsic ("materialistic") and intrinsic ("non-materialistic") life goals suggest that intrinsic aspirations (e.g. relationships, community service, personal development) are associated with a better functioning, mentally and physically more healthy personality. In this survey 198 undergraduate students…

  20. Advanced GPS-Based Time Link Calibration with PTB’s New GPS Calibration Setup

    Science.gov (United States)

    2010-11-01

    and O. Koudelka, 2008, “Time transfer with nanosecond accuracy for the realization of International Atomic Time,” Metrologia , 45, 185- 198. [4] H...Observatory, Washington, D.C.), pp. 63-88. [14] P. Defraigne and G. Petit, 2004, “Time Transfer to TAI using geodetic receivers,” Metrologia , 40, 184-188

  1. Calibrating GPS With TWSTFT For Accurate Time Transfer

    Science.gov (United States)

    2008-12-01

    and O. Koudelka, 2008, “Time transfer with nanosecond accuracy for the realization of International Atomic Time,” Metrologia , 45, 185- 198. [4] Z...468-475. [7] Z. Jiang, 2008, “Towards a TWSTFT Network Time Transfer,” Metrologia , 45, S6-S11.

  2. Time Transfer from Combined Analysis of GPS and TWSTFT Data

    Science.gov (United States)

    2008-12-01

    Koudelka, 2008, “Time transfer with nanosecond accuracy for the realization of International Atomic Time,” Metrologia , 45, 185- 198. [6] G. Petit and Z...K. Senior, 2005, “Geodetic techniques for time and frequency comparisons using GPS phase and code measurements,” Metrologia , 42, 215-232. [11] J

  3. Serine phosphorylation of syndecan-2 proteoglycan cytoplasmic domain

    DEFF Research Database (Denmark)

    Oh, E S; Couchman, J R; Woods, A

    1997-01-01

    Protein kinase C (PKC) is involved in cell-matrix and cell-cell adhesion, and the cytoplasmic domain of syndecan-2 contains two serines (residues 197 and 198) which lie in a consensus sequence for phosphorylation by PKC. Other serine and threonine residues are present but not in a consensus seque...

  4. P and СP violation in physics MICHAEL GRONAU It has often been ...

    Indian Academy of Sciences (India)

    90, 131803 (2003). BaBar Collaboration: B Aubert et al, hep-ex/0311032. [8] M Gronau and J L Rosner, Phys. Rev. D65, 013004 (2001); Phys. Rev. D65, 093012. (2002); Phys. Rev. D66, 053003 (2002). M Gronau, Phys. Lett. В557, 198 (2003). [9] R Fleischer, Phys. Lett. В459, 306 (1999). M Gronau and J L Rosner, Phys.

  5. Exploring Learning Performance toward Cognitive Approaches of a Virtual Companion System in LINE App for m-Learning

    Science.gov (United States)

    Hsieh, Sheng-Wen; Wu, Min-Ping

    2013-01-01

    This paper used a Virtual Companion System (VCS) to examine how specific design variables within virtual learning companion affect the learning process of learners as defined by the cognitive continuum of field-dependent, field-independent and field-mixed learners in LINE app for m-learning. The data were collected from 198 participants in a…

  6. Social Information Processing Patterns, Social Skills, and School Readiness in Preschool Children

    Science.gov (United States)

    Ziv, Yair

    2013-01-01

    The links among social information processing, social competence, and school readiness were examined in this short-term longitudinal study with a sample of 198 preschool children. Data on social information processing were obtained via child interview, data on child social competence were obtained via teacher report, and data on school readiness…

  7. Forest microbiome: diversity, complexity and dynamics

    Czech Academy of Sciences Publication Activity Database

    Baldrian, Petr

    2017-01-01

    Roč. 41, č. 2 (2017), s. 109-130 ISSN 0168-6445 R&D Projects: GA ČR GA13-06763S; GA ČR GA13-27454S; GA MŠk(CZ) LD15086 Institutional support: RVO:61388971 Keywords : forests * microbiome * habitat Subject RIV: EE - Microbiology, Virology Impact factor: 12.198, year: 2016

  8. cAMP Signaling of Adenylate Cyclase Toxin Blocks the Oxidative Burst of Neutrophils through Epac-Mediated Inhibition of Phospholipase C Activity

    Czech Academy of Sciences Publication Activity Database

    Černý, Ondřej; Anderson, K.E.; Stephens, L.R.; Hawkins, P.T.; Šebo, Peter

    2017-01-01

    Roč. 198, č. 3 (2017), s. 1285-1296 ISSN 0022-1767 R&D Projects: GA ČR(CZ) GA13-14547S; GA MŠk(CZ) LM2015064 Institutional support: RVO:61388971 Keywords : BORDETELLA-PERTUSSIS * NADPH OXIDASE * CYCLIC-AMP Subject RIV: EE - Microbiology, Virology Impact factor: 4.856, year: 2016

  9. Organizational Health and Higher Education: Concept and Measurement Scale Development.

    Science.gov (United States)

    Klingele, William E.; Lyden, Julie A.; Vaughan, Beverly J.

    2001-01-01

    A scale to measure higher education institutions' organizational health was developed and tested using 198 survey responses. Scale dimensions include communication adequacy, participation/involvement, commitment/loyalty, morale, external reputation, ethics, performance recognition, goal alignment, leadership, development, and resource use.…

  10. Causes of delay among patients seen at the fracture clinic at Menilik ...

    African Journals Online (AJOL)

    Background: In the third world countries like Ethiopia most patients reach fracture clinic delayed often loosing the golden time. The objective of this study is to analyze the factors causing delays of patients from reaching to fracture clinic early for treatment.. Method: A cross sectional study of 198 patients seen at the Fracture ...

  11. Chaos in Family Law

    African Journals Online (AJOL)

    NWUuser

    198 (CC); Du Plessis v Road Accident Fund 2004 1 SA 359 (SCA); Gory v Kolver 2007 4 SA 97. (CC). The following legislation is applicable to both opposite-sex and same-sex life partnerships: Estate Duty Act 45 of 1955; Pension Funds Act 24 of 1956; Maintenance Act 99 of 1998. (applicable if parties agreed upon a duty ...

  12. The Dynamic Structure of Everyday Life

    Science.gov (United States)

    1988-10-12

    1986. Available as Technical Report 918, MIT Artificial Intelligence Lab- oratory, 1986. Pierre Bourdieu , Outline of a theory of practice, Cambridge...everyday cognition (see for example Bourdieu 1977, Garfinkel 1967, Lave 1988, Rogoff and Lave 1984, Scribner 198-1, Wertsch 1985). Much of this work is

  13. A Study among Bereaved Persons in Oyo and Oke-Ogun Areas

    African Journals Online (AJOL)

    User

    Mojoyinola, J. K. - Department of Social Work, Faculty of Education,. University of ... survey research design of the expost-facto type. The instruments ... The study established that social support had a significant impact on symptoms of emotional feelings associated with bereavement (F = 9.82, df = 1/198, P < .05), and also ...

  14. Raloxifene and body composition and muscle strength in postmenopausal women: a randomized, double-blind, placebo-controlled trial.

    NARCIS (Netherlands)

    Jacobsen, D.E.; Samson, M.M.; Emmelot-Vonk, M.H.; Verhaar, H.J.

    2010-01-01

    OBJECTIVE: To compare the effects of raloxifene and placebo on body composition and muscle strength. DESIGN: Randomized, double-blind, placebo-controlled trial involving 198 healthy women aged 70 years or older conducted between July 2003 and January 2008 at the University Medical Centre, Utrecht,

  15. A study of the behaviour of copper in different types of silicate glasses implanted with Cu+ and O+ ions

    Czech Academy of Sciences Publication Activity Database

    Švecová, B.; Vařák, P.; Vytykačová, S.; Nekvindová, P.; Macková, Anna; Malinský, Petr; Bottger, R.

    2017-01-01

    Roč. 406, SEP (2017), s. 193-198 ISSN 0168-583X R&D Projects: GA MŠk LM2015056; GA ČR GA15-01602S Institutional support: RVO:61389005 Keywords : silicate glasses * ion implantation * copper Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.109, year: 2016

  16. Beliefs and attitude towards Spectacles | Adeoti | Nigerian Journal of ...

    African Journals Online (AJOL)

    The study was conducted in order to discover the beliefs and attitude of the people towardswearing glasses in order to improve acceptance of glasses when prescribed thus reducing blindness and visual impairment due to uncorrected refractive errors. Across sectional study of 198 participants using a pretested structured ...

  17. Ghaffari et al., Afr J Tradit Complement Altern Med. (2016) 13(6):194 ...

    African Journals Online (AJOL)

    Ghaffari et al., Afr J Tradit Complement Altern Med. (2016) 13(6):194-198. 10.21010/ajtcam. v13i6.28. 194. CYTOTOXIC, α-CHYMOTRYPSIN AND UREASE INHIBITION ACTIVITIES OF THE PLANT. Heliotropium dasycarpum L. Muhammad Abuzar Ghaffari٭, Bashir Ahmed Chaudhary, Muhammad Uzair, Khuram Ashfaq.

  18. Carbon and nutrient deposition in a Mediterranean seagrass (Posidonia oceanica) meadow

    NARCIS (Netherlands)

    Gacia, E.; Duarte, C.M.; Middelburg, J.J.

    2002-01-01

    The annual depositional flux of carbon (C), nitrogen (N), and phosphorous (P) to the sediments under a northeast Spain Posidonia oceanica meadow was evaluated, and the sources and fate of the material deposited elucidated. The annual deposition of carbon represented 198 g C m-2 yr-1, 72% of which

  19. Dicty_cDB: Contig-U13698-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 198 ) EST_cclu_evb_461716 ccluevb mixed_tissue Coregonu... 44 6.1 1 ( EV250197 ) ...EST_cclu_evb_461332 ccluevb mixed_tissue Coregonu... 44 6.1 1 ( U97002 ) Caenorhabditis elegans cosmid K09H1

  20. 550 EAST AFRICAN MEDICAL JOURNAL

    African Journals Online (AJOL)

    2002-10-10

    Oct 10, 2002 ... Objective: To investigate the prevalence of cryptosporidiosis among groups at risk. (animal handlers) and among domestic animals. Design: Comparative study with zoonotic aspect. Method: Stool samples were collected from 60 animal handlers, 175 nonanimal handlers and 198 domestic animals (60 ...

  1. divine exultation and agony in the face of evil, a creation theodicy of ...

    African Journals Online (AJOL)

    Divine exultation and agony in the face of evil. 198. The scope of this article will be limited to the context of Genesis. 1-6, spanning creation, fall and God's assessment of events prior to the flood. The article will mainly focus on those aspects which refer to. God's exultation and agony and conclude with divine restraint.

  2. Chart context menu

    African Journals Online (AJOL)

    Colombia, 2. Congo, Republic, 6. Côte d'Ivoire, 10. Croatia, 2. Cuba, 1. Czech Republic, 3. Ecuador, 2. Egypt, Arab Rep. 10. Estonia, 1. Ethiopia, 17. Fiji, 3. Finland, 4. France, 39. Germany, 198. Ghana, 5. Greece, 4. Hong Kong SAR, China, 2. Hungary, 2. India, 990. Indonesia, 17. Iran, Islamic Rep. 104. Iraq, 9. Ireland, 1.

  3. Should Cops Be Spies? Evaluating the Collection and Sharing of National Security Intelligence by State, Local and Tribal Law Enforcement

    Science.gov (United States)

    2013-03-01

    more in depth discussion. 7 were civilian or military, the threat to their domains, legislative mandates and frequently political considerations... political considerations will continue to affect the efficient collection and sharing of classified domestic national security intelligence...police forces to private enterprises” (p. 198). Both Crumpton and Fathali Moghaddam have postulated globalization as a meme that has created new

  4. Nigerian Quarterly Journal of Hospital Medicine - Vol 9, No 3 (1999)

    African Journals Online (AJOL)

    Assessment Of Periodontal Status Of Nigerian Factory Workers In Relation To Cigarette Smoking In Lagos · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. KO Savage, BM Afolabi, MO John, 198-201. http://dx.doi.org/10.4314/nqjhm.v9i3.12377 ...

  5. Piezoelectric and Electrostrictive Materials for Transducer Applications. Volume 1

    Science.gov (United States)

    1990-01-31

    of the piezoelectric phase anglc. REFERENCES I. T. Yamaguchi and K. Humano . J. Ploys. Sc. Japuan. 50, 3956 (198 1). 2. G. ArIt. fi’rrurle ’r,*. 74. 37...PbO in relaxors, however, remains a major concern and their use in existing MLC manufacturing facilities requires substantial capital investment to

  6. Analysis of genetic polymorphism of nine short tandem repeat loci in ...

    African Journals Online (AJOL)

    Yomi

    2012-03-15

    Mar 15, 2012 ... The genotype distributions were in accordance with Hardy-Weinberg equilibrium (p>0.05). New core sequences were found in D2S1772, D7S3048, and D22GATA198B05 STR loci in Chinese Han population of Henan province, which were different from those of other populations. Two single-nucleotide.

  7. Validation of an abbreviated Vitalpac™ Early Warning Score (ViEWS) in 75,419 consecutive admissions to a Canadian regional hospital.

    LENUS (Irish Health Repository)

    Kellett, John

    2012-03-01

    The early warning score derived from 198,755 vital sign sets in the Vitalpac™ database (ViEWS) has an area under the receiver operator characteristic curve (AUROC) for death of acute unselected medical patients within 24h of 88%.

  8. EST Table: FY031853 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY031853 bmte29m11 11/11/04 50 %/198 aa ref|XP_966817.2| PREDICTED: similar to sorting and assembly machine...6817.2| PREDICTED: similar to sorting and assembly machinery component 50 homolog [Tribolium castaneum] FS904485 bmte ...

  9. EST Table: FY024994 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY024994 bmte10j11 11/11/04 50 %/198 aa ref|XP_966817.2| PREDICTED: similar to sorting and assembly machine...6817.2| PREDICTED: similar to sorting and assembly machinery component 50 homolog [Tribolium castaneum] FS904485 bmte ...

  10. EST Table: FY021932 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY021932 bmte1p20 11/11/04 50 %/198 aa ref|XP_966817.2| PREDICTED: similar to sorting and assembly machine...817.2| PREDICTED: similar to sorting and assembly machinery component 50 homolog [Tribolium castaneum] FS904485 bmte ...

  11. EST Table: FY025360 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY025360 bmte11j11 11/11/04 50 %/198 aa ref|XP_966817.2| PREDICTED: similar to sorting and assembly machine...6817.2| PREDICTED: similar to sorting and assembly machinery component 50 homolog [Tribolium castaneum] FS904485 bmte ...

  12. EST Table: FY026186 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY026186 bmte13o11 11/11/04 50 %/198 aa ref|XP_966817.2| PREDICTED: similar to sorting and assembly machine...6817.2| PREDICTED: similar to sorting and assembly machinery component 50 homolog [Tribolium castaneum] FS904485 bmte ...

  13. Lambing results obtained with imported Ile de France rarn semen

    African Journals Online (AJOL)

    Two batches of lle de France ram semen frozen in 0,5 ml straws were imported from France during April 1929 and. September 198'1. Ewes were synchronized and artificial insemination was carried out either 54,5 h (fixed time single insemination) after sponge withdrawal, or with a doubre insemination, 12 h after the onset ...

  14. On the genetic basis of temperature compensation of circadian clocks

    Indian Academy of Sciences (India)

    Unknown

    Rhythms 1, 187–198. Mattern D. L., Forman L. R. and Brody S. 1982 Circadian rhythms in Neurospora crassa: a mutation affecting tempera- ture compensation. Proc. Natl. Acad. Sci. USA 79, 825–829. Sawyer L, Hennessy M. J., Peixoto A. A., Rosato E., Parkinson. H., Costa R. and Kyriacou C. P. 1997 Natural variation in a.

  15. Changes in composition and structure of urban flora over 120 years: a case study of the city of Plzeň

    Czech Academy of Sciences Publication Activity Database

    Chocholoušková, Z.; Pyšek, Petr

    2003-01-01

    Roč. 198, - (2003), s. 366-376 ISSN 0367-2530 R&D Projects: GA AV ČR KSK6005114 Keywords : urban flora * historical dynamics * species diversity Subject RIV: EF - Botanics Impact factor: 0.882, year: 2003

  16. CO2 as Moderator for Biomass Gasification

    Czech Academy of Sciences Publication Activity Database

    Pohořelý, Michael; Jeremiáš, Michal; Svoboda, Karel; Kameníková, Petra; Skoblia, S.; Beňo, Z.

    2014-01-01

    Roč. 117, PART: A (2014), s. 198-205 ISSN 0016-2361 R&D Projects: GA MŠk(CZ) 7C11009 Grant - others:RFCS(XE) RFCR-CT-2010-0009 Institutional support: RVO:67985858 Keywords : dolomite * limestone * catalyst Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 3.520, year: 2014

  17. Environmental Statement on the Tactical Fighter Weapons Center (TFWC) Range Complex, Nellis Air Force Base

    Science.gov (United States)

    1977-03-10

    Regulus calendula cineaceus Ruby-crowned Kinglet 197. Anthus spinoietta rubescens Water Pipit 198. Bombycilla cedrorum Cedar Waxwing 199. Phainopela nitens...velifer White River Speckled Dace 13. Moapa coriacea* ** Moapa Dace 14. Cyprinus carpio Asian Carp 15. Lepidomeda mollispinus pratensis Big Spring

  18. : tous les projets | Page 391 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    , Mexico, Uruguay. Financement total : CA$ 1,549,100.00 ... Financement total : CA$ 198,300.00. Agriculture itinérante : promotion de solutions novatrices en matière de politiques et de développement dans l'est de l'Himalaya. Projet. De façon ...

  19. 77 FR 62258 - Notice of November 3, 2012, Meeting for Flight 93 National Memorial Advisory Commission

    Science.gov (United States)

    2012-10-12

    ... [Federal Register Volume 77, Number 198 (Friday, October 12, 2012)] [Notices] [Page 62258] [FR Doc No: 2012-25098] DEPARTMENT OF INTERIOR National Park Service [NPS-NERO-FLNI-11426; 4140-SZD] Notice of November 3, 2012, Meeting for Flight 93 National Memorial Advisory Commission AGENCY: National...

  20. Prevalence of hePatitis c virus and its genotyPes among a cohort of ...

    African Journals Online (AJOL)

    2008-07-07

    Jul 7, 2008 ... Genotype 4. Genotype 3. Genotype 1. K170. K38. K154. K198. K77. K171. K51. K26 ... showed that most (65%) persons with Hcv infection were 30-39 years of .... 8. ray, s.c., arthur, r.r., carella, a., et al. genetic epidemiology of ...

  1. the conductivity of c'ervical mucus as a predictor of ovulation in beef ...

    African Journals Online (AJOL)

    S Afr .l Anim. \\c'i. 10, I 19 i 24 (198A'. THE CONDUCTIVITY OF C'ERVICAL MUCUS AS A PREDICTOR OF OVULATION. IN BEEF COWS SYNCHRONISED WITH CLOPROSTENOL. Receipt of MS 1646-1980. C.T. McCabe, G.W. Sprowson and D.H. Holness. Henderson Research Smrion, P. Bag 222A, Salisbury, Zimbabwe.

  2. Modernizing China’s Military: Opportunities and Constraints

    Science.gov (United States)

    2005-01-01

    particular, labor-intensive goods and services like handicrafts , housing, haircuts, dry cleaning, and health care that are consumed locally and that...cause of substantial regional tension. However, since 1991, China has settled disputes with Laos, Russia, Kazakhstan , Kyrgyzstan, Vietnam, and...Phil- ippines, Brunei, Laos, Kazakhstan , and Kyrgyzstan. 198 Modernizing China’s Military: Opportunities and Constraints paramount for the PLA at

  3. Powerful pictures: popular Christian aesthetics in southern Ghana

    NARCIS (Netherlands)

    Meyer, B.

    2008-01-01

    If images are life-forms, and objects are the body they animate, then media are the habitats or ecosystems in which pictures become alive. (Mitchell 2005: 198) Situated in an approach of religion in Africa that stresses the need to move beyond essentializing oppositions of Africa and the West, this

  4. Comparison of dust released from sanding conventional and nanoparticle-doped wall and wood coatings

    National Research Council Canada - National Science Library

    Koponen, Ismo Kalevi; Jensen, Keld Alstrup; Schneider, Thomas

    2011-01-01

    .... This study investigates the particle size distributions (5.6 nm-19.8 μm) and the total number of dust particles generated during sanding of ENP-doped paints, lacquers, and fillers as compared to their conventional counterparts...

  5. Transformation Toughening of Ceramics

    Science.gov (United States)

    1992-03-01

    chanical twing of ualaneeting Ceramica at High Temperatures. ILondo, Patigue-crack growth in overaged and partially stabi- U.K., 198.""IS. Itoribe... Ceramica " Chapter 18 In Mechanical Prop- ŗR. M. !AcMeeding and A. 0. Evans, ’Mechanics of Transformation ertles of Engineering Ceramics. Edited by W.W

  6. On System Scalability

    Science.gov (United States)

    2006-03-01

    Prediction for EJB Applications: A Sta- tistical Analysis, Software Engineering and Middleware,” 185–198. Proceedings of the Software Engineering and...doi.ieeecomputersociety.org/10.1109/APSEC.2002.1182977. Liu 04a Liu, Y. & Gorton, I. “Accuracy of Performance Prediction for EJB Applica- tions: A Statistical Analysis

  7. South African Journal of Animal Science - Vol 40, No 3 (2010)

    African Journals Online (AJOL)

    Characteristic of slaughter value and meat quality of three synthetic pig lines · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. W Przybylski, D Jaworska, E Olczak, I Namysław, K Kajak-Siemaszko, V Santé-Lhoutellier, S Niemyjski, 198-203.

  8. 75 FR 47263 - Certain Hot-Rolled Flat-Rolled Carbon-Quality Steel Products From the Russian Federation; Final...

    Science.gov (United States)

    2010-08-05

    ... effects of termination of the suspension agreement and underlying investigation and the magnitude of the... nickel, or 0.30 percent of tungsten, or 0.012 percent of boron, or 0.10 percent of molybdenum, or 0.10... = 44.80 inches maximum; Thickness = 0.063-0.198 inches; Yield Strength = 50,000 ksi minimum; Tensile...

  9. An Investigation into the Academic Success of Prospective Teachers in Terms of Learning Strategies, Learning Styles and the Locus of Control

    Science.gov (United States)

    Akça, Figen

    2013-01-01

    The present research aims to investigate the relationship between the learning strategies, learning styles, the locus of control and the academic success of prospective teachers. The study group consists of 198 university students in various departments at the Uludag University Faculty of Education. Research data were collected with the Locus of…

  10. Asian Student Depression in American High Schools: Differences in Risk Factors

    Science.gov (United States)

    Song, Suzan J.; Ziegler, Robert; Arsenault, Lisa; Fried, Lise E.; Hacker, Karen

    2011-01-01

    There are inconsistent findings about depression in Asians. This study examined risk factors for depression in Asian and Caucasian adolescents. Stratified bivariate secondary analyses of risk indicators and depressed mood were performed in this cross-sectional study of high school survey data (9th to 12th grades) from 2,542 students (198 Asian).…

  11. All projects related to South Africa | Page 7 | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2008-12-01

    Total Funding: CA$ 198,300.00. ICT Access and Usage in Higher Education in South Africa. Project. The assumption underlying information and communication technology (ICT) in higher education policy is that increased access to ICT leads to greater use of ICT. Start Date: December 1, 2008. End Date: September 20, ...

  12. Students' Knowledge of AIDS and Their Attitudes toward Gay Men and Lesbian Women.

    Science.gov (United States)

    Grieger, Ingrid; Ponterotto, Joseph G.

    1988-01-01

    Assessed students' (N=198) knowledge of Acquired Immune Deficiency Syndrome (AIDS) specific facts, their attitudes toward people with AIDS, and their general attitudes toward homosexual men and lesbian women. Found most subjects accurately informed on the subject of AIDS. Most held neither negative views toward homosexuality nor punitive views…

  13. 38 CFR 21.6050 - Participation of eligible veterans in an evaluation.

    Science.gov (United States)

    2010-07-01

    ... VETERANS AFFAIRS (CONTINUED) VOCATIONAL REHABILITATION AND EDUCATION Temporary Program of Vocational... (VR&E) staff as provided in §§ 21.197(c)(4) and 21.198(d). (Authority: 38 U.S.C. 1524(a); Pub. L. 100...

  14. Research in Biological and Medical Sciences Including Biochemistry, Communicable Disease and Immunology, Internal Medicine, Physiology, Psychiatry, Surgery, and Veterinary Medicine. Volume 1

    Science.gov (United States)

    1979-09-01

    development of scrub typhus ricket - tsiae in a colony of vector mites. Trans. R. Soc. Trop. Med. Hyg., 63: 251-58, 1969. 13. Rapmund, G., A. L. Dohany...Lovelace Inhalation Toxicology Research Insticute in Albuquerque, New Mexico is being utilized to simulate the M198/M203 pressure patterns. The

  15. AcEST: BP913315 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rotein C1orf198 OS=Homo s... 30 6.7 sp|P03123|VE2_PAPVD Probable regulatory protein E2 OS=Deer papil... 29 8...21 GEKVLPP 227 >sp|P03123|VE2_PAPVD Probable regulatory protein E2 OS=Deer papillomavirus GN=E2 PE=3 SV=2 Le

  16. Computer-aided diagnosis with temporal analysis to improve radiologists' interpretation of mammographic mass lesions.

    NARCIS (Netherlands)

    Timp, S.; Varela, C.; Karssemeijer, N.

    2010-01-01

    The purpose of this study was to evaluate the effect of independent reading with computer-aided diagnosis (CAD) and independent double reading on radiologists' performance to characterize mass lesions on serial mammograms. Six radiologists rated 198 cases, 99 benign and 99 malignant. For each case,

  17. Stereotype Threat Effects on African American Children in an Urban Elementary School

    Science.gov (United States)

    Wasserberg, Martin J.

    2014-01-01

    This study investigated whether a diagnostic testing condition leads to stereotype threat effects for African American children (n = 198) at an urban elementary school. Results indicated that presenting a reading test as diagnostic of abilities hindered the performance of African American children aware of racial stereotypes but not of those…

  18. HoB4 at high pressure and low temperature: an experimental and theoretical study

    DEFF Research Database (Denmark)

    Olsen, J. Staun; Waśkowska, A.; Gerward, Leif

    2011-01-01

    Single crystals of HoB4 have been grown and used for synchrotron X-ray diffraction studies at pressures up to 23GPa and temperatures down to 100K. The experimental bulk modulus 195 ± 6GPa is in good agreement with 188.4 and 198.2GPa values calculated in the LSDA and LSDA+U approximations, indicat...

  19. Facilitating community building in Learning Networks through peer tutoring in ad hoc transient communities

    NARCIS (Netherlands)

    Kester, Liesbeth; Sloep, Peter; Van Rosmalen, Peter; Brouns, Francis; Koné, Malik; Koper, Rob

    2006-01-01

    De volledige referentie is: Kester, L., Sloep, P. B., Van Rosmalen, P., Brouns, F., Koné, M., & Koper, R. (2007). Facilitating Community Building in Learning Networks Through Peer-Tutoring in Ad Hoc Transient Communities. International Journal of Web based Communities, 3(2), 198-205.

  20. 80 - 82 Taura Anthropometric

    African Journals Online (AJOL)

    DR. AMIN

    the various interactions between genetic, biochemical ... share genetic background and environmental factors, average height is frequently ... In sports like basket ball height can be an advantage where the average height of the players is about 1.98 m. Other sports where height can be an advantage or disadvantage ...