WorldWideScience

Sample records for astatine 197

  1. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  2. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-09-15

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Discovery of the astatine, radon, francium, and radium isotopes

    Science.gov (United States)

    Fry, C.; Thoennessen, M.

    2013-09-01

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration

    2011-11-30

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  6. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Science.gov (United States)

    Uusitalo, J.; Jakobsson, U.

    2011-11-01

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  7. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy.

    Science.gov (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  9. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others

    2015-10-15

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  10. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Science.gov (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.

    2015-10-01

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  11. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  12. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  13. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  14. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  15. α decay of the very neutron-deficient isotopes 197-199Fr

    Science.gov (United States)

    Kalaninová, Z.; Andreyev, A. N.; Antalic, S.; Heßberger, F. P.; Ackermann, D.; Andel, B.; Drummond, M. C.; Hofmann, S.; Huyse, M.; Kindler, B.; Lane, J. F. W.; Liberati, V.; Lommel, B.; Page, R. D.; Rapisarda, E.; Sandhu, K.; Šáro, Š.; Thornthwaite, A.; Van Duppen, P.

    2013-04-01

    Decay properties of the very neutron-deficient isotopes 197-199Fr were studied at the velocity filter Separator for Heavy Ion reaction Products (SHIP) at GSI in Darmstadt. The isotopes were produced in the 2n-4n evaporation channels of the fusion-evaporation reaction 60Ni+141Pr → 201Fr*. Improved α-decay properties of 199Fr were determined and the possible existence of two α-decaying states in this nucleus is discussed. For the isotope 198Fr a broad α-decay energy distribution was detected in the range of (7470-7930) keV and two α-decaying states were observed with half-lives of 1.1(7) and 15(3) ms. The new isotope 197Fr was identified based on the observation of one α-decay chain yielding Eα=7728(15) keV and T1/2=0.6-0.3+3.0 ms. The systematics of reduced α-decay widths are presented for neutron-deficient francium, radon, and astatine isotopes.

  16. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  17. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  18. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  19. 46 CFR 197.550 - Respiratory protection.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Respiratory protection. 197.550 Section 197.550 Shipping... GENERAL PROVISIONS Benzene § 197.550 Respiratory protection. (a) General. When the use of respirators in... section that is appropriate for the exposure. Table 197.550(b)—Respiratory Protection for Benzene Airborne...

  20. 197

    African Journals Online (AJOL)

    the bladder as in this case. The urethrogram also indicates the degree of hydronephrosis and may reveal a duplicated kidney (5). In this particular case there was no evidence of a duplex. Sonography has replaced the excretory urography in most centres, as for this case the ureterocele was clearly demonstrated with very.

  1. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study

    Science.gov (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi

    2018-01-01

    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).

  2. 46 CFR 197.430 - SCUBA diving.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false SCUBA diving. 197.430 Section 197.430 Shipping COAST... GENERAL PROVISIONS Commercial Diving Operations Specific Diving Mode Procedures § 197.430 SCUBA diving. The diving supervisor shall insure that— (a) SCUBA diving is not conducted— (1) Outside the no...

  3. 46 CFR 197.336 - Pressure piping.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Pressure piping. 197.336 Section 197.336 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE OCCUPATIONAL SAFETY AND HEALTH STANDARDS GENERAL PROVISIONS Commercial Diving Operations Equipment § 197.336 Pressure piping. Piping systems that...

  4. 46 CFR 197.535 - Regulated areas.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Regulated areas. 197.535 Section 197.535 Shipping COAST... GENERAL PROVISIONS Benzene § 197.535 Regulated areas. (a) Based on the employer's evaluation of the environmental monitoring, whenever the airborne concentration of benzene within an area exceeds or reasonably...

  5. 46 CFR 197.460 - Diving equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Diving equipment. 197.460 Section 197.460 Shipping COAST... GENERAL PROVISIONS Commercial Diving Operations Periodic Tests and Inspections of Diving Equipment § 197.460 Diving equipment. The diving supervisor shall insure that the diving equipment designated for use...

  6. 32 CFR 197.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 197.5 Section 197.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS HISTORICAL RESEARCH IN THE FILES OF THE OFFICE OF THE SECRETARY OF DEFENSE (OSD) § 197.5 Responsibilities. (a...

  7. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  8. 21 CFR 1.97 - Bonds.

    Science.gov (United States)

    2010-04-01

    ... by the owner or consignee on the appropriate form of a customs single-entry or term bond, containing... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Bonds. 1.97 Section 1.97 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL GENERAL ENFORCEMENT REGULATIONS...

  9. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  10. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  11. NUHOMS {sup registered} - MP197 transport cask

    Energy Technology Data Exchange (ETDEWEB)

    Shih, P. [Transnuclear, Inc. (AREVA Group) (United States); Sicard, D.; Michels, L. [COGEMA Logistics (AREVA Group) (France)

    2004-07-01

    The NUHOMS {sup registered} -MP197 cask is an optimized transport design which can be loaded in the spent fuel pool (wet loading) or loaded the canister from the NUHOMS concrete modules at the ISFSI site. With impact limiters attached, the package can be transported within the states or world-wide. The NUHOMS {sup registered} -MP197 packaging can be used to transport either BWR or PWR canisters. The NUHOMS {sup registered} -MP197 cask is designed to the ASME B and PV Code and meets the requirements of Section III, Division 3 for Transport Packaging. The cask with impact limiters has undergone drop testing to verify the calculated g loadings during the 9m drops. The test showed good correlation with analytical results and demonstrate that the impact limiters stay in place and protect the package and fuel during the hypothetical accidents.

  12. 46 CFR 197.314 - First aid and treatment equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false First aid and treatment equipment. 197.314 Section 197... HEALTH STANDARDS GENERAL PROVISIONS Commercial Diving Operations Equipment § 197.314 First aid and... consists of— (i) Basic first aid supplies; and (ii) Any additional supplies necessary to treat minor trauma...

  13. 46 CFR 197.454 - First aid and treatment equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false First aid and treatment equipment. 197.454 Section 197.454 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE OCCUPATIONAL SAFETY AND... Equipment § 197.454 First aid and treatment equipment. The diving supervisor shall ensure that medical kits...

  14. 46 CFR 197.320 - Diving ladder and stage.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Diving ladder and stage. 197.320 Section 197.320... STANDARDS GENERAL PROVISIONS Commercial Diving Operations Equipment § 197.320 Diving ladder and stage. (a) Each diving ladder must— (1) Be capable of supporting the weight of at least two divers; (2) Extend 3...

  15. 46 CFR 197.432 - Surface-supplied air diving.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Surface-supplied air diving. 197.432 Section 197.432... STANDARDS GENERAL PROVISIONS Commercial Diving Operations Specific Diving Mode Procedures § 197.432 Surface-supplied air diving. The diving supervisor shall insure that— (a) Surface-supplied air diving is conducted...

  16. 46 CFR 197.210 - Designation of diving supervisor.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Designation of diving supervisor. 197.210 Section 197... HEALTH STANDARDS GENERAL PROVISIONS Commercial Diving Operations General § 197.210 Designation of diving supervisor. The name of the diving supervisor for each commercial diving operation shall be— (a) Designated...

  17. 46 CFR 197.334 - Open diving bells.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Open diving bells. 197.334 Section 197.334 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE OCCUPATIONAL SAFETY AND HEALTH STANDARDS GENERAL PROVISIONS Commercial Diving Operations Equipment § 197.334 Open diving bells. Each open diving...

  18. 47 CFR 87.197 - ELT test procedures.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false ELT test procedures. 87.197 Section 87.197... Aircraft Stations Emergency Locator Transmitters § 87.197 ELT test procedures. ELT testing must avoid... with the ELT terminated into a dummy load. ...

  19. 46 CFR 197.555 - Personal protective clothing and equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Personal protective clothing and equipment. 197.555... SAFETY AND HEALTH STANDARDS GENERAL PROVISIONS Benzene § 197.555 Personal protective clothing and equipment. (a) When the use of respirators in compliance with § 197.550 and the personal protective clothing...

  20. 46 CFR 197.575 - Observation of monitoring.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Observation of monitoring. 197.575 Section 197.575... STANDARDS GENERAL PROVISIONS Benzene § 197.575 Observation of monitoring. (a) Persons involved in benzene.... (b) When observation of monitoring requires entry into regulated areas, the observers shall use...

  1. 12 CFR 19.7 - Good faith certification.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Good faith certification. 19.7 Section 19.7... PROCEDURE Uniform Rules of Practice and Procedure § 19.7 Good faith certification. (a) General requirement... warranted by existing law or a good faith argument for the extension, modification, or reversal of existing...

  2. 46 CFR 197.340 - Breathing gas supply.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Breathing gas supply. 197.340 Section 197.340 Shipping... GENERAL PROVISIONS Commercial Diving Operations Equipment § 197.340 Breathing gas supply. (a) A primary breathing gas supply for surface-supplied diving must be sufficient to support the following for the...

  3. 46 CFR 197.312 - Breathing supply hoses.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Breathing supply hoses. 197.312 Section 197.312 Shipping... GENERAL PROVISIONS Commercial Diving Operations Equipment § 197.312 Breathing supply hoses. (a) Each breathing supply hose must— (1) Have a maximum working pressure that is equal to or exceeds— (i) The maximum...

  4. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  5. Initial Eccentricity in Deformed 197Au+197Au and 238U+238U Collisions at RHIC

    Energy Technology Data Exchange (ETDEWEB)

    Filip, Peter; Lednicky, Richard; Masui, Hiroshi; Xu, Nu

    2010-07-07

    Initial eccentricity and eccentricity fluctuations of the interaction volume created in relativistic collisions of deformed {sup 197}Au and {sup 238}U nuclei are studied using optical and Monte-Carlo (MC) Glauber simulations. It is found that the non-sphericity noticeably influences the average eccentricity in central collisions and eccentricity fluctuations are enhanced due to deformation. Quantitative results are obtained for Au+Au and U+U collisions at energy {radical}s{sub NN} = 200 GeV.

  6. 46 CFR 197.404 - Responsibilities of the diving supervisor.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Responsibilities of the diving supervisor. 197.404... SAFETY AND HEALTH STANDARDS GENERAL PROVISIONS Commercial Diving Operations Operations § 197.404 Responsibilities of the diving supervisor. (a) The diving supervisor shall— (1) Be fully cognizant of the...

  7. 42 CFR 84.197 - Respirator containers; minimum requirements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Respirator containers; minimum requirements. 84.197... Cartridge Respirators § 84.197 Respirator containers; minimum requirements. Respirators shall be equipped with a substantial, durable container bearing markings which show the applicant's name, the type and...

  8. 40 CFR 98.197 - Records that must be retained.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Records that must be retained. 98.197... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Lime Manufacturing § 98.197 Records that must be retained. In addition to the records required by § 98.3(g), you must retain the records specified in paragraphs (a) and...

  9. 30 CFR 19.7 - Protection against explosion hazard.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Protection against explosion hazard. 19.7..., EVALUATION, AND APPROVAL OF MINING PRODUCTS ELECTRIC CAP LAMPS § 19.7 Protection against explosion hazard. Unless properly designed, electric cap lamps may present two sources of probable explosion hazards...

  10. 46 CFR 197.456 - Breathing supply hoses.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Breathing supply hoses. 197.456 Section 197.456 Shipping....456 Breathing supply hoses. (a) The diving supervisor shall insure that— (1) Each breathing supply....5 times its maximum working pressure; (2) Each breathing supply hose assembly, prior to being placed...

  11. 14 CFR 21.197 - Special flight permits.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Special flight permits. 21.197 Section 21... CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS Airworthiness Certificates § 21.197 Special flight permits. (a) A special flight permit may be issued for an aircraft that may not currently meet applicable...

  12. Meningitis in Children: Evaluation of 197 Patients

    Directory of Open Access Journals (Sweden)

    Ali Gunes

    2016-01-01

    Full Text Available Aim: The aim of our study was to evaluate the epidemiologic, clinic and laboratory results and the answers to treatment of meningitis cases. Material and Method: In this study, the epidemiologic, clinic and laboratory results of 197 patients hospitalized with central nervous system infection diagnosis in the Department of Pediatric Health and Diseases of the Faculty of Medicine of Dicle University between 1st of January 2003 and 1st of January 2006 have been studied retrospectively. The files have been studied in details for age, sex, complaints, and results of physical examination, laboratory results, radiological results and treatments applied. Results: 118 of the patients were male, 79 were women and the mean age calculated was 62,2±47,3 months.137, 27 and 33 patients have been respectively considered as ABM, AM and TM. The most frequent complaints of application to hospital were fever (95,4%, vomiting (82,7%, headache (45,6% and change of consciousness (21,3%. The presence of many risks about meningitis has been observed. The most frequent risk factors were head trauma history, parenchymal lung tuberculosis, military tuberculosis, presence of V-P shunt, meningocele, varicella history, having mumps, and the presence of purulent ear discharge. BOS has developed in 7 patients and for five patients, reproduction occurred in blood culture. The most important central nervous system sequels or complications were in order of frequency hydrocephalies requiring the installation of V-P shunt, brain edema, epilepsies, subdural effusions, tuberculoma, retention of head pair, and brain apses. The rate of mortality was (% 13,1. Discussion: During the period of execution of the study, the mortality and morbidity of central nervous system diseases were still at high risk. But this may be associated to the absence of vaccination programs for frequent meningitis factors such as pneumococcus and H. influenza were not in routine vaccination program in our

  13. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.

    2017-04-01

    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  14. Freeze-out configuration properties in the 197Au + 197Au reaction at 23 AMeV

    CERN Document Server

    Najman, R; Sochocka, A; Amorini, F; Auditore, L; Cap, T; Cardella, G; De Filippo, E; Geraci, E; Grzeszczuk, A; Kowalski, S; Kozik, T; Lanzalone, G; Lombardo, I; Majka, Z; Nicolis, N G; Pagano, A; Piasecki, E; Pirrone, S; Politi, G; Rizzo, F; Russotto, P; Siwek-Wilczynska, K; Skwira-Chalot, I; Trifiro, A; Trimarchi, M; Wilczynski, J; Zipper, W

    2015-01-01

    Data from the experiment on the 197Au + 197Au reaction at 23 AMeV are analyzed with an aim to find signatures of exotic nuclear configurations such as toroid-shaped objects. The experimental data are compared with predictions of the ETNA code dedicated to look for such configurations and with the QMD model. A novel criterion of selecting events possibly resulting from the formation of exotic freeze-out configurations, "the efficiency factor", is tested. Comparison between experimental data and model predictions may indicate for the formation of flat/toroidal nuclear systems.

  15. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination.

    Science.gov (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick

    2007-01-01

    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  16. ZNF 197L is dispensable in mouse development | Tang | African ...

    African Journals Online (AJOL)

    ZNF 197L is dispensable in mouse development. R Tang, G Xu, A Kimi, J Shen, Z Li, K Yamamura, H Tang. Abstract. The gene trap technique is a newly powerful approach for characterizing and mutating genes in mouse. We used gene trap method to identify mice gene of unknown function and to establish their mouse line ...

  17. Phenotype abnormality: 197 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 197 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u703i decreased number... of stomatal complex in organ named hypocotyl ... hypocotyl ... present in fewer numbers in organism ... stomatal complex ...

  18. 37 CFR 2.197 - Certificate of mailing or transmission.

    Science.gov (United States)

    2010-07-01

    ..., DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES General Information and Correspondence in Trademark Cases § 2.197 Certificate of mailing or transmission. (a) Except in the cases enumerated in... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Certificate of mailing or...

  19. 38 CFR 17.197 - Amount of aid payable.

    Science.gov (United States)

    2010-07-01

    ... 1741(a)(1) for domiciliary care; and section 1741(a)(3) for hospital care. In no case shall the payments made with respect to any veteran exceed one-half of the cost of the veteran's care in the State... to States for Care of Veterans in State Homes § 17.197 Amount of aid payable. The amount of aid...

  20. Phenotype-gene: 197 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 197 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1195i decreased size for quantity.../metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u12566580i decreased size for quantity of inflorescence http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u721i AT2G26330

  1. 46 CFR Appendix A to Part 197 - Air No-Decompression Limits

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Air No-Decompression Limits A Appendix A to Part 197 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE OCCUPATIONAL SAFETY AND HEALTH STANDARDS GENERAL PROVISIONS Pt. 197, App. A Appendix A to Part 197—Air No-Decompression Limits The...

  2. 15 CFR 19.7 - When will Commerce entities compromise a Commerce debt?

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false When will Commerce entities compromise a Commerce debt? 19.7 Section 19.7 Commerce and Foreign Trade Office of the Secretary of Commerce COMMERCE DEBT COLLECTION Procedures To Collect Commerce Debts § 19.7 When will Commerce entities compromise...

  3. 40 CFR 197.26 - What are the circumstances of the human intrusion?

    Science.gov (United States)

    2010-07-01

    ... human intrusion? 197.26 Section 197.26 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... YUCCA MOUNTAIN, NEVADA Public Health and Environmental Standards for Disposal Human-Intrusion Standard § 197.26 What are the circumstances of the human intrusion? For the purposes of the analysis of human...

  4. O:2-CRM(197) conjugates against Salmonella Paratyphi A.

    Science.gov (United States)

    Micoli, Francesca; Rondini, Simona; Gavini, Massimiliano; Lanzilao, Luisa; Medaglini, Donata; Saul, Allan; Martin, Laura B

    2012-01-01

    Enteric fevers remain a common and serious disease, affecting mainly children and adolescents in developing countries. Salmonella enterica serovar Typhi was believed to cause most enteric fever episodes, but several recent reports have shown an increasing incidence of S. Paratyphi A, encouraging the development of a bivalent vaccine to protect against both serovars, especially considering that at present there is no vaccine against S. Paratyphi A. The O-specific polysaccharide (O:2) of S. Paratyphi A is a protective antigen and clinical data have previously demonstrated the potential of using O:2 conjugate vaccines. Here we describe a new conjugation chemistry to link O:2 and the carrier protein CRM(197), using the terminus 3-deoxy-D-manno-octulosonic acid (KDO), thus leaving the O:2 chain unmodified. The new conjugates were tested in mice and compared with other O:2-antigen conjugates, synthesized adopting previously described methods that use CRM(197) as carrier protein. The newly developed conjugation chemistry yielded immunogenic conjugates with strong serum bactericidal activity against S. Paratyphi A.

  5. A clinical trial examining the effect of increased total CRM(197) carrier protein dose on the antibody response to Haemophilus influenzae type b CRM(197) conjugate vaccine.

    Science.gov (United States)

    Usonis, Vytautas; Bakasenas, Vytautas; Lockhart, Stephen; Baker, Sherryl; Gruber, William; Laudat, France

    2008-08-18

    CRM(197) is a carrier protein in certain conjugate vaccines. When multiple conjugate vaccines with the same carrier protein are administered simultaneously, reduced response to vaccines and/or antigens related to the carrier protein may occur. This study examined responses of infants who, in addition to diphtheria toxoid/tetanus toxoid/acellular pertussis vaccine (DTaP) received either diphtheria CRM(197)-based Haemophilus influenzae type b conjugate vaccine (HbOC) or HbOC and a diphtheria CRM(197)-based combination 9-valent pneumococcal conjugate vaccine/meningococcal group C conjugate vaccine. Administration of conjugate vaccines with CRM(197) carrier protein load >50 microg did not reduce response to CRM(197) conjugate vaccines or immunogenicity to immunologically cross-reactive diphtheria toxoid.

  6. Experimental and evaluated photoneutron cross sections for 197Au

    Science.gov (United States)

    Varlamov, V.; Ishkhanov, B.; Orlin, V.

    2017-10-01

    There is a serious well-known problem of noticeable disagreements between the partial photoneutron cross sections obtained in various experiments. Such data were mainly determined using quasimonoenergetic annihilation photon beams and the method of neutron multiplicity sorting at Lawrence Livermore National Laboratory (USA) and Centre d'Etudes Nucleaires of Saclay (France). The analysis of experimental cross sections employing new objective physical data reliability criteria has shown that many of those are not reliable. The IAEA Coordinated Research Project (CRP) on photonuclear data evaluation was approved. The experimental and previously evaluated cross sections of the partial photoneutron reactions (γ ,1 n ) and (γ ,2 n ) on 197Au were analyzed using the new data reliability criteria. The data evaluated using the new experimental-theoretical method noticeably differ from both experimental data and data previously evaluated using nuclear modeling codes gnash, gunf, alice-f, and others. These discrepancies needed to be resolved.

  7. α-induced reaction cross section measurements on 197Au

    Science.gov (United States)

    Szücs, Tamás; Gyürky, György; Halász, Zoltán; Kiss, Gábor Gy.; Fülöp, Zsolt

    2018-01-01

    The γ-process is responsible for creating the majority of the isotopes of heavier elements on the proton rich side of the valley of stability. The γ-process simulations fail to reproduce the measured solar system abundance of these isotopes. The problem can lie in the not well known astrophysical scenarios where the process takes place, or in the not sufficiently known nuclear physics input. To improve the latter part, α-induced reaction cross section measurements on 197Au were carried out at Atomki. With this dataset new experimental information will become available, which can be later used as validation of the theoretical cross section calculations used in the γ-process simulations.

  8. 46 CFR 197.434 - Surface-supplied mixed-gas diving.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Surface-supplied mixed-gas diving. 197.434 Section 197....434 Surface-supplied mixed-gas diving. The diving supervisor shall insure that— (a) When mixed-gas... supply meeting the requirements of § 197.340; and (k) The surface-supplied mixed-gas diver has the...

  9. Potential protective immunogenicity of tetanus toxoid, diphtheria toxoid and Cross Reacting Material 197 (CRM197) when used as carrier proteins in glycoconjugates.

    Science.gov (United States)

    Bröker, Michael

    2016-03-03

    When tetanus toxoid (TT), diphtheria toxoid (DT) or Cross Reacting Material 197 (CRM197), a non-toxic diphtheria toxin mutant protein, are used as carrier proteins in glycoconjugate vaccines, these carriers induce a protein specific antibody response as measured by in vitro assays. Here, it was evaluated whether or not glycoconjugates based on TT, DT or CRM197 can induce a protective immune response as measured by potency tests according to the European Pharmacopoeia. It could be shown, that the conjugate carriers TT and DT can induce a protective immune response against a lethal challenge by toxins in animals, while glycoconjugates based on CRM197 failed to induce a protective immune response. Opportunities for new applications of glycoconjugates are discussed.

  10. The ({gamma},p) reaction in {sup 197}Au

    Energy Technology Data Exchange (ETDEWEB)

    Tamae, T. E-mail: tamae@lns.tohoku.ac.jp; Hino, T.; Kawahara, H.; Nomura, M.; Sugawara, M.; Tanaka, A.; Tanaka, T.; Tsubota, H.; Yokokawa, T.; Yoshida, T.K

    2001-07-30

    Proton energy spectra of the {sup 197}Au(e,p) reaction were measured in the region between 17 and 30 MeV at three angles: 40 deg. , 90 deg. and 140 deg. . Two prominent bumps were observed in the ({gamma},p) spectra converted using virtual photon theory. The higher-energy bump shifts with photon energies and the lower-energy one stays at 10.5 MeV. The higher-energy bump is much larger at 40 deg. than at 140 deg. ; on the contrary the angular dependence of the lower-energy bump is small. Neither bump can be described by a statistical calculation. A calculation of a microscopic shell model shows that the lower-energy bump is attributed to the decay of proton-particle-neutron-hole pairs in the T{sub >} states, leaving a neutron hole around the Fermi surface. The higher-energy bump can be ascribed to the direct-semidirect mechanism. This paper gives the solution to a part of the long-standing question about the origin of photo-proton emission in heavy nuclei.

  11. 32 CFR Appendix G to Part 197 - Procedures for Copying Documents

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Procedures for Copying Documents G Appendix G to.... 197, App. G Appendix G to Part 197—Procedures for Copying Documents 1. The records will be reviewed... requires that certain types of documents be tabbed for easy identification. Any tabs removed during the...

  12. 10 CFR 431.197 - Manufacturer's determination of efficiency for distribution transformers.

    Science.gov (United States)

    2010-01-01

    ... basic model over a reasonable period of time (approximately 180 days), then it must test each unit... 10 Energy 3 2010-01-01 2010-01-01 false Manufacturer's determination of efficiency for distribution transformers. 431.197 Section 431.197 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION ENERGY...

  13. 9 CFR 381.197 - Imported products; foreign inspection certificates required.

    Science.gov (United States)

    2010-01-01

    ... certificates required. 381.197 Section 381.197 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION... Shipping marks (Signature) (Name of official of national foreign government authorized to issue inspection...

  14. 33 CFR 110.197 - Galveston Harbor, Bolivar Roads Channel, Texas.

    Science.gov (United States)

    2010-07-01

    ... Channel, Texas. 110.197 Section 110.197 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Roads Channel, Texas. (a)(1) Anchorage area (A). The water bounded by a line connecting the following... VHF-FM channels 12 (156.60 MHz) or 13 (156.65 MHz). (3) No vessel with a draft of less than 22 feet...

  15. The crosstalk between IL-22 signaling and miR-197 in human keratinocytes.

    Directory of Open Access Journals (Sweden)

    Galya Lerman

    Full Text Available The interaction between the immune system and epithelial cells is tightly regulated. Aberrations of this balance may result in inflammatory diseases such as psoriasis, inflammatory bowel disease and rheumatoid arthritis. IL-22 is produced by Th17, Th22 and Th1 cells. Putative targets for IL-22 are cells in the skin, kidney, digestive and respiratory systems. The highest expression of IL-22 receptor is found in the skin. IL-22 plays an important role in the pathogenesis of T cell-mediated inflammatory diseases such as psoriasis, inflammatory bowel disease and rheumatoid arthritis. Recently, we found that miR-197 is down regulated in psoriatic lesions. In the present work we show that miR-197 over expression inhibits keratinocytes proliferation induced by IL-22 and keratinocytes migration. In addition, we found that IL-22 activates miR-197 expression through the binding of phosphorylated STAT3 to sequences in the putative promoter of miR-197. Finally we found that IL-22 receptor subunit IL22RA1 is a direct target of miR-197. Hence, we identified a novel feedback loop controlling IL-22 signaling, in which IL-22 induces miR-197, which in turn, negatively regulates IL-22 receptor and attenuates the biological outcome of such signaling. Regulation of this pathway may be important in inflammatory skin disorders such a psoriasis and in wound healing.

  16. Production of the mercury-197 through proton induced reaction on gold.

    Science.gov (United States)

    Elmaghraby, E K; Hassan, K F; Omara, H; Saleh, Z A

    2010-09-01

    The excitation function of the proton exchange reactions on gold was investigated in the energy range from threshold up to 20MeV. We presented our experimental results upto 14MeV stacked-foil technique was used, the target was of high purity gold foils (99.99%.) Reactions cross-sections and excitation functions were studied. Both isomeric level cross sections of (197)Hg were measured and calculated theoretically using the DDHMS routine of the EMPIRE-II (v2.19) code. Isomeric cross-section ratios for the pair (197m,g)Hg were calculated and presented as a function of proton energy.

  17. Atlas of the Spectrum of a Platinum/Neon Hollow-Cathode Lamp in the Region 1130-4330 &#197

    Science.gov (United States)

    SRD 112 Atlas of the Spectrum of a Platinum/Neon Hollow-Cathode Lamp in the Region 1130-4330 &#197 (Web, free access)   Atlas of the Spectrum of a Platinum/Neon Hollow-Cathode Lamp in the Region 1130-4330 &#197 contains wavelengths and intensities for about 5600 lines in the region 4330 &#197. An atlas plot of the spectrum is given, with the spectral lines marked and their intensities, wavelengths, and classifications listed.

  18. 197.pdf | mar2007 | jbiosci | www.ias.ac.in | | http: | Indian Academy ...

    Indian Academy of Sciences (India)

    Home; http: www.ias.ac.in; jbiosci; mar2007; 197.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube · Twitter · Facebook · Blog. Academy News. IAS Logo. Live streaming of the Symposium on Dialogue: Science, Scientists, and Society starts at ...

  19. 14 CFR 121.197 - Airplanes: Turbine engine powered: Landing limitations: Alternate airports.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplanes: Turbine engine powered: Landing... AND OPERATIONS OPERATING REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Airplane Performance Operating Limitations § 121.197 Airplanes: Turbine engine powered: Landing limitations: Alternate...

  20. Association of Interleukin-17 polymorphism (-197G/A) in chronic and localized aggressive periodontitis.

    Science.gov (United States)

    Chaudhari, Harshal Liladhar; Warad, Shivaraj; Ashok, Nipun; Baroudi, Kusai; Tarakji, Bassel

    2016-01-01

    Interleukin 17(IL-17) is a pro-inflammatory cytokine produced mainly by Th17 cells. The present study was undertaken to investigate a possible association between IL-17 A genetic polymorphism at (-197A/G) and susceptibility to chronic and localized aggressive periodontitis (LAgP) in an Indian population. The study was carried out on 105 subjects, which included 35 LAgP patients, 35 chronic periodontitis patients and 35 healthy controls. Blood samples were drawn from the subjects and analyzed for IL-17 genetic polymorphism at (-197A/G), by using the polymerase chain reaction-restriction fragment length polymorphism method. A statistically significant difference was seen in the genotype distribution among chronic periodontitis patients, LAgP patients and healthy subjects. There was a significant difference in the distribution of alleles among chronic periodontitis patients, LAgP patients and healthy subjects. The odds ratio for A allele versus G allele was 5.1 between chronic periodontitis patients and healthy controls, and 5.1 between LAgp patients and healthy controls. Our study concluded that IL-17 A gene polymorphism at (-197A/G) is linked to chronic periodontitis and LAgP in Indian population. The presence of allele A in the IL-17 gene polymorphism (-197A/G) can be considered a risk factor for chronic periodontitis and LAgP.

  1. Association of Interleukin-17 polymorphism (-197G/A in chronic and localized aggressive periodontitis

    Directory of Open Access Journals (Sweden)

    Harshal Liladhar CHAUDHARI

    2016-01-01

    Full Text Available Abstract Interleukin 17(IL-17 is a pro-inflammatory cytokine produced mainly by Th17 cells. The present study was undertaken to investigate a possible association between IL-17 A genetic polymorphism at (-197A/G and susceptibility to chronic and localized aggressive periodontitis (LAgP in an Indian population. The study was carried out on 105 subjects, which included 35 LAgP patients, 35 chronic periodontitis patients and 35 healthy controls. Blood samples were drawn from the subjects and analyzed for IL-17 genetic polymorphism at (-197A/G, by using the polymerase chain reaction-restriction fragment length polymorphism method. A statistically significant difference was seen in the genotype distribution among chronic periodontitis patients, LAgP patients and healthy subjects. There was a significant difference in the distribution of alleles among chronic periodontitis patients, LAgP patients and healthy subjects. The odds ratio for A allele versus G allele was 5.1 between chronic periodontitis patients and healthy controls, and 5.1 between LAgp patients and healthy controls. Our study concluded that IL-17 A gene polymorphism at (-197A/G is linked to chronic periodontitis and LAgP in Indian population. The presence of allele A in the IL-17 gene polymorphism (-197A/G can be considered a risk factor for chronic periodontitis and LAgP.

  2. 14 CFR 61.197 - Renewal requirements for flight instructor certification.

    Science.gov (United States)

    2010-01-01

    ... Instructors Other than Flight Instructors With a Sport Pilot Rating § 61.197 Renewal requirements for flight... the following renewal requirements— (i) A record of training students showing that, during the... completed an approved flight instructor refresher course consisting of ground training or flight training...

  3. 26 CFR 1.197-2 - Amortization of goodwill and certain other intangibles.

    Science.gov (United States)

    2010-04-01

    ... acquired for the purpose of marketing the computer software is included in the definition of computer... 1286. (10) Professional sports franchises. Section 197 intangibles do not include any franchise to engage in professional baseball, basketball, football, or any other professional sport, and any item...

  4. The new european standard on common cements specifications EN 197-1:2011

    Directory of Open Access Journals (Sweden)

    Sanjuán, M. A.

    2012-09-01

    Full Text Available In this paper, the novelties of European standard EN 197-1:2011 which has been aprobed on 6th August, 2011 are presented. The european standard EN 197-1:2011 has been published in the Official Journal of the European Union on 19th June, 2012 (C 176/1. The UNEEN 197-1:2011 will be published in Spain in the Official Journal of Spain (B.O.E.. The date of applicability (DAV of the standard as a harmonised European standard is on 1st of July, 2012 and the date of the end of the coexistence period is on 1st of July, 2013. The former EN 197-1:2000 has been the first European standard in the field of the Construction Products Directive (CPD and this first revision include the requirements needed for a common cement to be, in addition, sulphate resisting cement. Therefore, the mandate given by the European Commission to CEN to prepare harmonised standards in the cement field (mandate M114 has been fulfilled.En este artículo se presentan las novedades de la nueva norma europea de especificaciones de cementos comunes UNE-EN 197-1:2011 aprobada el 6 de agosto de 2011 como EN 197-1:2011 y publicada el 19 de junio de 2012 en el Diario Oficial de la Unión Europea (DOUE. Esta norma se publicará en el Boletín Oficial del Estado (BOE antes de final de año. La fecha de disponibilidad (date of applicability, DAV es el 1 de julio de 2012 y el periodo de coexistencia finalizará el 1 de julio de 2013. La UNE-EN 197-1:2000 fue la primera norma armonizada dentro del campo de la Directiva de Productos de la Construcción (DPC europea y esta primera revisión incorpora unos nuevos requisitos para establecer cuándo un cemento común, además, es resistente a la acción de los sulfatos. De esta forma, se completa el mandato dado por la Comisión Europea a CEN para la elaboración de normas armonizadas de cementos (mandato M114.

  5. Co-expression of sulphydryl oxidase and protein disulphide isomerase in Escherichia coli allows for production of soluble CRM197.

    Science.gov (United States)

    Roth, R; van Zyl, P; Tsekoa, T; Stoychev, S; Mamputha, S; Buthelezi, S; Crampton, M

    2017-05-01

    To investigate the production of soluble cross-reacting material 197 (CRM197 ) in Escherichia coli, a safe and effective T-cell-dependent protein carrier for polysaccharides used in the manufacture and application of multivalent conjugate vaccines. The use of co-expression of a sulphydryl oxidase (SOX) and protein disulphide isomerase for the production of soluble CRM197 in E. coli is described. CRM197 contains two disulphide bonds, which are normally unable to form in the reducing environment of the E. coli cytoplasm. It was found that co-expression yielded soluble CRM197 , at a production rate ~10% of the production of insoluble CRM197 , in equivalent small-scale cultures. Structural analysis of the purified CRM197 compared to CRM197 commercially produced in cultures of recombinant Pseudomonas fluorescens indicated that the E. coli soluble protein compares favourably on all structural levels. SOX and protein disulphide isomerase are enzymes involved in the formation of intra-protein disulphide bonds, and can influence the tertiary structure of the protein being produced, resulting in increased solubility due to the correct folding of the protein. Their use enabled the production of soluble untagged CRM197 in E. coli, which was previously unachievable. Previous literature reports have shown that CRM197 can be expressed in E. coli, though only in an insoluble form, or in soluble form as a fusion protein. It is currently commercially produced in cultures of recombinant P. fluorescens. The use of a widely used, well-characterized expression host such as E. coli, rather than P. fluorescens broadens the applicability of the production technology, and the production system described here is worthy of further investigation for scaled up manufacture of CRM197 . © 2017 The Society for Applied Microbiology.

  6. Co-expression of sulphydryl oxidase and protein disulphide isomerase in Escherichia coli allows for production of soluble CRM197

    CSIR Research Space (South Africa)

    Roth, Robyn L

    2017-04-01

    Full Text Available The aim of this article is to investigate the production of soluble cross-reacting material 197 (CRM(sub197)) in Escherichia coli, a safe and effective T-cell-dependent protein carrier for polysaccharides used in the manufacture and application...

  7. Further test of internal-conversion theory with a measurement in Pt197

    Science.gov (United States)

    Nica, N.; Hardy, J. C.; Iacob, V. E.; Goodwin, J.; Balonek, C.; Hernberg, M.; Nolan, J.; Trzhaskovskaya, M. B.

    2009-12-01

    We have measured the K-shell internal conversion coefficient, αK, for the 346.5-keV M4 transition in Pt197 to be 4.23(7). This result differs from a previous value, which disagreed significantly from theory. Our new value agrees well with Dirac-Fock calculations and removes the earlier discrepancy as a source of concern.

  8. Vi-CRM 197 as a new conjugate vaccine against Salmonella Typhi.

    Science.gov (United States)

    Micoli, F; Rondini, S; Pisoni, I; Proietti, D; Berti, F; Costantino, P; Rappuoli, R; Szu, S; Saul, A; Martin, L B

    2011-01-17

    An efficacious, low cost vaccine against typhoid fever, especially for young children, would make a major impact on disease burden in developing countries. The virulence capsular polysaccharide of Salmonella Typhi (Vi) coupled to recombinant mutant Pseudomonas aeruginosa exoprotein A (Vi-rEPA) has been shown to be highly efficacious. We investigated the use of carrier proteins included in infant vaccines, standardized the conjugation process and developed key assays required for routine lot release at production scale. Vi from a BSL1 organism, Citrobacter freundii, strain WR7011, was used as an alternative to Vi from S. Typhi. We showed that Vi conjugated to CRM(197), a non-toxic mutant of diphtheria toxin, widely used in commercial vaccines, was produced at high yield. Vi-CRM(197) proved immunogenic in animal studies, even without adjuvant. Thus, Vi-CRM(197) appears to be a suitable candidate for the development of a commercially viable, effective typhoid vaccine for developing countries. Copyright © 2010 Elsevier Ltd. All rights reserved.

  9. Novel methodology for the study of mercury methylation and reduction in sediments and water using 197Hg radiotracer.

    Science.gov (United States)

    Ribeiro Guevara, Sergio; Zizek, Suzana; Repinc, Urska; Pérez Catán, Soledad; Jaćimović, Radojko; Horvat, Milena

    2007-03-01

    Mercury tracers are powerful tools that can be used to study mercury transformations in environmental systems, particularly mercury methylation, demethylation and reduction in sediments and water. However, mercury transformation studies using tracers can be subject to error, especially when used to assess methylation potential. The organic mercury extracted can be as low as 0.01% of the endogenous labeled mercury, and artefacts and contamination present during methylmercury (MeHg) extraction processes can cause interference. Solvent extraction methods based on the use of either KBr/H2SO4 or HCl were evaluated in freshwater sediments using 197Hg radiotracer. Values obtained for the 197Hg tracer in the organic phase were up to 25-fold higher when HCl was used, which is due to the coextraction of 197Hg2+ into the organic phase during MeHg extraction. Evaluations of the production of MeHg gave similar results with both MeHg extraction procedures, but due to the higher Hg2+ contamination of the controls, the uncertainty in the determination was higher when HCl was used. The Hg2+ contamination of controls in the HCl extraction method showed a nonlinear correlation with the humic acid content of sediment pore water. Therefore, use of the KBr/H2SO4 method is recommended, since it is free from these interferences. 197Hg radiotracer (T1/2=2.673 d) has a production rate that is about 50 times higher than that of 203Hg (T1/2=46.595 d), the most frequently used mercury radiotracer. Hence it is possible to obtain a similar level of performance to 203Hg when it is used it in short-term experiments and produced by the irradiation of 196Hg with thermal neutrons, using mercury targets with the natural isotopic composition. However, if the 0.15% natural abundance of the 196Hg isotope is increased, the specific activity of the 197Hg tracer can be significantly improved. In the present work, 197Hg tracer was produced from mercury 51.58% enriched in the 196Hg isotope, and a 340-fold

  10. Proteomic analysis of the gamma human papillomavirus type 197 E6 and E7 associated cellular proteins.

    Science.gov (United States)

    Grace, Miranda; Munger, Karl

    2017-01-01

    Gamma HPV197 was the most frequently identified HPV when human skin cancer specimens were analyzed by deep sequencing (Arroyo Muhr et al., Int. J. Cancer 136: 2546-55, 2015). To gain insight into the biological activities of HPV197, we investigated the cellular interactomes of HPV197 E6 and E7. HPV197 E6 protein interacts with a broad spectrum of cellular LXXLL domain proteins, including UBE3A and MAML1. HPV197 E6 also binds and inhibits the TP53 tumor suppressor and interacts with the CCR4-NOT ubiquitin ligase and deadenylation complex. Despite lacking a canonical retinoblastoma (RB1) tumor suppressor binding site, HPV197 E7 binds RB1 and activates E2F transcription. Hence, HPV197 E6 and E7 proteins interact with a similar set of cellular proteins as E6 and E7 proteins encoded by HPVs that have been linked to human carcinogenesis and/or have transforming activities in vitro. Copyright © 2016 Elsevier Inc. All rights reserved.

  11. Systematic analysis of gene expression pattern in has-miR-197 over-expressed human uterine leiomyoma cells.

    Science.gov (United States)

    Ling, Jing; Wu, Xiaoli; Fu, Ziyi; Tan, Jie; Xu, Qing

    2015-10-01

    Our previous study showed that the expression of miR-197 in leiomyoma was down-regulated compared with myometrium. Further, miR-197 has been identified to affect uterine leiomyoma cell proliferation, apoptosis, and metastasis ability, though the responsible molecular mechanism has not been well elucidated. In this study, we sought to determine the expression patterns of miR-197 targeted genes and to explore their potential functions, participating Pathways and the networks that are involved in the biological behavior of human uterine leiomyoma. After transfection of human uterine leiomyoma cells with miR-197, we confirmed the expression level of miR-197 using quantitative real-time PCR (qRT-PCR), and we detected the gene expression profiles after miR-197 over-expression through DNA microarray analysis. Further, we performed GO and Pathway analysis. The dominantly dys-regulated genes, which were up- or down-regulated by more than 10-fold, compared with parental cells, were confirmed using qRT-PCR technology. Compared with the control group, miR-197 was up-regulated by 30-fold after miR-197 lentiviral transfection. The microarray data showed that 872 genes were dys-regulated by more than 2-fold in human uterine leiomyoma cells after miR-197 overexpression, including 537 up-regulated and 335 down-regulated genes. The GO analysis indicated that the dys-regulated genes were primarily involved in response to stimuli, multicellular organ processes, and the signaling of biological progression. Further, Pathway analysis data showed that these genes participated in regulating several signaling Pathways, including the JAK/STAT signaling Pathway, the Toll-like receptor signaling Pathway, and cytokine-cytokine receptor interaction. The qRT-PCR results confirmed that 17 of the 66 selected genes, which were up- or down-regulated more than 10-fold by miR-197, were consistent with the microarray results, including tumorigenesis-related genes, such as DRT7, SLC549, SFMBT2, FLJ37956

  12. 197 nm femtosecond laser-pulse duration: comparison of autocorrelation measurements

    Science.gov (United States)

    Heisel, P.-C.; Bergmann, J.; Paa, W.; Triebel, W.; Zeuner, T.; Stafast, H.

    2013-08-01

    An easy and reliable way is presented to measure the duration of UV femtosecond laser pulses of λ autocorrelation techniques are based on two-photon absorption (TPA) in different TPA media, especially calcium fluoride (CaF2). For 197 nm, the laser-pulse energy transmission and the laser-induced fluorescence of self-trapped excitons at 278 nm are applied. Both methods yield nearly the same second-order autocorrelation functions allowing to analyze the investigated laser pulse and obtain its duration of fs.

  13. Tribenuron-methyl resistance and mutation diversity of Pro197 in flixweed (Descurainia Sophia L.) accessions from China.

    Science.gov (United States)

    Deng, Wei; Liu, Ming Jie; Yang, Qian; Mei, Yu; Li, Xue Feng; Zheng, Ming Qi

    2015-01-01

    Flixweed (Descurainia Sophia L.) is a problematic weed in winter wheat fields in China, which causes great loss of wheat yield. A total of 46 flixweed accessions from winter wheat-planting areas were collected and used for the survey of resistance to tribenuron-methyl and Pro197 mutation diversity. According to the "R" resistance rating system, 16 flixweed accessions have evolved resistance to tribenuron-methyl, 13 accessions have high risk of developing resistance to this herbicide and 17 accessions are susceptible. The mutation of Pro197 codon (CCT) changed proline (Pro) into leucine (Leu) (homozygous, RR), serine (Ser, RR), histidine (His, RR), threonine (Thr, RR), Pro/Leu (heterozygous, RS), Pro/Ser (RS), Pro/His, Pro/Thr (RS) and Pro/Tyr (RS). Among these amino acid changes, a Pro197-Pro/Tyr (heterozygous, RS) substitution caused by the mutation of two successive nucleotides was identified for the first time in resistant weed species. In addition, the Pro197-His and Pro197-Pro/His mutations have not been reported previously in flixweed. Finally, a CPAS marker was developed to identify flixweed plants with or without Pro197 mutation. Copyright © 2014 Elsevier Inc. All rights reserved.

  14. Evaluation of Dual Energy X Ray Absorbsiometry and Osteoporosis Risk Factors in 197 Patients - Original Investigation

    Directory of Open Access Journals (Sweden)

    Şirin Raife Çoban

    2007-12-01

    Full Text Available Aim: To examine the risk factors for osteoporosis, dual energy X ray absorbsiometry (DXA measures, dorsolomber radiographics and laboratory analysis of 197 patients which followed in Goztepe Education and Research Hospital Physical Medicine and Rehabilitation Policlinics. Patients and Methods: 197 patients, ages between 37-78, which followed in Physical Medicine and Rehabilitation Policlinics, cross-sectionally evaluated. Patients interrogated about risk factors like life style, calcium-caffeine-alcohol consumption in nutrition, cigarette smoking, age ot menarch, number of births, time of menopause, physical activity levels and their dorsolomber AP-lateral radiograpichs, laboratory analysis and bone mineral density measures with DXA has done. Osteoporosis-osteopenia classification has done by the T score criterias of World Health Organisation. Pearson correlation analysis and ANOVA has used as statistical method. Results: Mean age was 59,24±8,33. Mean body mass index was 26,42±3,99. A significant correlation did not found between life style, nutrition, age of menarch, number of births, early fracture, compression fracture, sunbathe and T scores. A statistically significant correlation has found between age and femur neck T scores; body mass index and lomber-femoral T scores; time of menopause and femur neck T scores (p<0,005. Conclussion: A significant correlation did not found between the minimal risk factors and DXA measures. Age, body mass index and time of menopause has found related to bone mineral density measures. (From the World of Osteoporosis 2007;13:80-2

  15. Antigen processing of glycoconjugate vaccines; the polysaccharide portion of the pneumococcal CRM(197) conjugate vaccine co-localizes with MHC II on the antigen processing cell surface.

    Science.gov (United States)

    Lai, Zengzu; Schreiber, John R

    2009-05-21

    Pneumococcal (Pn) polysaccharides (PS) are T-independent (TI) antigens and do not induce immunological memory or antibodies in infants. Conjugation of PnPS to the carrier protein CRM(197) induces PS-specific antibody in infants, and memory similar to T-dependent (Td) antigens. Conjugates have improved immunogenicity via antigen processing and presentation of carrier protein with MHC II and recruitment of T cell help, but the fate of the PS attached to the carrier is unknown. To determine the location of the PS component of PnPS-CRM(197) in the APC, we separately labeled PS and protein and tracked their location. The PS of types 14-CRM(197) and 19F-CRM(197) was specifically labeled by Alexa Fluor 594 hydrazide (red). The CRM(197) was separately labeled red in a reaction that did not label PS. Labeled antigens were incubated with APC which were fixed, permeabilized and incubated with anti-MHC II antibody labeled green by Alexa Fluor 488, followed by confocal microscopy. Labeled CRM(197) was presented on APC surface and co-localized with MHC II (yellow). Labeled unconjugated 14 or 19F PS did not go to the APC surface, but PS labeled 14-CRM(197) and 19F-CRM(197) was internalized and co-localized with MHC II. Monoclonal antibody to type 14 PS bound to intracellular type 14 PS and PS-CRM(197). Brefeldin A and chloroquine blocked both CRM(197) and PS labeled 14-CRM(197) and 19F-CRM(197) from co-localizing with MHC II. These data suggest that the PS component of the CRM(197) glycoconjugate enters the endosome, travels with CRM(197) peptides to the APC surface and co-localizes with MHC II.

  16. ARQ-197, an oral small-molecule inhibitor of c-Met for the treatment of solid tumors.

    Science.gov (United States)

    Bagai, Rakesh; Fan, Weiwen; Ma, Patrick C

    2010-06-01

    ARQ-197 is an oral, selective c-Met inhibitor under development by ArQule Inc, in partnership with Daiichi Sankyo Co Ltd and Asian licensee Kyowa Hakko Kirin Co Ltd, for the potential treatment of solid tumors, including NSCLC, hepatocellular carcinoma and pancreatic cancer, as well as microphthalmia transcription factor-driven tumors. c-Met, a key cell surface receptor tyrosine kinase involved in diverse regulatory functions, is often aberrantly activated in human cancers. While the precise mechanism of action of ARQ-197 remains undefined, data from preclinical studies have demonstrated that ARQ-197 inhibits c-Met activation in numerous human tumor cell lines and specifically targets c-Met in various cancer types; uniquely, ARQ-197 inhibits c-Met in a non-ATP-competitive manner. Phase I/II clinical trials demonstrated promise in terms of both tolerability and tumor response. Intriguingly, dose-limiting adverse effects were hematological in nature. Combinational trials are also ongoing to take advantage of the signaling crosstalk between c-Met and other oncogenic signaling systems. Prioritization of the clinical development of c-Met inhibitors, such as ARQ-197, among different tumor disease types is a key challenge at present; an improved understanding of the prediction of molecular determinants in tumors with respect to c-Met kinase as the driver oncogenic receptor, and of the prediction of tumor response, is still urgently needed.

  17. ARQ 197, a novel and selective inhibitor of the human c-Met receptor tyrosine kinase with antitumor activity.

    Science.gov (United States)

    Munshi, Neru; Jeay, Sébastien; Li, Youzhi; Chen, Chang-Rung; France, Dennis S; Ashwell, Mark A; Hill, Jason; Moussa, Magdi M; Leggett, David S; Li, Chiang J

    2010-06-01

    The met proto-oncogene is functionally linked with tumorigenesis and metastatic progression. Validation of the receptor tyrosine kinase c-Met as a selective anticancer target has awaited the emergence of selective c-Met inhibitors. Herein, we report ARQ 197 as the first non-ATP-competitive small molecule that selectively targets the c-Met receptor tyrosine kinase. Exposure to ARQ 197 resulted in the inhibition of proliferation of c-Met-expressing cancer cell lines as well as the induction of caspase-dependent apoptosis in cell lines with constitutive c-Met activity. These cellular responses to ARQ 197 were phenocopied by RNAi-mediated c-Met depletion and further demonstrated by the growth inhibition of human tumors following oral administration of ARQ 197 in multiple mouse xenograft efficacy studies. Cumulatively, these data suggest that ARQ 197, currently in phase II clinical trials, is a promising agent for targeting cancers in which c-Met-driven signaling is important for their survival and proliferation.

  18. Breakup mechanisms for 7Li + 197Au, 204Pb systems at sub-barrier energies

    Directory of Open Access Journals (Sweden)

    Luong D.H.

    2013-12-01

    Full Text Available Coincidence measurements of breakup fragments were carried out for the 7Li + 197Au and 204Pb systems at sub-barrier energies. The mechanisms triggering breakup, and time-scales of each process, were identified through the reaction Q-values and the relative energy of the breakup fragments. Binary breakup of 7Li were found to be predominantly triggered by nucleon transfer, with p-pickup leading to 8Be → α + α decay being the preferred breakup mode. From the time-scales of each process, the coincidence yields were separated into prompt and delayed components, allowing the identification of breakup process important in the suppression of complete fusion of 7Li at above-barrier energies.

  19. Neutron transfer in the 13C+197Au reaction from gold isotope residuals

    Science.gov (United States)

    Daub, B. H.; Bleuel, D. L.; Wiedeking, M.; Bernstein, L. A.; Brickner, N. M.; Brown, J. A.; Goldblum, B. L.; Holliday, K. S.; Lundgren, J.; Moody, K.

    2017-08-01

    Residual gold nuclei were produced via neutron transfer at multiple energies using a 130-MeV 13C beam incident on a stacked-foil target consisting of alternating layers of 197Au and 27Al. Production cross sections, over an energy range of 56 to 129 MeV, for seven gold isotopes and two gold isomers were determined through activation analysis. By using the Wilczyński binary transfer model with a modified version of the recoil formula and a standard evaporation model, we were able to reproduce the isotopic production cross sections at high beam energy, with some disagreement at lower beam energies. This limiting angular momentum model does not predict the transfer of sufficient angular momentum to reproduce the observed isomeric populations.

  20. Variants of human thymidylate synthase with loop 181-197 stabilized in the inactive conformation.

    Energy Technology Data Exchange (ETDEWEB)

    Lovelace, Leslie L.; Johnson, Saphronia R.; Gibson, Lydia M.; Bell, Brittnaie J.; Berger, Sondra H.; Lebioda, Lukasz; (SC)

    2009-08-31

    Loop 181-197 of human thymidylate synthase (hTS) populates two major conformations, essentially corresponding to the loop flipped by 180{sup o}. In one of the conformations, the catalytic Cys195 residue lies distant from the active site making the enzyme inactive. Ligands stabilizing this inactive conformation may function as allosteric inhibitors. To facilitate the search for such inhibitors, we have expressed and characterized several mutants designed to shift the equilibrium toward the inactive conformer. In most cases, the catalytic efficiency of the mutants was only somewhat impaired with values of k{sub cat}/K{sub m} reduced by factors in a 2-12 range. One of the mutants, M190K, is however unique in having the value of k{sub cat}/K{sub m} smaller by a factor of {approx}7500 than the wild type. The crystal structure of this mutant is similar to that of the wt hTS with loop 181-197 in the inactive conformation. However, the direct vicinity of the mutation, residues 188-194 of this loop, assumes a different conformation with the positions of C{sub {alpha}} shifted up to 7.2 {angstrom}. This affects region 116-128, which became ordered in M190K while it is disordered in wt. The conformation of 116-128 is however different than that observed in hTS in the active conformation. The side chain of Lys190 does not form contacts and is in solvent region. The very low activity of M190K as compared to another mutant with a charged residue in this position, M190E, suggests that the protein is trapped in an inactive state that does not equilibrate easily with the active conformer.

  1. Leg 197 synthesis: Southward motion and geochemical variability of the Hawaiian hotspot

    Science.gov (United States)

    Duncan, Robert A.; Tarduno, John A.; Scholl, David W.

    2006-01-01

    The bend in the Hawaiian-Emperor volcanic chain is an often-cited example of a change in plate motion with respect to a stationary hotspot. Growing evidence, however, suggests that the bend might instead record variable drift of the Hawaiian hotspot within a convecting mantle. Paleomagnetic and radiometric age data from samples recovered during Ocean Drilling Program (ODP) Leg 197 define an age-progressive paleolatitude history, indicating that the Emperor Seamounts volcanic trend was formed principally by rapid (4–5 cm/yr) southward motion of the Hawaiian hotspot during Late Cretaceous to early Tertiary time (81–47 Ma). Paleointensity data derived from Leg 197 suggest an inverse relationship between field strength and reversal frequency, consistent with an active lower mantle that controls the efficiency of the geodynamo. Petrochemical data and observations of volcanic products (lava flows and volcaniclastic sediments) from Detroit, Nintoku, and Koko Seamounts provide records of the evolution of these volcanic systems for comparison with recent activity in the Hawaiian Islands. We find that the Emperor Seamounts formed from similar mantle sources for melting (plume components and lithosphere) and in much the same stages of volcanic activity and time span as the Hawaiian volcanoes. Changes in major and trace element and Sr isotopic compositions of shield lavas along the lineament can be related to variations in thickness of the lithosphere overlying the hotspot that control the depth and extent of partial melting. Other geochemical tracers, such as He, Pb, and Hf isotopic compositions, indicate persistent contributions to melting from the plume throughout the volcanic chain.

  2. Phase I trial of a selective c-MET inhibitor ARQ 197 incorporating proof of mechanism pharmacodynamic studies.

    Science.gov (United States)

    Yap, Timothy A; Olmos, David; Brunetto, Andre T; Tunariu, Nina; Barriuso, Jorge; Riisnaes, Ruth; Pope, Lorna; Clark, Jeremy; Futreal, Andrew; Germuska, Michael; Collins, David; deSouza, Nandita M; Leach, Martin O; Savage, Ronald E; Waghorne, Carol; Chai, Feng; Garmey, Edward; Schwartz, Brian; Kaye, Stan B; de Bono, Johann S

    2011-04-01

    The hepatocyte growth factor/c-MET axis is implicated in tumor cell proliferation, survival, and angiogenesis. ARQ 197 is an oral, selective, non-adenosine triphosphate competitive c-MET inhibitor. A phase I trial of ARQ 197 was conducted to assess safety, tolerability, and target inhibition, including intratumoral c-MET signaling, apoptosis, and angiogenesis. Patients with solid tumors amenable to pharmacokinetic and pharmacodynamic studies using serial biopsies, dynamic contrast-enhanced magnetic resonance imaging (DCE-MRI), and circulating endothelial cell (CEC) and circulating tumor cell (CTC) enumeration were enrolled. Fifty-one patients received ARQ 197 at 100 to 400 mg twice per day. ARQ 197 was well tolerated, with the most common toxicities being grade 1 to 2 fatigue, nausea, and vomiting. Dose-limiting toxicities included grade 3 fatigue (200 mg twice per day; n = 1); grade 3 mucositis, palmar-plantar erythrodysesthesia, and hypokalemia (400 mg twice per day; n = 1); and grade 3 to 4 febrile neutropenia (400 mg twice per day, n = 2; 360 mg twice per day, n = 1). The recommended phase II dose was 360 mg twice per day. ARQ 197 systemic exposure was dose dependent and supported twice per day oral dosing. ARQ 197 decreased phosphorylated c-MET, total c-MET, and phosphorylated focal adhesion kinase and increased terminal deoxynucleotidyl transferase-mediated deoxyuridine triphosphate-biotin nick-end labeling (TUNEL) staining in tumor biopsies (n = 15). CECs decreased in 25 (58.1%) of 43 patients, but no significant changes in DCE-MRI parameters were observed after ARQ 197 treatment. Of 15 patients with detectable CTCs, eight (53.3%) had ≥ 30% decline in CTCs after treatment. Stable disease, as defined by Response Evaluation Criteria in Solid Tumors (RECIST), ≥ 4 months was observed in 14 patients, with minor regressions in gastric and Merkel cell cancers. ARQ 197 safely inhibited intratumoral c-MET signaling. Further clinical evaluation focusing on

  3. Test Operations Procedure (TOP) 08-2-197 Chemical Protection Testing of Sorbent-Based Air Purification Components (APCs)

    Science.gov (United States)

    2016-06-24

    36-8), acetic acid (AA, CAS® Number 64-19-7), and ethylene glycol (CAS® Number 107- 21-1). TOP 08-2-197 24 June 2016 A-1 APPENDIX A. TEST...2-197 24 June 2016 E-1 APPENDIX E. ABBREVIATIONS. ∆P differential pressure AA acetic acid AAPTF Advanced Air Purification Test Fixture AC...isobutyl-3-methoxypyrazine (IMP, CAS® Number 24683-00-9), dimethyl methylphosphonate (DMMP, CAS® Number 756-79-6), methyl salicylate (MeS, CAS® Number 119

  4. Breakup of 42 MeV 7 Li projectiles in the fields of 12 C and 197 Au ...

    Indian Academy of Sciences (India)

    2015-11-27

    Nov 27, 2015 ... Inclusive cross sections of particles and tritons from the breakup of 42 MeV 7Li by 12C and 197Au targets are presented and analysed in the framework of the Serber model. Spectral distortions due to the targets and relevant reaction mechanisms are discussed.

  5. MISSING MOMENTUM VECTOR IN THE AU-197(NE-20-F-1,F-2,PLF) REACTION AT 15-MEV/U

    NARCIS (Netherlands)

    WIELOCH, A; BRZYCHCZYK, J; GROTOWSKI, K; LEEGTE, HKW; MICEK, S; PAWLOWSKI, P; PLANETA, R; SIEMSSEN, RH; SOSIN, Z; WILSCHUT, HW; SIWEKWILCZYNSKA, K; WILCZYNSKI, J

    1995-01-01

    Projectile-like fragments (PLF's) emitted in damped collisions of 15 MeV/u Ne-20 ions with Au-197 were observed in coincidence with two fission fragments. For given detection angles of the PLF's differential and energy-integrated fission probabilities were obtained and the average missing momentum

  6. Effects of resistance mutations of Pro197, Asp376 and Trp574 on the characterization of acetohydroxyacid synthase (AHAS) isozymes.

    Science.gov (United States)

    Yang, Qian; Deng, Wei; Wang, Shipeng; Liu, Hongjie; Li, Xuefeng; Zheng, Mingqi

    2018-02-09

    Descurainia sophia L., a problematic weed in winter wheat fields in China, has developed high resistance to tribenuron-methyl. Amino acid substitutions at sites Pro197, Asp376 and Trp574 in the target acetohydroxyacid synthase (AHAS) were primarily responsible for D. sophia resistance to tribenuron-methyl. In this study, D. sophia plants individually homozygous for a specific resistance mutation (Pro197Leu, Pro197His, Pro197Ser, Pro197Thr, Asp376Glu or Trp574Leu) in AHAS were purified and generated, and the effects of resistance mutations on D. sophia resistance and AHAS characterization were investigated. All resistance mutations in this study not only caused D. sophia to evolve 152 to 811-fold resistance to tribenuron-methyl but also greatly reduced AHAS sensitivity to tribenuron-methyl and increased AHAS binding affinity with the substrate pyruvate, which was primarily responsible for D. sophia resistance. The molecular docking results indicated these resistance mutations altered AHAS binding affinity with tribenuron-methyl by reducing the hydrogen bonds and changing hydrophobic interactions. Compared with the wild-type AHAS, these resistance mutations exhibited no significant effects on AHAS feedback inhibition by branched-chain amino acids (BCAAs) at concentrations less than 0.08 mM. The altered AHAS sensitivity to feedback inhibition by BCAAs did not necessarily increase or decrease the free BCAAs in resistant D. sophia plants. The AHAS resistance mutations conferred D. sophia resistance to tribenuron-methyl by decreasing the binding affinity with tribenuron-methyl or (and) increasing the binding affinity with pyruvate, but the mutations did not necessarily affect the biosynthesis of BCAAs in plants. This article is protected by copyright. All rights reserved.

  7. $^{197}$Au($n,\\gamma$) cross section in the unresolved resonance region

    CERN Document Server

    Lederer, C.; Domingo-Pardo, C; Gunsing, F; Kappeler, F; Massimi, C.; Mengoni, A.; Wallner, A.; Abbondanno, U.; Aerts, G.; Alvarez, H.; Alvarez-Velarde, F.; Andriamonje, S.; Andrzejewski, J.; Assimakopoulos, P.; Audouin, L.; Badurek, G.; Barbagallo, M.; Baumann, P.; Becvar, F.; Belloni, F.; Berthoumieux, E.; Calviani, M.; Calvino, F.; Cano-Ott, D.; Capote, R.; Carrapico, C.; Carrillo de Albornoz, A.; Cennini, P.; Chepel, V.; Chiaveri, E.; Cortes, G.; Couture, A.; Cox, J.; Dahlfors, M.; David, S.; Dillmann, I.; Dolfini, R.; Dridi, W.; Duran, I.; Eleftheriadis, C.; Embid-Segura, M.; Ferrant, L.; Ferrari, A.; Ferreira-Marques, R.; Fitzpatrick, L.; Frais-Koelbl, H.; Fujii, K.; Furman, W.; Goncalves, I.; Gonzalez-Romero, E.; Goverdovski, A.; Gramegna, F.; Griesmayer, E.; Guerrero, C.; Haas, B.; Haight, R.; Heil, M.; Herrera-Martinez, A.; Igashira, M.; Isaev, S.; Jericha, E.; Kadi, Y.; Karadimos, D.; Karamanis, D.; Kerveno, M.; Ketlerov, V.; Koehler, P.; Konovalov, V.; Kossionides, E.; Krticka, M.; Lampoudis, C.; Leeb, H.; Lindote, A.; Lopes, I.; Losito, R.; Lozano, M.; Lukic, S.; Marganiec, J.; Marques, L.; Marrone, S.; Martinez, T.; Mastinu, P.; Mendoza, E.; Milazzo, P.M.; Moreau, C.; Mosconi, M.; Neves, F.; Oberhummer, H.; O'Brien, S.; Oshima, M.; Pancin, J.; Papachristodoulou, C.; Papadopoulos, C.; Paradela, C.; Patronis, N.; Pavlik, A.; Pavlopoulos, P.; Perrot, L.; Pigni, M.T.; Plag, R.; Plompen, A.; Plukis, A.; Poch, A.; Praena, J.; Pretel, C.; Quesada, J.; Rauscher, T.; Reifarth, R.; Rosetti, M.; Rubbia, C.; Rudolf, G.; Rullhusen, P.; Salgado, J.; Santos, C.; Sarchiapone, L.; Sarmento, R.; Savvidis, I.; Stephan, C.; Tagliente, G.; Tain, J.L.; Tarrio, D.; Tassan-Got, L.; Tavora, L.; Terlizzi, R.; Vannini, G.; Vaz, P.; Ventura, A.; Villamarin, D.; Vlachoudis, V.; Vlastou, R.; Voss, F.; Walter, S.; Wendler, H.; Wiescher, M.; Wisshak, K.

    2011-01-01

    The cross section of the reaction (197)Au(n,gamma) was measured with the time-of-flight technique at the n_TOF (neutron time-of-flight) facility in the unresolved resonance region between 5 and 400 keV using a pair of C(6)D(6) (where D denotes (2)H) liquid scintillators for the detection of prompt capture gamma rays. The results with a total uncertainty of 3.9%-6.7% for a resolution of 20 bins per energy decade show fair agreement with the Evaluated Nuclear Data File Version B-VII.0 (ENDF B-VII.0), which contains the standard evaluation. The Maxwellian-averaged cross section (MACS) at 30 keV is in excellent agreement with the one according to the ENDF/B-VII.0 evaluation and 4.7% higher than the MACS measured independently by activation technique. Structures in the cross section, which had also been reported earlier, have been interpreted as being due to clusters of resonances.

  8. Phase II study of tivantinib (ARQ 197) in patients with metastatic triple-negative breast cancer.

    Science.gov (United States)

    Tolaney, Sara M; Tan, Sally; Guo, Hao; Barry, William; Van Allen, Eliezer; Wagle, Nikhil; Brock, Jane; Larrabee, Katherine; Paweletz, Cloud; Ivanova, Elena; Janne, Pasi; Overmoyer, Beth; Wright, John J; Shapiro, Geoffrey I; Winer, Eric P; Krop, Ian E

    2015-10-01

    MET expression and activation appear to be important for initiation and progression of triple-negative breast cancer. Tivantinib (ARQ 197) is an orally administered agent that targets MET, although recent preclinical data suggests the agent may have mechanisms of action that are independent of MET signaling. We conducted a phase 2 study of tivantinib monotherapy in patients with metastatic triple-negative breast cancer. Patients with metastatic triple-negative breast cancer who had received 1 to 3 prior lines of chemotherapy in the metastatic setting were enrolled into this two-stage, single arm phase 2 study. Treatment consisted of twice daily oral dosing of tivantinib (360 mg po bid) during a 21-day cycle. Patients underwent restaging scans at 6 weeks, and then every 9 weeks. Tumor biomarkers that might predict response to tivantinib were explored. 22 patients were enrolled. The overall response rate was 5 % (95 % CI 0-25 %) and the 6-month progression-free survival (PFS) was 5 % (95 % CI 0-25 %), with one patient achieving a partial response (PR). Toxicity was minimal with only 5 grade ≥3 adverse events (one grade 3 anemia, one grade 3 fatigue, and 3 patients with grade 3/4 neutropenia). This study represents the first evaluation of tivantinib for the treatment of metastatic triple-negative breast cancer. These results suggest that single agent tivantinib is well tolerated, but did not meet prespecified statistical targets for efficacy.

  9. Reactive Hyperplasia of the Oral Cavity: A Survey of 197 Cases in Tabriz, Northwest Iran

    Directory of Open Access Journals (Sweden)

    Amir Ala Aghbali

    2010-09-01

    Full Text Available Background and aims. Reactive hyperplastic lesions of the oral connective tissue are associated with injuries of soft tissue and have high prevalence rates and different involvement patterns in different parts of the world. The aim of this study was to analyze demographic data of a university department. Materials and methods. Patient records of the Department of Oral Pathology during a four-year period were reviewed for diagnosis of oral connective tissue reactive hyperplastic lesion. Data including the area involved and the type of lesion were collected and analyzed using descriptive statistical methods and t-test with SPSS 15 statistical software. Results. 197 cases (mean age, 37.68±18.97; male: female ratio, 1.8:1 matched study criterion. The most common affected site was gingiva (83.9% and the most common lesion was fibroma (45.2%. Giant cell granuloma and pyogenic granuloma were more common in the maxilla than in the mandible. Pyogenic granuloma was seen to be equally distributed in males and females. Conclusion. The results of the present study are overall consistent with the findings of previous studies.

  10. Aggravating factors for melasma: a prospective study in 197 Tunisian patients.

    Science.gov (United States)

    Guinot, C; Cheffai, S; Latreille, J; Dhaoui, M A; Youssef, S; Jaber, K; Nageotte, O; Doss, N

    2010-09-01

    Melasma is a frequent cause of consultations at dermatology departments by dark-skinned patients in Tunisia. To investigate factors that influence melasma severity in a large Tunisian population. A total of 197 patients (188 women and 9 men), who attended Tunis Military Hospital for a consultation were included prospectively from August 2005 to August 2006. Disease severity was estimated using the Melasma Area and Severity Index (MASI). Aggravating factors were investigated using multiple logistic regressions. Of the women included, 14% presented phototype III, 45% phototype IV and 41% phototype V; 76% presented a centrofacial melasma phenotype, 23% a malar and 1% a mandibular phenotype. About 60% developed melasma before thirty. Sun exposure was reported as a triggering factor by 51% of women and as an aggravating factor by 84%. Pregnancy was reported as an aggravating factor by 51% of women who had been pregnant, and oral contraceptive use reported by 38% of women exposed to oral contraceptives. The risk of severe melasma was about three times higher for women with age at onset under 30, phototype V and major lifetime sun exposure and about 8 times higher for women exposed to oral contraceptives. This study identifies a number of factors associated with the severity of melasma. Further epidemiological studies in this type of population, in particular, to investigate triggering factors, are justified by the aesthetic damage caused by melasma in dark-skinned patients, lack of efficacy of existing treatments, non-compliance with photoprotection recommendations and the challenge of treatment.

  11. m197wo.m77t and m197wo.h77t: MGD77T data and header files for single-beam bathymetry data for field activity M-1-97-WO in Southwest Washington Inner Shelf from 07/07/1997 to 07/15/1997

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS and GPS navigation data were collected as part of the U.S. Geological Survey cruise M-1-97-WO. The cruise was conducted...

  12. Novel methodology for the study of mercury methylation and reduction in sediments and water using {sup 197}Hg radiotracer

    Energy Technology Data Exchange (ETDEWEB)

    Ribeiro Guevara, Sergio; Perez Catan, Soledad [Centro Atomico Bariloche, Laboratorio de Analisis por Activacion Neutronica, Bariloche (Argentina); Zizek, Suzana; Repinc, Urska; Jacimovic, Radojko; Horvat, Milena [Jozef Stefan Institute, Department of Environmental Sciences, Ljubljana (Slovenia)

    2007-03-15

    Mercury tracers are powerful tools that can be used to study mercury transformations in environmental systems, particularly mercury methylation, demethylation and reduction in sediments and water. However, mercury transformation studies using tracers can be subject to error, especially when used to assess methylation potential. The organic mercury extracted can be as low as 0.01% of the endogenous labeled mercury, and artefacts and contamination present during methylmercury (MeHg) extraction processes can cause interference. Solvent extraction methods based on the use of either KBr/H{sub 2}SO{sub 4} or HCl were evaluated in freshwater sediments using {sup 197}Hg radiotracer. Values obtained for the {sup 197}Hg tracer in the organic phase were up to 25-fold higher when HCl was used, which is due to the coextraction of {sup 197}Hg{sup 2+} into the organic phase during MeHg extraction. Evaluations of the production of MeHg gave similar results with both MeHg extraction procedures, but due to the higher Hg{sup 2+} contamination of the controls, the uncertainty in the determination was higher when HCl was used. The Hg{sup 2+} contamination of controls in the HCl extraction method showed a nonlinear correlation with the humic acid content of sediment pore water. Therefore, use of the KBr/H{sub 2}SO{sub 4} method is recommended, since it is free from these interferences. {sup 197}Hg radiotracer (T{sub 1/2} = 2.673 d) has a production rate that is about 50 times higher than that of {sup 203}Hg (T{sub 1/2} = 46.595 d), the most frequently used mercury radiotracer. Hence it is possible to obtain a similar level of performance to {sup 203}Hg when it is used it in short-term experiments and produced by the irradiation of {sup 196}Hg with thermal neutrons, using mercury targets with the natural isotopic composition. However, if the 0.15% natural abundance of the {sup 196}Hg isotope is increased, the specific activity of the {sup 197}Hg tracer can be significantly improved. In

  13. Cytotoxic activity of tivantinib (ARQ 197) is not due solely to c-MET inhibition.

    Science.gov (United States)

    Katayama, Ryohei; Aoyama, Aki; Yamori, Takao; Qi, Jie; Oh-hara, Tomoko; Song, Youngchul; Engelman, Jeffrey A; Fujita, Naoya

    2013-05-15

    The receptor tyrosine kinase c-MET is the high-affinity receptor for the hepatocyte growth factor (HGF). The HGF/c-MET axis is often dysregulated in tumors. c-MET activation can be caused by MET gene amplification, activating mutations, and auto- or paracrine mechanisms. Thus, c-MET inhibitors are under development as anticancer drugs. Tivantinib (ARQ 197) was reported as a small-molecule c-MET inhibitor and early clinical studies suggest antitumor activity. To assess whether the antitumor activity of tivantinib was due to inhibition of c-MET, we compared the activity of tivantinib with other c-MET inhibitors in both c-MET-addicted and nonaddicted cancer cells. As expected, other c-MET inhibitors, crizotinib and PHA-665752, suppressed the growth of c-MET-addicted cancers, but not the growth of cancers that are not addicted to c-MET. In contrast, tivantinib inhibited cell viability with similar potency in both c-MET-addicted and nonaddicted cells. These results suggest that tivantinib exhibits its antitumor activity in a manner independent of c-MET status. Tivantinib treatment induced a G(2)-M cell-cycle arrest in EBC1 cells similarly to vincristine treatment, whereas PHA-665752 or crizotinib treatment markedly induced G(0)-G(1) cell-cycle arrest. To identify the additional molecular target of tivantinib, we conducted COMPARE analysis, an in silico screening of a database of drug sensitivities across 39 cancer cell lines (JFCR39), and identified microtubule as a target of tivantinib. Tivantinib-treated cells showed typical microtubule disruption similar to vincristine and inhibited microtubule assembly in vitro. These results suggest that tivantinib inhibits microtubule polymerization in addition to inhibiting c-MET. ©2013 AACR.

  14. Cytotoxic activity of Tivantinib (ARQ 197) is not due solely to MET inhibition

    Science.gov (United States)

    Katayama, Ryohei; Aoyama, Aki; Yamori, Takao; Qi, Jie; Oh-hara, Tomoko; Song, Youngchul; Engelman, Jeffrey A.; Fujita, Naoya

    2013-01-01

    The receptor tyrosine kinase c-MET is the high-affinity receptor for the hepatocyte growth factor (HGF). The HGF/c-MET axis is often dysregulated in tumors. c-MET activation can be caused by MET gene amplification, activating mutations, and auto- or paracrine mechanisms. Thus, c-MET inhibitors are under development as anti-cancer drugs. Tivantinib (ARQ 197) was reported as a small molecule c-MET inhibitor and early clinical studies suggest anti-tumor activity. To assess if the anti-tumor activity of tivantinib was due to inhibition of c-MET, we compared the activity of tivantinib to other c-MET inhibitors in both c-MET addicted and non-addicted cancer cells. As expected, other c-MET inhibitors, crizotinib and PHA-665752, suppressed the growth of c-MET addicted cancers, but not the growth of cancers that are not addicted to c-MET. In contrast, tivantinib inhibited cell viability with similar potency in both c-MET addicted and non-addicted cells. These results suggest that tivantinib exhibits its antitumor activity in a manner independent of c-MET status. Tivantinib treatment induced a G2/M cell cycle arrest in EBC1 cells similarly to vincristine treatment, whereas PHA-665752 or crizotinib treatment markedly induced G0/G1 cell cycle arrest. To identify the additional molecular target of tivantinib, we performed COMPARE analysis, an in silico screening of a database of drug sensitivities across 39 cancer cell lines (JFCR39), and identified microtubule as a target of tivantinib. Tivantinib treated cells demonstrated typical microtubule disruption similar to vincristine and inhibited microtubule assembly in vitro. These results suggest that tivantinib inhibits microtubule polymerization in addition to inhibiting c-MET. PMID:23598276

  15. 197Au Mössbauer study of copper refinery anode slimes

    Science.gov (United States)

    Sawicki, J. A.; Dutrizac, J. E.; Friedl, J.; Wagner, F. E.; Chen, T. T.

    1993-06-01

    Copper refinery anode slimes are abundantly produced during the electrolytic refining of copper. Although the slimes contain significant and economically recoverable amounts of gold and silver, the chemical state of the gold has not been fully identified. In the present work, the chemical form of gold in a copper anode, in a raw slime, and in slimes treated by different leaching procedures has been investigated by Mössbauer spectroscopy with the 77.3 keV γ-rays of197Au. The Mössbauer spectrum of the anode is typical of a dilute Au:Cu alloy. The spectrum of the raw slime consists of two components, namely, a single, rather broad line with an isomer shift (IS) of about -0.3 mm/s relative to a Pt metal source and a quadrupole doublet with an IS of + 1.2 mm/s and a quadrupole splitting of 5.0 mm/s. The single line component can be attributed to a gold-rich alloy, with an approximate composition of Au60Ag{n40} or Au80Cu20 if it is a binary alloy, or to a ternary Au-Ag-Cu alloy of appropriate composition. The parameters of the quadrupole doublet match those of Ag3AuSe2 (fischesserite) or related Ag2-xAuxSe compounds. In these compounds, the gold atoms are coordinated by two selenium atoms in a linear arrangement, as is typical for Au(I). It was found that the ratio between the concentrations of the metallic phase and the selenide strongly depends on the leaching conditions. The measurement of the Lamb-Mössbauer factor of fischesserite is also reported.

  16. Carrier priming with CRM 197 or diphtheria toxoid has a different impact on the immunogenicity of the respective glycoconjugates: biophysical and immunochemical interpretation.

    Science.gov (United States)

    Pecetta, S; Lo Surdo, P; Tontini, M; Proietti, D; Zambonelli, C; Bottomley, M J; Biagini, M; Berti, F; Costantino, P; Romano, M R

    2015-01-03

    Glycoconjugate vaccines play an enormous role in preventing infectious diseases. The main carrier proteins used in commercial conjugate vaccines are the non-toxic mutant of diphtheria toxin (CRM197), diphtheria toxoid (DT) and tetanus toxoid (TT). Modern childhood routine vaccination schedules include the administration of several vaccines simultaneously or in close sequence, increasing the concern that the repeated exposure to conjugates based on these carrier proteins might interfere with the anti-polysaccharide response. Extending previous observations we show here that priming mice with CRM197 or DT does not suppress the response to the carbohydrate moiety of CRM197 meningococcal serogroup A (MenA) conjugates, while priming with DT can suppress the response to DT-MenA conjugates. To explain these findings we made use of biophysical and immunochemical techniques applied mainly to MenA conjugates. Differential scanning calorimetry and circular dichroism data revealed that the CRM197 structure was altered by the chemical conjugation, while DT and the formaldehyde-treated form of CRM197 were less impacted, depending on the degree of glycosylation. Investigating the binding and avidity properties of IgGs induced in mice by non-conjugated carriers, we found that CRM197 induced low levels of anti-carrier antibodies, with decreased avidity for its MenA conjugates and poor binding to DT and respective MenA conjugates. In contrast, DT induced high antibody titers able to bind with comparable avidity both the protein and its conjugates but showing very low avidity for CRM197 and related conjugates. The low intrinsic immunogenicity of CRM197 as compared to DT, the structural modifications induced by glycoconjugation and detoxification processes, resulting in conformational changes in CRM197 and DT epitopes with consequent alteration of the antibody recognition and avidity, might explain the different behavior of CRM197 and DT in a carrier priming context. Copyright © 2014

  17. Measurement of the {sup 197}Au(n,{gamma}) cross section at n-TOF: towards a new standard

    Energy Technology Data Exchange (ETDEWEB)

    Massimi, C.; Abbondanno, U.; Aerts, G.; Alvarez, H.; A lvarez-Velarde, F.; Andriamonje, S.; Andrzejewski, J.; Assimakopoulos, P.; Audouin, L.; Badurek, G.; Baumann, P.; Becvar, F.; Berthoumieux, E.; Calvino, F.; Calviani, M.; Cano-Ott, D.; Capote, R.; Carrapic, C.; Cennini, P.; Chepel, V.; Chiaveri, E.; Colonna, N.; Cortes, G.; Couture, A.; Cox, J.; Dahlfors, M.; David, S.; Dillmann, I.; Domingo-Pardo, C.; Dridi, W.; Duran, I.; Eleftheriadis, C.; Embid-Segura, M.; Ferrant, L.; Ferrari, A.; Ferreira-Marques, R.; Fujii, K.; Furman, W.; Goncalves, I.; Gonzalez-Romero, E.; Gramegna, F.; Guerrero, C.; Gunsing, F.; Haas, B.; Haight, R.; Heil, M.; Herrera-Martinez, A.; Igashira, M.; Jericha, E.; Kappeler, F.; Kadi, Y.; Karadimos, D.; Karamanis, D.; Kerveno, M.; Koehler, P.; Kossionides, E.; Krticka, M.; Lampoudis, C.; Leeb, H.; Lindote, A.; Lopes, I.; Lozano, M.; Lukic, S.; Marganie, J.; Marrone, S.; Martinez, T.; Mastinu, P.; Mengoni, A.; Milazzo, P.M.; Moreau, C.; Mosconi, M.; Neves, F.; Oberhummer, H.; O' Brien, S.; Pancin, J.; Papachristodoulou, C.; Papadopoulos, C.; Paradela, C.; Patronis, N.; Pavlik, A.; Pavlopoulos, P.; Perrot, L.; Pigni, M.T.; Plag, R.; Plompen, A.; Plukis, A.; Poch, A.; Praena, J.; Pretel, C.; Quesada, J.; Rauscher, T.; Reifarth, R.; Rubbia, C.; Rudolf, G.; Rullhusen, P.; Salgado, J.; Santos, C.; Sarchiapone, L.; Savvidis, I.; Stephan, C.; Tagliente, G.; Tain, J.L.; Tassan-Got, L.; Tavora, L.; Terlizzi, R.; Vannini, G.; Vaz, P.; Ventura, A.; Villamarin, D.; Vincente, M.C.; Vlachoudis, V.; Vlastou, R.; Voss, F.; Walter, S.; Wiescher, M.; Wisshak, K

    2008-07-01

    Two different detectors and techniques are employed at n-TOF facility, at CERN, to improve the accuracy of the neutron capture cross section of {sup 197}Au(n,{gamma}): a total absorption calorimeter and a set of C{sub 6}D{sub 6}. The accurate knowledge of this cross section is of great importance for all the (n,{gamma}) reactions study. The neutron capture cross section and nuclear resonance parameters of the {sup 197}Au have been measured in the energy range of 1 eV to 1 KeV. The present work shows in average a good agreement with evaluated data libraries, although sizeable differences have been observed for some resonances. Two new resonances have also been discovered. The accuracy of the resonance partial widths has been improved and the main nuclear quantities such as the neutron strength function have been extracted. (authors)

  18. Computational design of novel inhibitors to overcome weed resistance associated with acetohydroxyacid synthase (AHAS) P197L mutant.

    Science.gov (United States)

    Qu, Ren-Yu; Yang, Jing-Fang; Liu, Yu-Chao; Chen, Qiong; Hao, Ge-Fei; Niu, Cong-Wei; Xi, Zhen; Yang, Guang-Fu

    2017-07-01

    Acetohydroxyacid synthase (AHAS; EC 2.2.1.6) is the first common enzyme in the biosynthetic pathway leading to the branched-chain amino acids in plants and a wide range of microorganisms. With the long-term and wide application of AHAS inhibitors, weed resistance is becoming a global problem, which leads to an urgent demand for novel inhibitors to antagonize both wild-type and resistant AHAS. Pyrimidinyl salicylic acid derivatives, as one of the main classes of commercial AHAS herbicides, show potential anti-resistant bioactivity to wild-type and P197L mutant. In current work, a series of novel 2-benzoyloxy-6-pyrimidinyl salicylic acid derivatives were designed through fragment-based drug discovery. Fortunately, the newly synthesized compounds showed good inhibitory activity against both wild-type and P197L mutant. Some compounds not only had a lower resistance factor value but also showed excellent inhibitory activity against wild-type AHAS and P197L mutant. Furthermore, greenhouse experiments showed compound 11m displayed almost 100% inhibition against both wild-type and high-resistant Descurainia sophia at a dosage of 150 g a.i. ha-1 . The present work indicated that the 2-benzoyloxy-6-pyrimidinyl salicylic acid motif was well worth further optimization. Also, compound 11m could be used as a potential anti-resistant AHAS herbicide, which requires further research. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  19. Resistance mutations of Pro197, Asp376 and Trp574 in the acetohydroxyacid synthase (AHAS) affect pigments, growths, and competitiveness of Descurainia sophia L.

    Science.gov (United States)

    Zhang, Yongzhi; Xu, Yufang; Wang, Shipeng; Li, Xuefeng; Zheng, Mingqi

    2017-11-27

    D. Sophia is one of the most problematic weed species infesting winter wheat in China, and has evolved high resistance to tribenuron-methyl. Amino acid substitutions at site of Pro197, Asp376 and Trp574 in acetohydroxyacid synthase (AHAS) were mainly responsible for D. sophia resistance to tribenuron-methyl. In this study, D. sophia plant individually homozygous for specific AHAS mutation (Pro197Leu, Pro197His, Pro197Ser, Pro197Thr, Asp376Glu and Trp574Leu) were generated. In addition, the effects of resistance mutations on pigments, growths and competitiveness of susceptible (S) and resistant (R) plants of D. sophia were investigated. The results indicated the R plants carrying Pro197Leu or Pro197His or Asp376Glu or Trp574Leu displayed stronger competitiveness than S plants. The adverse effects on R plants aggravated with the increase of R plants proportion, which made the R plants against domination the weed community in absent of herbicide selection. Therefore, these resistance mutation have no obvious adverse effects on the pigments (chlorophyll a, chlorophyll b and carotenoid), relative growth rates (RGR), leaf area ratio (LAR) and net assimilation rate (NAR) of R plants.

  20. miRNA-197 and miRNA-184 are associated with brain metastasis in EGFR-mutant lung cancers.

    Science.gov (United States)

    Remon, J; Alvarez-Berdugo, D; Majem, M; Moran, T; Reguart, N; Lianes, P

    2016-02-01

    The prognostic value of EGFR mutation in lung cancer patients with brain metastases is uncertain and therapeutic efficacy with EGFR TKI is limited. Looking for biomarkers closely related with early tumor changes and brain metastases in non-small cell lung cancer is warranted. MicroRNAs (miRNAs) are frequently deregulated in lung cancer. The objective of this study was to investigate whether some miRNAs are related with brain metastasis risk in EGFR-mutant non-small cell lung cancer patients. miRNA quantification was retrospectively performed in formalin-fixed, extracranial paraffin-embedded adenocarcinoma tumor tissue available from 17 human samples of advanced non-small cell lung cancer patients. Samples were classified as brain metastasis group (5 EGFR-mutant patients with initial BM, EGFRm-BM+; and 6 EGFR wild-type patients with initial BM) and the control group (6 EGFR-mutant NSCLC patients without BM). The RNA obtained was preamplified and retro-transcribed, and the miRNA was quantified with the TaqMan OpenArray Human MiRNA Panel in the QuantStudio™ 12 K Flex Real-Time PCR system. miRNA-197 and miRNA-184 showed a significant higher expression in EGFRm-BM+ group than in the control group (p = 0.017 and p = 0.01, for miRNA-197 and miRNA-184, respectively), with a trend toward overexpression in BM group compared with the control group (p = 0.08 and p = 0.065, for miRNA-197 and miRNA-184, respectively), without differences in expression in BM group according to EGFR mutational status (EGFR wild type vs. EGFR-mutant: p = 0.175 and p = 0.117, for miRNA-197, miRNA-184 respectively). miRNA-197 and miRNA-184 are overexpressed in EGFR-mutant patients with BM and they might be a new biomarker for stratifying the risk of BM in this subpopulation.

  1. A novel c.197T ® A variant among Brazilian neonates with glucose-6-phosphate dehydrogenase deficiency

    Directory of Open Access Journals (Sweden)

    José Pereira de Moura Neto

    2008-01-01

    Full Text Available Glucose-6-phosphate dehydrogenase (G6PD, EC 1.1.1.49 deficiency is the most common enzyme deficiency worldwide, causing a spectrum of diseases including neonatal hyperbilirubinemia and acute or chronic hemolysis. We used the methemoglobin reduction test and G6PD electrophoresis to screen 655 neonates (354 females and 301 males for common G6PD mutations in the city of Salvador in the Northeastern Brazilian state Bahia and found that 66 (10.1% were G6PD-deficient (41 females and 25 males. The 66 (10.1% G6PD-deficient neonates were assessed for the c.376 A -> G (exon 5 and c.202 G -> A (exon 4 mutations using the polymerase chain reaction and restriction enzyme fragment length polymorphism (PCR-RFLP analysis and the results validated by DNA sequencing. Of the 66 G6PD-deficient neonates investigated we found that 54 (81.8% presented the c.376 A -> G (p.Asn126Asp and c.202 G -> A (p.Val68Met mutations, two (3% had the c.376 A -> G mutation only, two (3% had the c.202 G -> A mutation only, five (7.6% exhibited a previously unrecorded 197T -> A (p.Phe66Thr substitution in exon 4 and three showed no mutations at any of these sites. Of the five neonates exhibiting the new 197T -> A (p.Phe66Thr substitution, four (6.1% also presented the c.202 G -> A and c.376 A -> G mutations and one (1.5% had the c.[197T -> A / 202 G -> A] combination. We propose to name the new variant G6PD Bahia.

  2. Excitation functions of fusion reactions and neutron transfer in the interaction of 6He with 197Au and 206Pb

    Science.gov (United States)

    Penionzhkevich, Yu. E.; Astabatyan, R. A.; Demekhina, N. A.; Gulbekian, G. G.; Kalpakchieva, R.; Kulko, A. A.; Lukyanov, S. M.; Markaryan, E. R.; Maslov, V. A.; Muzychka, Yu. A.; Oganessian, Yu. Ts.; Revenko, R. V.; Skobelev, N. K.; Sobolev, Yu. G.; Testov, D. A.; Zholdybaev, T.

    2007-02-01

    Excitation functions for evaporation residues in the reactions 197Au(6He, xn)203-xnTl, x = 2-7, and 206Pb(6He, 2n)210Po, as well as for neutron transfer reactions for the production of 196Au and 198Au in the interaction of 6He with 197Au were measured. The 6He beam was obtained from the accelerator complex for radioactive beams DRIBs (JINR). The maximum energy of the beam was about 10AMeV and the intensity reached 2×107pps. The stacked-foil activation technique was used directly in the beam extracted from the cyclotron or in the focal plane of the magnetic spectrometer MSP-144. The identification of the reaction products was done by their radioactive γ- or α-decay. The fusion reaction with the evaporation of two neutrons was characterized by an increase in the cross-section compared to statistical model calculations. The analysis of the data in the framework of the statistical model for the decay of excited nuclei, which took into account the sequential fusion of 6He has shown good agreement between the experimental and the calculated values of the cross-sections in the case of sub-Coulomb-barrier fusion in the 206Pb + 6He reaction. An unusually large cross-section was observed below the Coulomb barrier for the production of 198Au in the interaction of 6He with 197Au. Possible mechanisms of formation and decay of transfer reaction products are discussed.

  3. Elastic scattering of the halo nucleus 6 He from 197 Au at Elab=27 MeV

    Directory of Open Access Journals (Sweden)

    O. R. Kakuee

    2003-12-01

    Full Text Available   A radioactive ion beam of 6He produced via the 7Li(p,2p6He reaction with typical intensity of 3 × 106 ions/see was elastically scattered from LiF(Au targets. Elastic scattering of 6He at Elab=27 MeV with 197Au have been measured in the angular range of 6º-72º in the laboratory system employing LEDA and LAMP detection system. Optical Model calculations have been used to fit the data .

  4. Anthropometry, DXA and leptin reflect subcutaneous but not visceral abdominal adipose tissue by MRI in 197 healthy adolescents

    DEFF Research Database (Denmark)

    Tinggaard, Jeanette; Hagen, Casper P; Christensen, Anders Nymark

    2017-01-01

    magnetic resonance imaging (MRI). Methods We performed a cross-sectional study that included 197 healthy adolescents (114 boys) aged 10–15 years nested within a longitudinal population-based cohort. Clinical examination, blood sampling, DXA, and abdominal MRI were performed. SAT% and VAT% were adjusted......Background Abdominal fat distribution is associated with the development of cardio-metabolic disease independently of body mass index (BMI). We assessed anthropometry, serum adipokines, and DXA as markers of abdominal subcutaneous adipose tissue (SAT) and visceral adipose tissue (VAT) using...

  5. 100-MeV proton beam intensity measurement by Au activation analysis using {sup 197}Au(p, pn){sup 196}Au and {sup 197}Au(p, p3n){sup 194}Au reactions

    Energy Technology Data Exchange (ETDEWEB)

    Mokhtari Oranj, Leila [Division of Advanced Nuclear Engineering, POSTECH, Pohang 37673 (Korea, Republic of); Jung, Nam-Suk; Oh, Joo-Hee [Pohang Accelerator Laboratory, POSTECH, Pohang 37673 (Korea, Republic of); Lee, Hee-Seock, E-mail: lee@postech.ac.kr [Pohang Accelerator Laboratory, POSTECH, Pohang 37673 (Korea, Republic of)

    2016-05-15

    The proton beam intensity of a 100-MeV proton linac at the Korea Multi-purpose Accelerator Complex (KOMAC) was measured by an Au activation analysis using {sup 197}Au(p, pn){sup 196}Au and {sup 197}Au(p, p3n){sup 194}Au reactions to determine the accuracy and precision of beam intensity measurement using Gafchromic film dosimetry method. The target, irradiated by 100-MeV protons, was arranged in a stack consisting of Au, Al foils and Pb plates. The yields of produced radio-nuclei in Au foils were obtained by gamma-ray spectroscopy. The FLUKA code was employed to calculate the energy spectrum of protons onto the front surface of Au foils located at three different depth points of the target and also to investigate the condition of incident beam on the target. A good agreement was found between the beam intensity measurements using the activation analysis method at three different depth points of the target. An excellent agreement was also observed between the beam intensity measurements using the Au activation analysis method and the dosimetry method using Gafchromic film.

  6. Genetic association analysis of the glutathione peroxidase (GPX1) gene polymorphism (Pro197Leu) with tardive dyskinesia.

    Science.gov (United States)

    Shinkai, Takahiro; Müller, Daniel J; De Luca, Vincenzo; Shaikh, Sajid; Matsumoto, Chima; Hwang, Rudi; King, Nicole; Trakalo, Joseph; Potapova, Natalia; Zai, Gwyneth; Hori, Hiroko; Ohmori, Osamu; Meltzer, Herbert Y; Nakamura, Jun; Kennedy, James L

    2006-02-28

    A possible involvement of oxidative stress in the pathophysiology of tardive dyskinesia (TD) has previously been proposed (reviewed in [Andreassen, O.A., Jorgensen, H.A., 2000. Neurotoxicity associated with neuroleptic-induced oral dyskinesias in rats. Implications for tardive dyskinesia? Progress in Neurobiology 61, 525-541.]). Long-term administration of neuroleptics alters dopaminergic turnover, which results in increased formation of reactive oxygen species (ROS). This is hypothesized to lead to TD through neuronal toxicity as a consequence of oxidative stress. In the present study, the relationship between TD and a possible functional polymorphism of the human glutathione peroxidase (GPX1) gene (an important antioxidant enzyme) was studied in 68 chronic treatment-refractory patients with schizophrenia. A proline (Pro) to leucine (Leu) substitution at codon 197 (Pro197Leu) in the GPX1 gene was genotyped. No significant difference in total Abnormal Involuntary Movements Scale (AIMS) scores was observed among patients in the three genotype groups. Moreover, no significant differences in genotype or allele frequencies were observed between subjects with and without TD. Our results suggest that the GPX1 gene polymorphism does not confer increased susceptibility to TD, although further studies are warranted before a conclusion can be drawn.

  7. Transcutaneous immunization with cross-reacting material CRM(197) of diphtheria toxin boosts functional antibody levels in mice primed parenterally with adsorbed diphtheria toxoid vaccine.

    Science.gov (United States)

    Stickings, Paul; Peyre, Marisa; Coombes, Laura; Muller, Sylviane; Rappuoli, Rino; Del Giudice, Giuseppe; Partidos, Charalambos D; Sesardic, Dorothea

    2008-04-01

    Transcutaneous immunization (TCI) capitalizes on the accessibility and immunocompetence of the skin, elicits protective immunity, simplifies vaccine delivery, and may be particularly advantageous when frequent boosting is required. In this study we examined the potential of TCI to boost preexisting immune responses to diphtheria in mice. The cross-reacting material (CRM(197)) of diphtheria toxin was used as the boosting antigen and was administered alone or together with either one of two commonly used mucosal adjuvants, cholera toxin (CT) and a partially detoxified mutant of heat-labile enterotoxin of Escherichia coli (LTR72). We report that TCI with CRM(197) significantly boosted preexisting immune responses elicited after parenteral priming with aluminum hydroxide-adsorbed diphtheria toxoid (DTxd) vaccine. In the presence of LTR72 as an adjuvant, toxin-neutralizing antibody titers were significantly higher than those elicited by CRM(197) alone and were comparable to the functional antibody levels induced after parenteral booster immunization with the adsorbed DTxd vaccine. Time course study showed that high levels of toxin-neutralizing antibodies persisted for at least 14 weeks after the transcutaneous boost. In addition, TCI resulted in a vigorous antigen-specific proliferative response in all groups of mice boosted with the CRM(197) protein. These findings highlight the promising prospect of using booster administrations of CRM(197) via the transcutaneous route to establish good herd immunity against diphtheria.

  8. Early Clinical Development of ARQ 197, a Selective, Non–ATP-Competitive Inhibitor Targeting MET Tyrosine Kinase for the Treatment of Advanced Cancers

    Science.gov (United States)

    Schwartz, Brian; Garmey, Edward

    2011-01-01

    Expression of the receptor tyrosine kinase c-MET (MET, mesenchymal-epithelial transition factor) in many cancers, and its participation in multiple signal transduction pathways involved in malignant tumor growth, suggest a wide therapeutic potential for MET inhibition in human cancer. Here we describe the discovery and early clinical development of ARQ 197, a novel, selective, non–ATP-competitive inhibitor of MET. Phase I studies demonstrate that ARQ 197 has a predictable pharmacokinetics and favorable safety profile, making it a potentially ideal partner for combination with cytotoxic chemotherapies and targeted anticancer agents. Results from phase I and phase II trials demonstrate preliminary evidence of anticancer activity. New data from a global phase II randomized trial comparing a combination of ARQ 197 plus erlotinib with erlotinib/placebo, in endothelial growth factor receptor inhibitor-naïve patients with locally advanced/metastatic non–small cell lung cancer, demonstrate improvement in progression-free and overall survival with combined therapy. Results were especially pronounced for patients with non–squamous lung cancer histologies, and in particular molecularly defined subgroups including KRAS mutations. These and other data from ARQ 197 clinical trials in hepatocellular, germ-cell, pancreatic (in combination with gemcitabine), and colorectal (in combination with cetuximab and irinotecan) cancers further highlight the potential role of ARQ 197 in existing and emerging anticancer therapeutic regimens. PMID:21632449

  9. Early clinical development of ARQ 197, a selective, non-ATP-competitive inhibitor targeting MET tyrosine kinase for the treatment of advanced cancers.

    Science.gov (United States)

    Adjei, Alex A; Schwartz, Brian; Garmey, Edward

    2011-01-01

    Expression of the receptor tyrosine kinase c-MET (MET, mesenchymal-epithelial transition factor) in many cancers, and its participation in multiple signal transduction pathways involved in malignant tumor growth, suggest a wide therapeutic potential for MET inhibition in human cancer. Here we describe the discovery and early clinical development of ARQ 197, a novel, selective, non-ATP-competitive inhibitor of MET. Phase I studies demonstrate that ARQ 197 has a predictable pharmacokinetics and favorable safety profile, making it a potentially ideal partner for combination with cytotoxic chemotherapies and targeted anticancer agents. Results from phase I and phase II trials demonstrate preliminary evidence of anticancer activity. New data from a global phase II randomized trial comparing a combination of ARQ 197 plus erlotinib with erlotinib/placebo, in endothelial growth factor receptor inhibitor-naïve patients with locally advanced/metastatic non-small cell lung cancer, demonstrate improvement in progression-free and overall survival with combined therapy. Results were especially pronounced for patients with non-squamous lung cancer histologies, and in particular molecularly defined subgroups including KRAS mutations. These and other data from ARQ 197 clinical trials in hepatocellular, germ-cell, pancreatic (in combination with gemcitabine), and colorectal (in combination with cetuximab and irinotecan) cancers further highlight the potential role of ARQ 197 in existing and emerging anticancer therapeutic regimens.

  10. Discovery of a Novel Mode of Protein Kinase Inhibition Characterized by the Mesenchymal-epithelial Transition Factor (c-Met) Protein Autophosphorylation by ARQ 197

    Energy Technology Data Exchange (ETDEWEB)

    S Eathiraj; R Palma; E Volckova; M Hirschi; D France; M Ashwell; T Chan

    2011-12-31

    A number of human malignancies exhibit sustained stimulation, mutation, or gene amplification of the receptor tyrosine kinase human mesenchymal-epithelial transition factor (c-Met). ARQ 197 is a clinically advanced, selective, orally bioavailable, and well tolerated c-Met inhibitor, currently in Phase 3 clinical testing in non-small cell lung cancer patients. Herein, we describe the molecular and structural basis by which ARQ 197 selectively targets c-Met. Through our analysis we reveal a previously undisclosed, novel inhibitory mechanism that utilizes distinct regulatory elements of the c-Met kinase. The structure of ARQ 197 in complex with the c-Met kinase domain shows that the inhibitor binds a conformation that is distinct from published kinase structures. ARQ 197 inhibits c-Met autophosphorylation and is highly selective for the inactive or unphosphorylated form of c-Met. Through our analysis of the interplay between the regulatory and catalytic residues of c-Met, and by comparison between the autoinhibited canonical conformation of c-Met bound by ARQ 197 to previously described kinase domains of type III receptor tyrosine kinases, we believe this to be the basis of a powerful new in silico approach for the design of similar inhibitors for other protein kinases of therapeutic interest.

  11. 71 W (19.7 W/mm) SiC BJTs for long-pulse UHF radar applications

    Science.gov (United States)

    Zhao, Feng

    2009-11-01

    In this paper, we present 71 W SiC bipolar junction transistors (BJTs) using state of the art technology. The devices were fabricated on a commercial n-type 4H-SiC substrate using a double-mesa etch and interdigitated emitter-base finger design. When operating under common-emitter configuration and long pulse RF conditions of 15 ms pulse width and 25% duty cycle, the packaged devices without internal matching exhibited 8.5 dB power gain and 71 W output power with a 50.7% power added efficiency (PAE) at 500 MHz. The power density is 19.7 W/mm normalized to total emitter finger length. The normally-off characteristic and superior long pulse RF performance makes these SiC transistors promising for use in compact power amplifiers in long-pulse UHF radar systems.

  12. Extended adjuvant endocrine therapy in hormone dependent breast cancer: the paradigm of the NCIC-CTG MA.17/BIG 1-97 trial.

    Science.gov (United States)

    Higgins, Michaela J; Liedke, Pedro E R; Goss, Paul E

    2013-04-01

    Early hormone-receptor-positive breast cancer is a chronic relapsing disease that can remain clinically silent for many years. The NCIC-CTG MA.17/BIG 1-97 trial randomized disease-free early breast cancer patients who had received five years of adjuvant tamoxifen to either letrozole or placebo and was the first to demonstrate a benefit with extended endocrine therapy. MA.17/BIG 1-97 was stopped at the first interim analysis because disease free survival was strongly prolonged in the letrozole arm. Subsequent subset analyses and longer follow up have shown that this therapy improved survival across all groups, particularly among women with node-positive disease and those that were pre-menopausal at time of study enrolment. The MA.17/BIG 1-97 study should be considered a paradigm for extended adjuvant endocrine therapy in hormone-receptor-positive early breast cancer. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  13. Analysis of manganese superoxide dismutase (MnSOD: Ala-9Val and glutathione peroxidase (GSH-Px: Pro 197 Leu gene polymorphisms in mood disorders.

    Directory of Open Access Journals (Sweden)

    Birgül Elbozan Cumurcu

    2013-05-01

    Full Text Available We investigated the etiopathogenetic role of manganese superoxide dismutase (MnSOD (Ala-9Val and glutathione peroxidase (GSH-Px (Pro 197 Leu gene polymorphisms in patients diagnosed with major depressive disorder (MDD and bipolar I disorder (BD. Eighty patients with MDD, 82 patients with BD (total 162 patients and 96 healthy controls were enrolled in this study and genotyped using a Real Time-Quantitative Polymer Chain Reaction (RT-qPCR-based method. The patients with BD and MDD and the controls had a similar distribution of the genotypes and alleles in the Ala-9Val MnSOD gene polymorphism. Comparison of the MDD group and control group regarding the Pro197 Leu GSH-Px gene polymorphism revealed similar genotype distribution but different allele distribution. The BD group and control group were similar both for genotypes and for alleles when compared regarding the Pro 197 Leu GSH-Px gene polymorphism. The combined analysis (MDD plus BD also failed to find any association between the Ala-9Val MnSOD and Pro 197 Leu GSH-Px gene polymorphism. Although small statistical power of the current study the significant difference between patients with depression and the control group for the Pro 197 Leu GSH-Px polymorphism indicates that the distribution of these alleles may have a contribution in the physiopathogenesis of depression. One of the limitation of the current study is that the sample size is too small. Understanding of the exact role of Pro 197 LeuGSH-Px polymorphism in the development of depression needs to further studies with more sample size and high statistical power.

  14. Enhanced inhibition of murine prostatic carcinoma growth by immunization with or administration of viable human umbilical vein endothelial cells and CRM197

    Directory of Open Access Journals (Sweden)

    Zhang Huiyong

    2011-02-01

    Full Text Available Vaccination with xenogeneic and syngeneic endothelial cells is effective for inhibiting tumor growth. Nontoxic diphtheria toxin (CRM197, as an immunogen or as a specific inhibitor of heparin-binding EGF-like growth factor, has shown promising antitumor activity. Therefore, immunization with or administration of viable human umbilical vein endothelial cells (HUVECs combined with CRM197 could have an enhanced antitumor effect. Six-week-old C57BL/6J male mice were vaccinated with viable HUVECs, 1 x 10(6 viable HUVECs combined with 100 μg CRM197, or 100 μg CRM197 alone by ip injections once a week for 4 consecutive weeks. RM-1 cells (5 x 10(5 were inoculated by sc injection as a preventive procedure. During the therapeutic procedure, 6-week-old male C57BL/6J mice were challenged with 1 x 10(5 RM-1 cells, then injected sc with 1 x 10(6 viable HUVECs, 1 x 10(6 viable HUVECs + 100 μg CRM197, and 100 μg CRM197 alone twice a week for 4 consecutive weeks. Tumor volume and life span were monitored. We also investigated the effects of immunization with HUVECs on the aortic arch wall and on wound healing. Vaccination with or administration of viable HUVECs+CRM197 enhanced the inhibition of RM-1 prostatic carcinoma by 24 and 29%, respectively, and prolonged the life span for 3 and 4 days, respectively, compared with those of only vaccination or administration with viable HUVECs of tumor-bearing C57BL/6J mice. Furthermore, HUVEC immunization caused some damage to the aortic arch wall but did not have remarkable effects on the rate of wound healing; the wounds healed in approximately 13 days. Treatment with CRM197 in combination with viable HUVECs resulted in a marked enhancement of the antitumor effect in the preventive or therapeutic treatment for prostatic carcinoma in vivo, suggesting a novel combination for anti-cancer therapy.

  15. Catalytic residues Lys197 and Arg199 of Bacillus subtilis phosphoribosyl diphosphate synthase. Alanine-scanning mutagenesis of the flexible catalytic loop

    DEFF Research Database (Denmark)

    Hove-Jensen, Bjarne; Bentsen, Ann-Kristin K; Harlow, Kenneth W

    2005-01-01

    Eleven of the codons specifying the amino acids of the flexible catalytic loop [KRRPRPNVAEVM(197-208)] of Bacillus subtilis phosphoribosyl diphosphate synthase have been changed individually to specify alanine. The resulting variant enzyme forms, as well as the wildtype enzyme, were produced...... in an Escherichia coli strain lacking endogenous phosphoribosyl diphosphate synthase activity and purified to near homogeneity. The B. subtilis phosphoribosyl diphosphate synthase mutant variants K197A and R199A were studied in detail. The physical properties of the two enzymes were similar to those of the wildtype...

  16. Targeted delivery of rosmarinic acid across the blood-brain barrier for neuronal rescue using polyacrylamide-chitosan-poly(lactide-co-glycolide) nanoparticles with surface cross-reacting material 197 and apolipoprotein E.

    Science.gov (United States)

    Kuo, Yung-Chih; Rajesh, Rajendiran

    2017-08-07

    Rosmarinic acid-loaded polyacrylamide-chitosan-poly(lactide-co-glycolide) nanoparticles (RA-PAAM-CH-PLGA NPs) were grafted with cross-reacting material 197 (CRM197) and apolipoprotein E (ApoE) for targeting of the blood-brain barrier (BBB) and rescuing degenerated neurons. The polymeric nanocarriers were prepared by microemulsion, solvent diffusion, grafting, and surface modification, and CRM197-ApoE-RA-PAAM-CH-PLGA NPs were used to treat human brain-microvascular endothelial cells, RWA264.7 cells, and Aβ-insulted SK-N-MC cells. Experimental results revealed that an increase in the weight percentage of PAAM decreased the particle size, zeta potential, and grafting efficiency of CRM197 and ApoE. In addition, surface DSPE-PEG(2000) could protect CRM197-ApoE-RA-PAAM-CH-PLGA NPs against uptake by RWA264.7 cells. An increase in the concentration of CRM197 and ApoE decreased the transendothelial electrical resistance and increased the ability of propidium iodide and RA to cross the BBB. The order in the viability of apoptotic SK-N-MC cells was CRM197-ApoE-RA-PAAM-CH-PLGA NPs > CRM197-RA-PAAM-CH-PLGA NPs > RA. Thus, CRM197-ApoE-RA-PAAM-CH-PLGA NPs can be a promising formulation to deliver RA to Aβ-insulted neurons in the pharmacotherapy of Alzheimer's disease. Copyright © 2017 Elsevier B.V. All rights reserved.

  17. Biofilm formation and cellulose expression by Bordetella avium 197N, the causative agent of bordetellosis in birds and an opportunistic respiratory pathogen in humans.

    Science.gov (United States)

    McLaughlin, Kimberley; Folorunso, Ayorinde O; Deeni, Yusuf Y; Foster, Dona; Gorbatiuk, Oksana; Hapca, Simona M; Immoor, Corinna; Koza, Anna; Mohammed, Ibrahim U; Moshynets, Olena; Rogalsky, Sergii; Zawadzki, Kamil; Spiers, Andrew J

    2017-06-01

    Although bacterial cellulose synthase (bcs) operons are widespread within the Proteobacteria phylum, subunits required for the partial-acetylation of the polymer appear to be restricted to a few γ-group soil, plant-associated and phytopathogenic pseudomonads, including Pseudomonas fluorescens SBW25 and several Pseudomonas syringae pathovars. However, a bcs operon with acetylation subunits has also been annotated in the unrelated β-group respiratory pathogen, Bordetella avium 197N. Our comparison of subunit protein sequences and GC content analyses confirms the close similarity between the B. avium 197N and pseudomonad operons and suggests that, in both cases, the cellulose synthase and acetylation subunits were acquired as a single unit. Using static liquid microcosms, we can confirm that B. avium 197N expresses low levels of cellulose in air-liquid interface biofilms and that biofilm strength and attachment levels could be increased by elevating c-di-GMP levels like the pseudomonads, but cellulose was not required for biofilm formation itself. The finding that B. avium 197N is capable of producing cellulose from a highly-conserved, but relatively uncommon bcs operon raises the question of what functional role this modified polymer plays during the infection of the upper respiratory tract or survival between hosts, and what environmental signals control its production. Copyright © 2017 Institut Pasteur. All rights reserved.

  18. Measurement of cross sections for alpha-induced reactions on 197Auand thick-target yields for the (alpha,gamma) process on 64Zn and63Cu

    Energy Technology Data Exchange (ETDEWEB)

    Basunia, M.S.; Shugart, H.A.; Smith, A.R.; Norman, E.B.

    2006-08-07

    We have measured the cross sections for the197Au(alpha,gamma)201Tl and 197Au(alpha,2n)199Tl reactions in the 17.9-to 23.9-MeV energy range, and 197Au(alpha,n)200Tl reaction in the 13.4-to 23.9-MeV energy range using an activation technique. Thick-targetyields for the 64Zn(alpha,gamma)68Ge (7- to 14-MeV) and63Cu(alpha,gamma)67Ga (7-MeV) reactions were measured. For allmeasurements, natural elements were bombarded with He+ beams from the88-inch Cyclotron at the Lawrence Berkeley National Laboratory (LBNL).Irradiated samples were counted using a gamma-spectrometry system at LBNLs Low Background Facility. Measured 197Au(alpha,gamma)201Tlcross-sections were compared with the NON-SMOKER theoretical values. Thethick-target yields for the 64Zn(alpha,gamma)68Ge and63Cu(alpha,gamma)67Ga reactions are also compared with the theoreticalyield, calculated numerically using the energy dependent NON-SMOKER crosssection data. In both cases, measured values are found to follow a trendof overlapping the predicted value near the alpha nucleus barrier heightand fall below with a slowly widening difference between them in the subbarrier energy points.

  19. Combination of BIBW2992 and ARQ 197 is effective against erlotinib-resistant human lung cancer cells with the EGFR T790M mutation.

    Science.gov (United States)

    Qu, Geping; Liu, Changting; Sun, Baojun; Zhou, Changxi; Zhang, Zhijian; Wang, Peng

    2014-07-01

    Although the EGFR tyrosine kinase inhibitors (EGFR-TKI) erlotinib and gefitinib have shown marked effects against EGFR-mutated lung cancer, patients acquire resistance by various mechanisms, including the EGFR T790M mutation and Met induction, consequently suffering relapse. Thus, novel agents to overcome EGFR-TKI resistance are urgently needed. We aimed to investigate the inhibitory effects of a combination of BIBW2992 (irreversible EGFR inhibitor)/ARQ 197 (MET inhibitor) on the human lung adenocarcinoma cell line H1975. H1975 cells (harboring a T790M mutation in EGFR) were treated with erlotinib, BIBW2992 or ARQ 197 separately or with combinations of erlotinib/ARQ 197 or BIBW2992/ARQ 197. Cell growth, apoptosis and cell cycle distribution were evaluated by MTT assay, Annexin V/propidium iodide (PI) double staining and flow cytometry, respectively. EGFR, MET, AKT, ERK and the respective phosphorylated counterparts were detected by western blot analysis. Pathway-specific knockdown of MET and/or EGFR kinase signaling was achieved by siRNA interference. H1975 cells displayed EGFR and MET activation, and were resistant to erlotinib. The BIBW2992/ARQ 197 combination significantly inhibited growth, induced cell cycle arrest and apoptosis, and altered the phosphorylation of EGFR, MET, AKT and ERK1/2 in the H1975 cells. Phosphorylation of AKT and ERK1/2, downstream effectors of the EGFR and MET pathways, was not affected by the other tested treatments. Finally, knockdown of MET and/or EGFR in the H1975 cells confirmed the enhanced downstream inhibition of both MET and EGFR pathways. Combination of an irreversible EGFR inhibitor and MET inhibitor is effective in controlling H1975 cells with acquired resistance to erlotinib, by a mechanism involving the downregulation of PI3K/AKT and MEK/ERK signaling pathways.

  20. {sup 197}Au irradiation study of phase-change memory cell with GeSbTe alloy

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Liangcai; Song, Zhitang; Lian, Jie; Rao, Feng; Liu, Bo; Song, Sannian; Liu, Weili; Feng, Songlin [State Key Laboratory of Functional Materials for Informatics, Laboratory of Nanotechnology, Shanghai Institute of Micro-system and Information Technology, Chinese Academy of Sciences, Shanghai 200050 (China); Zhou, Xilin; Liu, Xuyan [State Key Laboratory of Functional Materials for Informatics, Laboratory of Nanotechnology, Shanghai Institute of Micro-system and Information Technology, Chinese Academy of Sciences, Shanghai 200050 (China); Graduate School of the Chinese Academy of Sciences, Beijing 100080 (China)

    2010-10-15

    A {sup 197}Au ion source was used to irradiate a Ge{sub 2}Sb{sub 2}Te{sub 5}-alloy-based phase-change memory (PCM) cell to study the ion-irradiation effect on the properties of the cell. The PCM devices with the tungsten (W) heating electrode of 260 nm diameter were fabricated by 0.18 {mu}m complementary metal-oxide-semiconductor (CMOS) technology. Four different doses (10{sup 10}, 10{sup 11}, 10{sup 12}, and 5 x 10{sup 12} ions/cm{sup 2}, respectively) were applied to irradiate the PCM cell. The samples before and after irradiation were characterized by current-voltage and resistance measurements at room temperature. It is found that the cell properties (resistance value of the amorphous and crystalline states, threshold voltage, and current for phase transition, etc.) have hardly changed, even for the sample irradiated up to 10{sup 12} ions/cm{sup 2} dose, and the cell still has good set-reset operation ability (above 10{sup 5} cycles). Furthermore, the resistance ratio remains at 1000 even after 10{sup 5} cycles of the set-reset operation. The results show the PCM cell with Ge{sub 2}Sb{sub 2}Te{sub 5} alloy has a strong ion-irradiation tolerance. (Abstract Copyright [2010], Wiley Periodicals, Inc.)

  1. Mass and charge flow in the reaction 7.1 MeV/u197Au+63Cu

    Science.gov (United States)

    Jäckel, B.; Rox, A.; Esterlund, R. A.; Westmeier, W.; Knaack, M.; Patzelt, P.

    1991-12-01

    Mass-yield and angular-distribution data are presented for products from the reaction of 7.1 MeV/ μ 197Au with63Cu. With help from information derived from the latter, the former are classified into components corresponding to quasielastic transfer (580±80 mb), deep-inelastic transfer plus quasifission (1300±130 mb), fusionfission (≦195 mb), and sequential fission (195±45 mb). The fusion excitation function calculated with the Dynamic Capture model standard parameter set reproduces our deduced fusion-fission cross section well. Moreover, using this cross section as well as additional published data for the same reaction system, we extract an s-wave fusion-barrier shift (“extra push”) for this system of 35±7 MeV, which is in good agreement with the systematics derived from other fusion-barrier shifts which have been reported in the literature. Lastly, support is found for the Dissipative Diabatic Dynamics model prediction that dynamically-hindered fusion trajectories are reflected into quasielastic channels.

  2. Mass and charge flow in the reaction 7. 1 MeV/u sup 197 Au+ sup 63 Cu

    Energy Technology Data Exchange (ETDEWEB)

    Jaeckel, B.; Rox, A.; Esterlund, R.A.; Westmeier, W.; Knaack, M.; Patzelt, P. (Marburg Univ. (Germany, F.R.). Fachgebiet Kernchemie)

    1991-08-01

    Mass-yield and angular-distribution data are presented for products from the reaction of 7.1 MeV/u {sup 197}Au with {sup 63}Cu. With help from information derived from the latter, the former are calssified into components corresponding to quasielastic transfer (580+-80 mb), deep-inelastic transfer plus quasifission (1300+-130 mb), fusion-fission ({le}195 mb), and sequential fission (195+-45 mb). The fusion excitation function calculated with the Dynamic Capture model standard parameter set reproduces our deduced fusion-fission cross section well. Moreover, using this cross section as well as additional published data for the same reaction system, we extract an s-wave fusion-barrier shift ('extra push') for this system of 35+-7 MeV, which is in good agreement with the systematics derived from other fusion-barrier shifts which have been reported in the literature. Lastly, support is found for the Dissipative Diabatic Dynamics model prediction that dynamically-hindered fusion trajectories are reflected into quasielastic channels. (orig.).

  3. Targeting the Pro-Survival Protein MET with Tivantinib (ARQ 197) Inhibits Growth of Multiple Myeloma Cells12

    Science.gov (United States)

    Zaman, Shadia; Shentu, Shujun; Yang, Jing; He, Jin; Orlowski, Robert Z.; Stellrecht, Christine M.; Gandhi, Varsha

    2015-01-01

    The hepatocyte growth factor (HGF)/MNNG HOS transforming gene (MET) pathway regulates cell growth, survival, and migration. MET is mutated or amplified in several malignancies. In myeloma, MET is not mutated, but patients have high plasma concentrations of HGF, high levels of MET expression, and gene copy number, which are associated with poor prognosis and advanced disease. Our previous studies demonstrated that MET is critical for myeloma cell survival and its knockdown induces apoptosis. In our current study, we tested tivantinib (ARQ 197), a small-molecule pharmacological MET inhibitor. At clinically achievable concentrations, tivantinib induced apoptosis by > 50% in all 12 human myeloma cell lines tested. This biologic response was associated with down-regulation of MET signaling and inhibition of the mitogen-activated protein kinase and phosphoinositide 3-kinase pathways, which are downstream of the HGF/MET axis. Tivantinib was equally effective in inducing apoptosis in myeloma cell lines resistant to standard chemotherapy (melphalan, dexamethasone, bortezomib, and lenalidomide) as well as in cells that were co-cultured with a protective bone marrow microenvironment or with exogenous cytokines. Tivantinib induced apoptosis in CD138 + plasma cells from patients and demonstrated efficacy in a myeloma xenograft mouse model. On the basis of these data, we initiated a clinical trial for relapsed/refractory multiple myeloma (MM). In conclusion, MET inhibitors may be an attractive target-based strategy for the treatment of MM. PMID:25810013

  4. Targeting the pro-survival protein MET with tivantinib (ARQ 197) inhibits growth of multiple myeloma cells.

    Science.gov (United States)

    Zaman, Shadia; Shentu, Shujun; Yang, Jing; He, Jin; Orlowski, Robert Z; Stellrecht, Christine M; Gandhi, Varsha

    2015-03-01

    The hepatocyte growth factor (HGF)/MNNG HOS transforming gene (MET) pathway regulates cell growth, survival, and migration. MET is mutated or amplified in several malignancies. In myeloma, MET is not mutated, but patients have high plasma concentrations of HGF, high levels of MET expression, and gene copy number, which are associated with poor prognosis and advanced disease. Our previous studies demonstrated that MET is critical for myeloma cell survival and its knockdown induces apoptosis. In our current study, we tested tivantinib (ARQ 197), a small-molecule pharmacological MET inhibitor. At clinically achievable concentrations, tivantinib induced apoptosis by >50% in all 12 human myeloma cell lines tested. This biologic response was associated with down-regulation of MET signaling and inhibition of the mitogen-activated protein kinase and phosphoinositide 3-kinase pathways, which are downstream of the HGF/MET axis. Tivantinib was equally effective in inducing apoptosis in myeloma cell lines resistant to standard chemotherapy (melphalan, dexamethasone, bortezomib, and lenalidomide) as well as in cells that were co-cultured with a protective bone marrow microenvironment or with exogenous cytokines. Tivantinib induced apoptosis in CD138+ plasma cells from patients and demonstrated efficacy in a myeloma xenograft mouse model. On the basis of these data, we initiated a clinical trial for relapsed/refractory multiple myeloma (MM). In conclusion, MET inhibitors may be an attractive target-based strategy for the treatment of MM. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

  5. A Phase-1b study of tivantinib (ARQ 197) in adult patients with hepatocellular carcinoma and cirrhosis.

    Science.gov (United States)

    Santoro, A; Simonelli, M; Rodriguez-Lope, C; Zucali, P; Camacho, L H; Granito, A; Senzer, N; Rimassa, L; Abbadessa, G; Schwartz, B; Lamar, M; Savage, R E; Bruix, J

    2013-01-15

    The mesenchymal-epithelial transition factor (MET) receptor is dysregulated in hepatocellular carcinoma (HCC), and tivantinib (ARQ 197) is an oral, selective, MET inhibitor. This Phase-1b study assessed tivantinib safety as primary objective in patients with previously treated HCC and Child-Pugh A or B liver cirrhosis. Patients received oral tivantinib 360 mg twice daily until disease progression or unacceptable toxicity. Among 21 HCC patients, common drug-related adverse events (AEs) were neutropaenia, anaemia, asthenia, leucopaenia, anorexia, diarrhoea, and fatigue. No drug-related worsening of liver function or performance status occurred, but one Child-Pugh B patient experienced drug-related bilirubin increase. Four patients had drug-related serious AEs, including one neutropaenia-related death. Haematologic toxicities were more frequent than in previous tivantinib studies but were manageable with prompt therapy. Best response was stable disease (median, 5.3 months) in 9 of 16 evaluable patients (56%). Median time to progression was 3.3 months. Tivantinib demonstrated a manageable safety profile and preliminary antitumour activity in patients with HCC and Child-Pugh A or B cirrhosis.

  6. SAJCC 197.indd

    African Journals Online (AJOL)

    adaptive support ventilation (ASV) is a closed-loop, fully automatic method of mechanical ventilation. This advanced mode of ventilation ... new mode with ASV and synchronised intermittent mandatory ventilation (SIMV) modes. Methods.

  7. Pages 193 - 197.pmd

    African Journals Online (AJOL)

    Administrator

    Results: Age >60 years, female sex, presence of diabetic retinopathy (DR), proliferative DR, shorter DM duration, glaucoma, macular ... Conclusion: The risk of visual disability is 4 times higher in patients with diabetic retinopathy and 2 times higher in females with DM. ..... patients. Oxidative stress may accelerate DR and.

  8. Pages 193 - 197.pmd

    African Journals Online (AJOL)

    Administrator

    cataracts, macular degeneration and glaucoma)4. The same situation is shown in emerging economic areas5,6. In sub-Saharan Africa (SSA) however, the issues of visual disability due to Diabetes Mellitus. (DM) are overshadowed by the ...

  9. Recent origin and spread of a common Lithuanian mutation, G197del LDLR, causing familial hypercholesterolemia: positive selection is not always necessary to account for disease incidence among Ashkenazi Jews

    NARCIS (Netherlands)

    Durst, R.; Colombo, R.; Shpitzen, S.; Avi, L. B.; Friedlander, Y.; Wexler, R.; Raal, F. J.; Marais, D. A.; Defesche, J. C.; Mandelshtam, M. Y.; Kotze, M. J.; Leitersdorf, E.; Meiner, V.

    2001-01-01

    G197del is the most prevalent LDL receptor (LDLR) mutation causing familial hypercholesterolemia (FH) in Ashkenazi Jew (AJ) individuals. The purpose of this study was to determine the origin, age, and population distribution of G197del, as well as to explore environmental and genetic effects on

  10. miRNA-197 and miRNA-223 Predict Cardiovascular Death in a Cohort of Patients with Symptomatic Coronary Artery Disease.

    Directory of Open Access Journals (Sweden)

    Christian Schulte

    Full Text Available Circulating microRNAs (miRNAs have been described as potential diagnostic biomarkers in cardiovascular disease and in particular, coronary artery disease (CAD. Few studies were undertaken to perform analyses with regard to risk stratification of future cardiovascular events. miR-126, miR-197 and miR-223 are involved in endovascular inflammation and platelet activation and have been described as biomarkers in the diagnosis of CAD. They were identified in a prospective study in relation to future myocardial infarction.The aim of our study was to further evaluate the prognostic value of these miRNAs in a large prospective cohort of patients with documented CAD.Levels of miR-126, miR-197 and miR-223 were evaluated in serum samples of 873 CAD patients with respect to the endpoint cardiovascular death. miRNA quantification was performed using real time polymerase chain reaction (RT-qPCR.The median follow-up period was 4 years (IQR 2.78-5.04. The median age of all patients was 64 years (IQR 57-69 with 80.2% males. 38.9% of the patients presented with acute coronary syndrome (ACS, 61.1% were diagnosed with stable angina pectoris (SAP. Elevated levels of miRNA-197 and miRNA-223 reliably predicted future cardiovascular death in the overall group (miRNA-197: hazard ratio (HR 1.77 per one standard deviation (SD increase (95% confidence interval (CI 1.20; 2.60, p = 0.004, C-index 0.78; miRNA-223: HR 2.23 per one SD increase (1.20; 4.14, p = 0.011, C-index 0.80. In ACS patients the prognostic power of both miRNAs was even higher (miRNA-197: HR 2.24 per one SD increase (1.25; 4.01, p = 0.006, C-index 0.89; miRA-223: HR 4.94 per one SD increase (1.42; 17.20, p = 0.012, C-index 0.89.Serum-derived circulating miRNA-197 and miRNA-223 were identified as predictors for cardiovascular death in a large patient cohort with CAD. These results reinforce the assumption that circulating miRNAs are promising biomarkers with prognostic value with respect to future

  11. The effect of preexisting anti-carrier immunity on subsequent responses to CRM197 or Qb-VLP conjugate vaccines.

    Science.gov (United States)

    McCluskie, Michael J; Evans, Dana M; Zhang, Ningli; Benoit, Michelle; McElhiney, Susan P; Unnithan, Manu; DeMarco, Suzanne C; Clay, Bryan; Huber, Christoph; Deora, Aparna; Thorn, Jennifer M; Stead, David R; Merson, James R; Davis, Heather L

    2016-06-01

    Certain antigens, such as haptens (small molecules), short peptides, and carbohydrates (e.g. bacterial polysaccharides) are non- or poorly immunogenic unless conjugated to a carrier molecule that provides a structural scaffold for antigen presentation as well as T cell help required for B-cell activation and maturation. However, the carriers themselves are immunogenic and resulting carrier-specific immune responses may impact the immunogenicity of other conjugate vaccines using the same carrier that are administered subsequently. Herein, using two different carriers (cross-reactive material 197, CRM and Qb-VLP), we examined in mice the impact that preexisting anti-carrier antibodies (Ab) had on subsequent immune responses to conjugates with either the same or a different carrier. For this purpose, we used two nicotine hapten conjugates (NIC7-CRM or NIC-Qb), two IgE peptide conjugates (Y-CRM or Y-Qb), and a pneumococcal polysaccharide conjugate (Prevnar 13(®)). Prior exposure to CRM or Qb-VLP significantly reduced subsequent responses to the conjugated antigen having the homologous carrier, with the exception of Prevnar 13® where anti-polysaccharide responses were similar to those in animals without preexisting anti-carrier Ab. Collectively, the data suggest that the relative sizes of the antigen and carrier, as well as the conjugation density for a given conjugate impact the extent of anti-carrier suppression. All animals developed anti-carrier responses with repeat vaccination and the differences in Ab titer between groups with and without preexisting anti-carrier responses became less apparent; however, anti-carrier effects were more durable for Ab function.

  12. Real-world data of 197 patients treated with ulipristal acetate for uterine fibroids: PREMYA study French population main outcomes.

    Science.gov (United States)

    Fernandez, H; Descamps, P; Koskas, M; Lopès, P; Brun, J L; Darai, E; Agostini, A

    2017-09-01

    To characterize and describe treatment with ulipristal acetate (UPA) in a preoperative setting and to evaluate the safety, effectiveness, and Health Related Quality of Life (HRQoL) outcomes in a French population treated according to standard clinical practice. Multicentre, prospective, non-interventional study (PREMYA) of patients diagnosed with moderate to severe symptoms of uterine fibroids and undergoing a preoperative treatment with UPA 5mg (Esmya®). Patients were followed for a total of 15months (3months UPA treatment and 12months after). Data were collected approximatively every 3months according to centre usual visit schedule. A total of 206 women were enrolled in France, of whom 197 were found to be eligible for data analysis. Physicians' assessments of patients' overall symptomatic changes, as measured on the Clinical Global Impression-Improvement (CGI-I) scale, indicated that 83.7% of patients were improved at end of treatment (month 3). On the patients' treatment benefit scale (PTBS), 94.7% of patients reported an improvement. These 2 measurements, pain and quality of life, remained improved after treatment cessation and during the entire period of follow-up. Only 58.4% of patients underwent surgery within the timeframe of the study follow-up of which the majority were of a conservative/minimal invasive nature. Many patients did not undergo surgery during the planned 12months follow-up period after treatment whereas all patients had an indication of surgery. All measurements of treatment outcome were markedly improved by 3 months of UPA 5mg treatment. NCT01635452. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  13. Tivantinib (ARQ 197) exhibits antitumor activity by directly interacting with tubulin and overcomes ABC transporter-mediated drug resistance.

    Science.gov (United States)

    Aoyama, Aki; Katayama, Ryohei; Oh-Hara, Tomoko; Sato, Shigeo; Okuno, Yasushi; Fujita, Naoya

    2014-12-01

    Tivantinib (ARQ197) was first reported as a highly selective inhibitor of c-MET and is currently being investigated in a phase III clinical trial. However, as recently reported by us and another group, tivantinib showed cytotoxic activity independent of cellular c-MET status and also disrupted microtubule dynamics. To investigate if tivantinib exerts its cytotoxic activity by disrupting microtubules, we quantified polymerized tubulin in cells and xenograft tumors after tivantinib treatment. Consistent with our previous report, tivantinib reduced tubulin polymerization in cells and in mouse xenograft tumors in vivo. To determine if tivantinib directly binds to tubulin, we performed an in vitro competition assay. Tivantinib competitively inhibited colchicine but not vincristine or vinblastine binding to purified tubulin. These results imply that tivantinib directly binds to the colchicine binding site of tubulin. To predict the binding mode of tivantinib with tubulin, we performed computer simulation of the docking pose of tivantinib with tubulin using GOLD docking program. Computer simulation predicts tivantinib fitted into the colchicine binding pocket of tubulin without steric hindrance. Furthermore, tivantinib showed similar IC50 values against parental and multidrug-resistant cells. In contrast, other microtubule-targeting drugs, such as vincristine, paclitaxel, and colchicine, could not suppress the growth of cells overexpressing ABC transporters. Moreover, the expression level of ABC transporters did not correlate with the apoptosis-inducing ability of tivantinib different from other microtubule inhibitor. These results suggest that tivantinib can overcome ABC transporter-mediated multidrug-resistant tumor cells and is potentially useful against various tumors. ©2014 American Association for Cancer Research.

  14. Tivantinib (ARQ 197) efficacy is independent of MET inhibition in non-small-cell lung cancer cell lines.

    Science.gov (United States)

    Calles, Antonio; Kwiatkowski, Nicholas; Cammarata, Bernard K; Ercan, Dalia; Gray, Nathanael S; Jänne, Pasi A

    2015-01-01

    MET targeted therapies are under clinical evaluation for non-small-cell lung cancer (NSCLC) patients. Tyrosine kinase inhibitors (TKI) against MET have varying degrees of specificity. Tivantinib (ARQ 197) is reported to be a non-ATP competitive selective MET inhibitor. We aimed to compare the activity of tivantinib to established MET TKIs in a panel of NSCLC cell lines characterized by their MET dependency and by different relevant genotypes. A549, H3122, PC9 and HCC827, their respective resistant clones PC9 GR4 and HCC827 GR6 and the MET amplified cell lines H1993 and EBC-1 were treated in vitro with tivantinib, crizotinib or PHA-665752. Crizotinib and PHA-665752 showed growth inhibition restricted to MET dependent cell lines. The pattern of activity was related to MET inhibition and downstream signaling inhibition of AKT and ERK1/2, resulting in G0/G1 cycle arrest and apoptosis. In contrast, tivantinib possessed more potent anti-proliferative activity that was not restricted to only MET dependent cell lines. Tivantinib did not inhibit cellular MET activity or phosphorylation of downstream signaling proteins AKT or ERK1/2 in either MET dependent or independent cell lines. Cell cycle analysis demonstrated that tivantinib induced a G2/M arrest and induced apoptosis. Tivantinib but not crizotinib effected microtubule dynamics, disrupting mitotic spindles by a mechanism consistent with it functioning as a microtubule depolymerizer. Tivantinib activity is independent of MET signaling in NSCLC and suggests alternative mechanisms of action that should be considered when interpreting the results from on-going clinical studies. Copyright © 2014 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved.

  15. arXiv Study of the long-lived excited state in the neutron deficient nuclides $^{195,197,199}$Po by precision mass measurement

    CERN Document Server

    Althubiti, N.A.; Blaum, K.; Cocolios, T.E.; Day Goodacre, T.; Farooq-Smith, G.J.; Fedorov, D.V.; Fedosseev, V.N.; George, S.; Herfurth, F.; Heyde, K.; Kreim, S.; Lunney, D.; Lynch, K.M.; Manea, V.; Marsh, B.A.; Neidherr, D.; Rosenbusch, M.; Rossel, R.E.; Rothe, S.; Schweikhard, L.; Seliverstov, M.D.; Welker, A.; Wienholtz, F.; Wolf, R.N.; Zuber, K.

    2017-10-27

    Direct mass measurements of the low-spin 3/2− and high-spin 13/2+ states in the neutron-deficient isotopes Po195 and Po197 were performed with the Penning-trap mass spectrometer ISOLTRAP at ISOLDE-CERN. These measurements allow the determination of the excitation energy of the isomeric state arising from the νi13/2 orbital in Po195,197. Additionally, the excitation energy of isomeric states of lead, radon, and radium isotopes in this region were obtained from α-decay chains. These excitation energies complete the knowledge of the energy systematics in the region and confirm that the 13/2+ states remain isomeric, independent of the number of valence neutrons.

  16. 4{pi} studies of the 1.8-4.8 GeV {sup 3}He+{sup nat}Ag, {sup 197}Au reactions. I. Energy deposition

    Energy Technology Data Exchange (ETDEWEB)

    Morley, K.B.; Kwiatkowski, K.; Bracken, D.S.; Renshaw Foxford, E. [Indiana Univ., Bloomington, IN (United States). Dept. of Chemistry; Legrain, R.; Pollacco, E.C.; Volant, C. [CEA Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France). Dept. d`Astrophysique, de la Physique des Particules, de la Physique Nucleaire et de l`Instrumentation Associee; Korteling, R.G. [Simon Fraser Univ., Burnaby, BC (Canada). Dept. of Chemistry; Breuer, H. [Maryland Univ., College Park, MD (United States). Dept. of Physics; Brzychczyk, J. [Jagellonian Univ., Krakow (Poland). Inst. of Physics

    1996-01-01

    The 4{pi} detector ISiS has been used to measure light-charged particles and intermediate-mass-fragments emitted in the 1.8-4.8 GeV {sup 3}He+{sup nat}Ag, {sup 197}Au reactions. Ejectile multiplicity and total event kinetic energy distribution scale systematically with projectile energy and target mass, except for the {sup nat}Ag target at 3.6 and 4.8 GeV. For this system, a saturation in deposition energy is indicated by the data, suggesting the upper projectile energy for stopping has been reached. Maximum deposition energies of {approx}950 MeV for the {sup nat}Ag target and {approx}1600 MeV for the {sup 197}Au target are inferred from the data. Comparison of the experimental distributions with intranuclear cascade predictions shows qualitative agreement. (author). Submitted to Physical Review, C (US); 46 refs.

  17. Study of the long-lived excited state in the neutron deficient nuclides $^{195,197,199}$Po by precision mass measurement

    OpenAIRE

    Althubiti, N. A.; Atanasov, D; Blaum, K.; Cocolios, T. E.; Goodacre, T Day; Farooq-Smith, G. J.; Fedorov, D.V.; Fedosseev, V. N.; George, S.; Herfurth, F.; Heyde, K; Kreim, S; Lunney, D.; Lynch, K.M.; Manea, V.

    2017-01-01

    Direct mass measurements of the low-spin $3/2^{(-)}$ and high-spin $13/2^{(+)}$ states in the neutron-deficient isotopes $^{195}$Po, $^{197}$Po, and high-spin $13/2^{(+)}$ state in $^{199}$Po were performed with the Penning-trap mass spectrometer ISOLTRAP at ISOLDE-CERN. These measurements allow the determination of the excitation energy of the isomeric state arising from the $\

  18. Effects of flanges on pressure distribution on a flat plate and on a corrugated surface at Mach numbers from 0.60 to 1.97

    Science.gov (United States)

    Johns, A. L.; Jones, M. L.

    1974-01-01

    An 8 by 6 foot supersonic wind tunnel was used to obtain the static pressure distribution on a plate in the region of a flange placed normal to the airstream. Tests were conducted on both a flat plate surface and a corrugated surface using flange heights ranging from 10 to 125 percent of the boundary layer height. Data were obtained at a zero degree angle-of-attack and at Mach numbers from 0.60 to 1.97.

  19. Two-particle rapidity correlations between relativistic particles in central collisions of {sup 197}Au nuclei in emulsion at 11.6 A GeV/c

    Energy Technology Data Exchange (ETDEWEB)

    Abdurakhmanov, U.U.; Gulamov, K.G.; Navotny, V.Sh. [Fizika-Solntse Research and Production Association, Uzbek Academy of Sciences, Institute for Physics and Technology, Tashkent (Uzbekistan)

    2016-06-15

    It is shown that in central collisions of {sup 197}Au nuclei with heavy emulsion nuclei at 11.6 AGeV/c two-particles pseudorapidity correlations for produced particles in terms of correlation functions demonstrate predominantly long-range behaviour in contrast to nucleon-nucleon interactions. The experimental data are compared with calculations based on the FRITIOF-M model and the model of independent emission of particles. (orig.)

  20. Methodological considerations regarding the use of inorganic {sup 197}Hg(II) radiotracer to assess mercury methylation potential rates in lake sediment

    Energy Technology Data Exchange (ETDEWEB)

    Perez Catan, Soledad [Laboratorio de Analisis por Activacion Neutronica, Comision Nacional de Energia Atomica, Centro Atomico Bariloche, 8400 Bariloche (Argentina); Guevara, Sergio Ribeiro [Laboratorio de Analisis por Activacion Neutronica, Comision Nacional de Energia Atomica, Centro Atomico Bariloche, 8400 Bariloche (Argentina)], E-mail: ribeiro@cab.cnea.gov.ar; Marvin-DiPasquale, Mark [US Geological Survey, 345 Middlefield Rd./MS 480, Menlo Park, CA 94025 (United States); Magnavacca, Cecilia [Centro Atomico Ezeiza, Comision Nacional de Energia Atomica, Presbitero Gonzalez y Aragon No. 15, B1802AYA, Ezeiza, Buenos Aires (Argentina); Cohen, Isaac Marcos [Departamento de Ingenieria Quimica, Facultad Regional Buenos Aires, Universidad Tecnologica Nacional, Medrano 951 (C1179AAQ) Buenos Aires (Argentina); Arribere, Maria [Laboratorio de Analisis por Activacion Neutronica, Comision Nacional de Energia Atomica, Centro Atomico Bariloche, 8400 Bariloche (Argentina)

    2007-09-15

    Methodological considerations on the determination of benthic methyl-mercury (CH{sub 3}Hg) production potentials were investigated on lake sediment, using {sup 197}Hg radiotracer. Three methods to arrest bacterial activity were compared: flash freezing, thermal sterilization, and {gamma}-irradiation. Flash freezing showed similar CH{sub 3}Hg recoveries as thermal sterilization, which was both 50% higher than the recoveries obtained with {gamma}-ray irradiation. No additional radiolabel was recovered in kill-control samples after an additional 24 or 65 h of incubation, suggesting that all treatments were effective at arresting Hg(II)-methylating bacterial activity, and that the initial recoveries are likely due to non-methylated {sup 197}Hg(II) carry-over in the organic extraction and/or [{sup 197}Hg]CH{sub 3}Hg produced via abiotic reactions. Two CH{sub 3}Hg extraction methods from sediment were compared: (a) direct extraction into toluene after sediment leaching with CuSO{sub 4} and HCl and (b) the same extraction with an additional back-extraction step to thiosulphate. Similar information was obtained with both methods, but the low efficiency observed and the extra work associated with the back-extraction procedure represent significant disadvantages, even tough the direct extraction involves higher Hg(II) carry over.

  1. Conjugation of the CRM197-inulin conjugate significantly increases the immunogenicity of Mycobacterium tuberculosis CFP10-TB10.4 fusion protein.

    Science.gov (United States)

    Hu, Shun; Yu, Weili; Hu, Chunyang; Wei, Dong; Shen, Lijuan; Hu, Tao; Yi, Youjin

    2017-11-01

    Mycobacterium tuberculosis (Mtb) is a serious fatal pathogen that causes tuberculosis (TB). Effective vaccination is urgently needed to deal with the serious threat from TB. Mtb-secreted protein antigens are important virulence determinants of Mtb with poor immunogenicity. Adjuvants and antigen delivery systems are thus highly desired to improve the immunogenicity of protein antigens. Inulin is a biocompatible polysaccharide (PS) adjuvant that can stimulate a strong cellular and humoral immunity. Bacterial capsular PS and haptens have been conjugated with cross-reacting material 197 (CRM 197 ) to improve their immunogenicity. CFP10 and TB10.4 were two Mtb-secreted immunodominant protein antigens. A CFP10-TB10.4 fusion protein (CT) was used as the antigen for covalent conjugation with the CRM 197 -inulin conjugate (CRM-inu). The resultant conjugate (CT-CRM-inu) elicited high CT-specific IgG titers, stimulated splenocyte proliferation and provoked the secretion of Th1-type and Th2-type cytokines. Conjugation with CRM-inu significantly prolonged the systemic circulation of CT and exposure to the immune system. Moreover, CT-CRM-inu showed no apparent toxicity to cardiac, hepatic and renal functions. Thus, conjugation of CT with CRM-inu provided an effective strategy for development of protein-based vaccines against Mtb infection. Copyright © 2017 Elsevier Ltd. All rights reserved.

  2. Lack of Association of the Polymorphisms IL-17A (−197G/A and IL-17F (+7488A/G with Multibacillary Leprosy in Mexican Patients

    Directory of Open Access Journals (Sweden)

    Mónica Escamilla-Tilch

    2014-01-01

    Full Text Available Background. Leprosy is a chronic infectious disease caused by the intracellular acid-fast bacilli Mycobacterium leprae; it has been determined that genetic factors of the host play an important role in the disease susceptibility. Thus, in this case-control study, we evaluated the possible association between the IL-17A G-197A (rs227593 and IL-17F A7488G (His161Arg, rs763780 gene SNPs and susceptibility to leprosy disease in Mexican population. Methods. Seventy-five leprosy patients and sixty-nine control subjects were included. Both SNPs were genotyped with the polymerase chain reaction-restriction fragment length polymorphism technique. Results. We found nonsignificant differences in genotype and allele frequencies related to IL-17A G-197A (rs227593 and IL-17F A7488G (His161Arg, rs763780 gene SNPs in MB as well as subclinical forms of leprosy disease versus healthy individuals. Conclusions. Since the sample size is not large enough, it is difficult to sustain an association of susceptibility to leprosy with genotypes or allele frequencies of IL-17A G-197A (rs227593 and IL-17F A7488G (His161Arg, rs763780, suggesting that IL-17 polymorphisms have no significant role in the genetic susceptibility to development of this disease in the Mexican Mestizo population.

  3. Physical and underway data collected aboard the KNORR during cruise KN197-08 in the Caribbean Sea and North Atlantic Ocean from 2010-05-22 to 2010-06-24 (NODC Accession 0104289)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104289 includes physical and underway data collected aboard the KNORR during cruise KN197-08 in the Caribbean Sea and North Atlantic Ocean from...

  4. Physical and underway data collected aboard the KNORR during cruise KN197-03 in the North Atlantic Ocean from 2010-01-24 to 2010-02-14 (NODC Accession 0104285)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104285 includes physical and underway data collected aboard the KNORR during cruise KN197-03 in the North Atlantic Ocean from 2010-01-24 to...

  5. Physical and underway data collected aboard the KNORR during cruise KN197-04 in the North Atlantic Ocean and South Atlantic Ocean from 2010-02-19 to 2010-03-12 (NODC Accession 0104286)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104286 includes physical and underway data collected aboard the KNORR during cruise KN197-04 in the North Atlantic Ocean and South Atlantic Ocean...

  6. Physical and underway data collected aboard the KNORR during cruise KN197-06 in the Indian Ocean and South Atlantic Ocean from 2010-04-04 to 2010-04-23 (NODC Accession 0104288)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104288 includes physical and underway data collected aboard the KNORR during cruise KN197-06 in the Indian Ocean and South Atlantic Ocean from...

  7. Gold nanoparticles production using reactor and cyclotron based methods in assessment of (196,198)Au production yields by (197)Au neutron absorption for therapeutic purposes.

    Science.gov (United States)

    Khorshidi, Abdollah

    2016-11-01

    Medical nano-gold radioisotopes is produced regularly using high-flux nuclear reactors, and an accelerator-driven neutron activator can turn out higher yield of (197)Au(n,γ)(196,198)Au reactions. Here, nano-gold production via radiative/neutron capture was investigated using irradiated Tehran Research Reactor flux and also simulated proton beam of Karaj cyclotron in Iran. (197)Au nano-solution, including 20nm shaped spherical gold and water, was irradiated under Tehran reactor flux at 2.5E+13n/cm(2)/s for (196,198)Au activity and production yield estimations. Meanwhile, the yield was examined using 30MeV proton beam of Karaj cyclotron via simulated new neutron activator containing beryllium target, bismuth moderator around the target, and also PbF2 reflector enclosed the moderator region. Transmutation in (197)Au nano-solution samples were explored at 15 and 25cm distances from the target. The neutron flux behavior inside the water and bismuth moderators was investigated for nano-gold particles transmutation. The transport of fast neutrons inside bismuth material as heavy nuclei with a lesser lethargy can be contributed in enhanced nano-gold transmutation with long duration time than the water moderator in reactor-based method. Cyclotron-driven production of βeta-emitting radioisotopes for brachytherapy applications can complete the nano-gold production technology as a safer approach as compared to the reactor-based method. Copyright © 2016 Elsevier B.V. All rights reserved.

  8. 197Au Mössbauer study of the deactivation and reactivation of a carbon-supported AuCl{4/-} hydrochlorination catalyst

    Science.gov (United States)

    Friedl, J.; Wagner, F. E.; Nkosi, B.; Towert, M.; Coville, N. J.; Adams, M. D.; Hutchings, G. J.

    1992-04-01

    Acetylene hydrochlorination catalysts consisting of activated carbon impregnated with a solution of HAuCl4· xH2O in aqua regia have been studied by197Au Mössbauer spectroscopy. The relative amounts of AuCl{4/-}, of Au(0), and of an Au(J) species formed under certain process conditions were determined quantitatively. Deactivation of the catalyst at low and high temperatures was shown to be due to different mechanisms, and the reactivation of the catalyst by Cl2 gas was studied.

  9. Prognostic value of the neutrophil-to-lymphocyte ratio in the ARQ 197-215 second-line study for advanced hepatocellular carcinoma.

    Science.gov (United States)

    Personeni, Nicola; Giordano, Laura; Abbadessa, Giovanni; Porta, Camillo; Borbath, Ivan; Daniele, Bruno; Van Laethem, Jean-Luc; Van Vlierberghe, Hans; Trojan, Jörg; De Toni, Enrico N; Gasbarrini, Antonio; Lencioni, Monica; Lamar, Maria E; Wang, Yunxia; Shuster, Dale; Schwartz, Brian; Santoro, Armando; Rimassa, Lorenza

    2017-02-28

    The ARQ 197-215 study randomized patients to tivantinib or placebo and pre-specified efficacy analyses indicated the predictive value of MET expression as a marker of benefit from tivantinib in hepatocellular carcinoma (HCC). We aimed to explore the neutrophil-to-lymphocyte ratio (NLR) in 98 ARQ 197-215 patients with available absolute neutrophil count and absolute lymphocyte count at baseline. The cut-off value used to define high versus low NLR was 3.0. In univariate analysis, high NLR was associated with hazard ratio (HR) for overall survival (OS) of 1.58 [95% confidence interval (CI) 1.01; 2.47; P 3 (P = 0.03) and presence of vascular invasion (P = 0.017) were negatively associated with OS. After adjustment for vascular invasion, NLR independently predicted survival in both the placebo and the tivantinib cohort. For OS, no interaction was detected between NLR status and treatment (Pinteraction = 0.40). Baseline NLR is an independent prognostic biomarker in patients with HCC and compensated liver function who are candidate for second-line treatments.

  10. Precise measurements of αk for the 346.5 keV M4 transition from ^197Pt^m: A test of internal conversion theory

    Science.gov (United States)

    Nolan, J.; Nica, N.; Hardy, J. C.; Hernberg, M.; Goodwin, J. R.; Iacob, V. E.

    2008-10-01

    Precise values for internal conversion coefficients (ICCs) are important in the study of nuclear decay schemes; they are also useful for detector efficiency calibration. A recent survey revealed that few measured ICCs are known to a high precision (˜ 1%); in addition, there is some theoretical uncertainty over how to deal with the atomic vacancy left by the departing electron during the internal conversion process. Texas A&M has previously precisely measured the ICCs for ^193Ir, ^137Ba, and ^134Cs as a test of internal conversion theory; we now consider the ICC for ^197Pt^m as a further test. The ^197Pt^m was produced by thermal neutron activation of separated ^196Pt (97.43% pure). Two separate sources were produced; x-ray and gamma-ray emissions from each source were recorded by a High Purity Germanium Detector (+/- 0.20% absolute efficiency uncertainty). After impurity subtraction and attenuation correction, preliminary results for the αk value for the two sources have now been obtained. The αk from source one is 4.24 (13); the αk from source two is 4.26 (8). While these values are still tentative, the results show agreement with the theory that considers the atomic vacancy.

  11. INFRACŢIUNI CONTRA PATRIMONIULUI, SĂVÂRŞITE ÎN LIPSA UNUI SCOP SPECIAL (art.193, 197 şi 199 CP RM: ASPECTE TEORETICE ŞI PRACTICE

    Directory of Open Access Journals (Sweden)

    Sergiu BRÎNZA

    2016-03-01

    Full Text Available Prezentul articol este dedicat analizei juridico-penale a infracţiunilor contra patrimoniului, săvârşite în lipsa unui scop special. Acestea sunt prevăzute la art.193, 197 şi 199 CP RM. Sunt examinate elementele constitutive (obiectul, latura obiectivă, latura subiectivă şi subiectul, precum şi elementele circumstanţiale agravante ale infracţiunilor în cauză. Sunt propuse criterii de delimitare a infracţiunilor specificate la art.193, 197 şi 199 CP RM de faptele conexe de factură penală sau nepenală. Regulile de calificare a faptelor conform acestor articole, precum şi procedeele de interpretare a art.193, 197 şi 199 CP RM, urmăresc scopul eficientizării aplicării răspunderii pentru faptele infracţionale corespunzătoare. OFFENCES AGAINST PATRIMONY, COMMITED IN THE ABSENCE OF A SPECIAL PURPOSE (art.193, 197 and 199 PC RM: THEORETICAL AND PRACTICAL ASPECTSThis article is dedicated to the legal-penal analysis of the offences against patrimony, committed in the absence of a special purpose. The offences mentioned above are included in art.193, 197 and 199 PC RM; there are examined the constituents (the object, objective side, subjective side and the subject, as well as the circumstantial aggravating elements of the offences in question. There are also proposed delimitation criteria of the offences specified at art.193, 197 and 199 PC RM from the ancillary penal or non-penal acts. The rules of qualification of the acts under these articles, including the methods of interpretation of art.193, 197 and 199 PC RM, aim to streamline the application of penal liability for the appropriate criminal acts. 

  12. Coincident emission of neutrons and charged particles after π- absorption in 6Li, 7Li, 12C, 59Co and 197Au

    Science.gov (United States)

    Heusi, P.; Isaak, H. P.; Pruys, H. S.; Engfer, R.; Hermes, E. A.; Kozlowski, T.; Sennhauser, U.; Walter, H. K.

    1983-10-01

    Energy spectra d 3W/d E1 d E2 d cos ϑ of neutron-neutron and neutron-charged particle pairs (nn, np, nd, nt) emitted after the absorption of stopped negative pions in 6Li, 7Li, 12C, 59Co and 197Au have been measured for opening angles between 50° and 180°. Particle pairs emitted from light nuclei without energy loss due to final-state interactions were identified by the energy balance. Pion absorption on two nucleons (quasi-deuteron mechanism) was found to be the main process. The yields of nucleon pairs from quasi-free absorption on a quasi-deuteron are 0.52 ± 0.09 per π-stop, 0.57 ± 0.10 per π-stop and 0.19 ± 0.04 per π-stop for 6Li, 7Li and 12C, respectively. The ratio R of np to pp pairs that absorb the pion was determined for quasi-free absorption on p-shell nucleons of 12C: R(p-shell) = 6.3 ± 1.4. For pion absorption on s-shell nucleons of lithium lower limits R(s-shell) > 4.4 for 6Li and R(s-shell) > 7.8 for 7Li were determined. These values are larger than the statistical ratios Rstat = 2 N/( Z - 1) of np to pp pairs in the nucleus. Lower limits for the probability for pion absorption on heavier clusters ( 3He, α) are W(hc) > 0.16 per π-stop for 6Li, W(hc) > 0.11 per π-stop for 7Li and W( α) > 0.01 per π-stop for 12C. The shape of the energy spectra of pairs emitted directly after quasi-free absorption on 2 or 4 nucleons could be explained by a simple model for the momentum distribution of the absorbing nucleons. The results are in agreement with the parameters of the momentum distributions known from other reactions. Energy spectra and opening-angle distributions were compared with the intranuclear cascade calculations of Chiang, Hüfner and Hachenberg. For 59Co and 197Au the spectra are strongly influenced by the final-state interactions; lower limits of R > 1.8 for 59Co and R > 2.5 for 197Au were determined.

  13. Coincident emission of neutrons and charged particles after. pi. /sup -/ absorption in /sup 6/Li, /sup 7/Li, /sup 12/C, /sup 59/Co and /sup 197/Au

    Energy Technology Data Exchange (ETDEWEB)

    Heusi, P.; Isaak, H.P.; Pruys, H.S.; Engfer, R.; Hermes, E.A. (Zurich Univ. (Switzerland). Physik-Institut); Kozlowski, T.; Sennhauser, U.; Walter, H.K. (Eidgenoessische Technische Hochschule, Zurich (Switzerland). Lab. fuer Hochenergiephysik)

    1983-10-17

    Energy spectra d/sup 3/W/dE/sub 1/dE/sub 2/ d cos theta of neutron-neutron and neutron-charged particle pairs (nn, np, nd, nt) emitted after the absorption of stopped negative pions in /sup 6/Li, /sup 7/Li, /sup 12/C, /sup 59/Co and /sup 197/Au have been measured for opening angles between 50/sup 0/ and 180/sup 0/. Particle pairs emitted from light nuclei without energy loss due to final-state interactions were identified by the energy balance. Pion absorption on two nucleons (quasi-deuteron mechanism) was found to be the main process. The yields of nucleon pairs from quasi-free absorption on a quasi-deuteron are 0.52 +- 0.09 per ..pi..-stop, 0,57 +- 0.10 per ..pi..-stop and 0.19 +- 0.04 per ..pi..-stop for /sup 6/Li, /sup 7/Li and /sup 12/C, respectively. The ratio R of np to pp pairs that absorb the pion was determined for quasi-free absorption on p-shell nucleons of /sup 12/C: R(p-shell)=6.3 +- 1.4. For pion absorption on s-shell nucleons of lithium lower limits R(s-shell) > 4.4 for /sup 6/Li and R(s-shell) > 7.8 for /sup 7/Li were determined. These values are larger than the statistical ratios Rsub(stat)=2N/(Z-1) of np to pp pairs in the nucleus. Lower limits for the probability for pion absorption on heavier clusters (/sup 3/He, ..cap alpha..) are W(hc) > 0.16 per ..pi..-stop for /sup 6/Li, W (hc) > 0.11 per ..pi..-stop for /sup 7/Li and W(..cap alpha..) > 0.01 per ..pi..-stop for /sup 12/C. The shape of the energy spectra of pairs emitted directly after quasi-free absorption on 2 or 4 nucleons could be explained by a simple model for the momentum distribution of the absorbing nucleons. The results are in agreement with the parameters of the momentum distributions known from other reactions. Energy spectra and opening-angle distributions were compared with the intranuclear cascade calculations of Chiang, Huefner, and Hachenberg. For /sup 59/Co and /sup 197/ Au the spectra are strongly influenced by the final-state interactions; lower limits of R > 1.8 for /sup

  14. Immunogenicity and safety of a fully liquid aluminum phosphate adjuvanted Haemophilus influenzae type b PRP-CRM197-conjugate vaccine in healthy Japanese children: A phase III, randomized, observer-blind, multicenter, parallel-group study.

    Science.gov (United States)

    Togashi, Takehiro; Mitsuya, Nodoka; Kogawara, Osamu; Sumino, Shuji; Takanami, Yohei; Sugizaki, Kayoko

    2016-08-31

    Broad use of monovalent Haemophilus influenzae type b (Hib) conjugate vaccines based on the capsular polysaccharide polyribosyl-ribitol phosphate (PRP), has significantly reduced invasive Hib disease burden in children worldwide, particularly in children aged vaccine has been widely used since the initiation of public funding programs followed by a routine vaccination designation in 2013. We compared the immunogenicity and safety of PRP conjugated to a non-toxic diphtheria toxin mutant (PRP-CRM197) vaccine with the PRP-T vaccine when administered subcutaneously to healthy Japanese children in a phase III study. Additionally, we evaluated the immunogenicity and safety profiles of a diphtheria-tetanus acellular pertussis (DTaP) combination vaccine when concomitantly administered with either PRP-CRM197 or PRP-T vaccines. The primary endpoint was the "long-term seroprotection rate", defined as the group proportion with anti-PRP antibody titers ⩾1.0μg/mL, after the primary series. Long-term seroprotection rates were 99.3% in the PRP-CRM197 group and 95.6% in the PRP-T group. The intergroup difference (PRP-CRM197 group - PRP-T group) was 3.7% (95% confidence interval: 0.099-7.336), demonstrating that PRP-CRM197 vaccine was non-inferior to PRP-T vaccine (pvaccination was higher in the PRP-CRM197 group than in PRP-T. Concomitant administration of PRP-CRM197 vaccine with DTaP vaccine showed no differences in terms of immunogenicity compared with concomitant vaccination with PRP-T vaccine and DTaP vaccine. Although CRM197 vaccine had higher local reactogenicity, overall, both Hib vaccines had acceptable safety and tolerability profiles. The immunogenicity of PRP-CRM197 vaccine administered subcutaneously as a three-dose primary series in children followed by a booster vaccination 1year after the primary series induced protective levels of Hib antibodies with no safety or tolerability concerns. Registered on ClinicalTrials.gov: NCT01379846. Copyright © 2016 The Authors

  15. Discovery of a novel mode of protein kinase inhibition characterized by the mechanism of inhibition of human mesenchymal-epithelial transition factor (c-Met) protein autophosphorylation by ARQ 197.

    Science.gov (United States)

    Eathiraj, Sudharshan; Palma, Rocio; Volckova, Erika; Hirschi, Marscha; France, Dennis S; Ashwell, Mark A; Chan, Thomas C K

    2011-06-10

    A number of human malignancies exhibit sustained stimulation, mutation, or gene amplification of the receptor tyrosine kinase human mesenchymal-epithelial transition factor (c-Met). ARQ 197 is a clinically advanced, selective, orally bioavailable, and well tolerated c-Met inhibitor, currently in Phase 3 clinical testing in non-small cell lung cancer patients. Herein, we describe the molecular and structural basis by which ARQ 197 selectively targets c-Met. Through our analysis we reveal a previously undisclosed, novel inhibitory mechanism that utilizes distinct regulatory elements of the c-Met kinase. The structure of ARQ 197 in complex with the c-Met kinase domain shows that the inhibitor binds a conformation that is distinct from published kinase structures. ARQ 197 inhibits c-Met autophosphorylation and is highly selective for the inactive or unphosphorylated form of c-Met. Through our analysis of the interplay between the regulatory and catalytic residues of c-Met, and by comparison between the autoinhibited canonical conformation of c-Met bound by ARQ 197 to previously described kinase domains of type III receptor tyrosine kinases, we believe this to be the basis of a powerful new in silico approach for the design of similar inhibitors for other protein kinases of therapeutic interest.

  16. Separation of {sup 195(m,g),197m}Hg from bulk gold target by liquid-liquid extraction using hydrophobic ionic liquids

    Energy Technology Data Exchange (ETDEWEB)

    Ghosh, Kaustab; Lahiri, Susanta [Saha Institute of Nuclear Physics, Kolkata (India). Chemical Sciences Div.; Maiti, Moumita [Indian Institute of Technology Roorkee, Roorkee (India). Dept. of Physics

    2017-07-01

    The {sup 195(m,g),197m}Hg radionuclides were produced in accelerator when natural Au foil was irradiated with 23 MeV protons. The no-carrier-added (NCA) Hg radioisotopes were separated from the bulk Au target by liquid-liquid extraction (LLX) employing hydrophobic RTILs 1-butyl-3-methylimidazolium hexafluorophosphate([C{sub 4}mim][PF{sub 6}]) and 1-butyl-3-methylimidazolium bis(trifluoromethylsulfonyl)imide([bmim][Tf{sub 2}N]) as extractant with HNO{sub 3} and HCl. In each case, bulk Au was extracted into the RTIL phase leaving NCA Hg-radionuclides in the aqueous phase. The RTILs were recovered by washing with 1 M K{sub 2}S{sub 2}O{sub 5} and freshly prepared 1 M FeSO{sub 4}. The reported separation methods follow green chemistry approach as it does not involve any volatile reagents.

  17. Binding Stoichiometry of a Recombinant Selenophosphate Synthetase with One Synonymic Substitution E197D to a Fluorescent Nucleotide Analog of ATP, TNP-ATP

    Directory of Open Access Journals (Sweden)

    Y. V. Preobrazhenskaya

    2013-01-01

    Full Text Available The transformation of the strain DH5αTM-T1R with plasmid vector pET11a containing the cloned gene of bacterial selenophosphate synthetase (SPS, selD, from the E. coli BL21-Gold (DE3 strain gives an overproducing strain of SPS with one synonymic substitution, E197D. The transformation efficiency was estimated as 8 × 108 CFU/μg plasmid DNA. 28 mg of highly purified preparation of recombinant SPS capable of binding TNP-ATP was eluted from DEAE-Sephadex column in amount of 15 % from the total soluble protein in crude extract. The fluorescent derivative of ATP, 2′(3′-O-(2,4,6-trinitrophenyladenosine-5′-triphosphate (TNP-ATP, was used as a synthetic analog of the substrate for the monitoring and quantitative analysis of the functional activity of SPS. The non-linear regression analysis of the saturation curve of TNP-ATP binding to D197 SPS with GraphPad Prism software fits to a model with 2 distinct binding sites with KDs different in order. The SPS existence in a form of tetramer in given reaction conditions, in accordance with the concentration stoichiometry of 4 moles of TNP-ATP to 1 mole of recombinant protein, is being discussed. The tetramer structure was predicted with molecular modelling software YASARA and modelled in vacuum using steepest descent minimization energy method. We hypothesize here the recombinant SPS exists as a dimer in solution with two active sites capable of ATP binding in each subunit.

  18. Roman Policies towards Antiochus III and the Greeks from Winter 197/196 B.C. to Autumn 196 B.C.

    Directory of Open Access Journals (Sweden)

    Deutschmann, Eike Hellmut

    2012-01-01

    Full Text Available In the Second Macedonian War (200-196 B.C., the res publica reduced the strength of the enemy King Philip V apparently to establish a new political order in Southern Balkans: Assumedly a pro-Roman balance of forces should prevail there, untainted by influence of another major power. A particular senatorial policy towards the Greeks probably did not exist before the fighting in Hellas came to an end in summer 197 B.C. In the same year, the Seleucid king Antiochus III brought large parts of the west coast of Asia Minor under control and set about crossing the Hellespont. Rome subsequently stylized itself as the guardian of freedom for the Greeks living in Hellas and Asia Minor. The statesmen of the res publica could have perceived Antiochus’ expansion as a threat to the mentioned new order. Therefore, the Roman Policy of Freedom was possibly applied primarily to take action against the Seleucid king. Die res publica verminderte im Zweiten Makedonischen Krieg (200-196 a.c. die Macht des gegnerischen Königs Philipp V - anscheinend um eine neue politische Ordnung im südlichen Balkanraum zu etablieren: Vermutlich sollte dort ein romfreundliches Kräftegleichgewicht vorherrschen, auf das keine andere Großmacht Einfluß hat. Eine speziell an die Griechen gerichtete Politik seitens des römischen Senats gab es wahrscheinlich nicht vor Ende der Kampfhandlungen in Hellas im Sommer 197 a.c. In dem Jahr erweiterte der seleukidische König Antiochos III. seinen Einflussbereich auf große Teile der kleinasiatischen Westküste und schickte sich an, den Hellespont zu überqueren. Rom stilisierte sich in der Folgezeit zum Freiheitsgarant der in Hellas und Kleinasien lebenden Griechen. Antiochos Expansion könnte von den Staatsmännern der res publica als Bedrohung der genannten neuen Ordnung angesehen worden sein. Demzufolge wurde die römische Freiheitspolitik möglicherweise in erster Linie angewendet, um gegen den seleukidischen König vorzugehen.

  19. Evaluation of Effect CAT -262C/T, SOD + 35A/C, GPx1 Pro197Leu Polymorphisms in Patients with IBD in the Polish Population.

    Science.gov (United States)

    Mrowicki, Jerzy; Mrowicka, Małgorzata; Majsterek, Ireneusz; Mik, Michał; Dziki, Adam; Dziki, Łukasz

    2016-12-01

    Inflammatory bowel disease (IBD) are a heterogeneous group of disorders in the course dominated by chronic, recurrent gastrointestinal inflammation. It is believed that the activation of IBD occurs in patients with a genetic predisposition to their development. Chronic inflammation develops as a result of an excessive reaction of the immune system principally under the influence of environmental risk factors. Among them, it has been shown that the mechanism of oxidative stress is associated with the pathophysiology of inflammatory bowel disease, responsible for the commencement and progress of these diseases. The aim of the study was the relationship between single nucleotide polymorphisms (SNPs) of individual antioxidant enzymes, and the prevalence of inflammatory bowel disease that may be associated with increased levels of oxidative stress. A total of 111 IBD patients, including 65 patients with ulcerative colitis (UC) and 46 with Crohn's disease (CD) and 125 healthy controls recruited from the Polish population, were genotyped for CAT -262C / T (rs1001179), SOD + 35A / C (rs2234694), GPx Pro 197 Leu polymorphisms. Genotyping of CAT, SOD, GPx gene polymorphism was performed by a RFLP-PCR. The performed analysis of genetic polymorphisms of antioxidant enzymes showed that polymorphic variant of the CAT -262 C / T may have protective effects in patients with ulcerative colitis in the range of genotype C / T; OR = 0.49 (0.25-0.99), p = 0.044. Trend protective, but statistically unrelated, it was also observed for genotype T / T and T allele of the same polymorphism and genotypes and alleles + 35A / C SOD1 in UC as well as polymorphic variants CAT -262 C / T, Pro197Leu of GPx1, + 35A / C SOD1 in CD. The results were compared with a control group of potentially healthy individuals without such diseases. It has been shown that the polymorphism of antioxidant enzymes CAT gene -262 C / T may have protective effects in patients who are carriers of a genotype C / T at the

  20. The effect of CYP2C19 polymorphism on the safety, tolerability, and pharmacokinetics of tivantinib (ARQ 197): results from a phase I trial in advanced solid tumors.

    Science.gov (United States)

    Yamamoto, N; Murakami, H; Nishina, T; Hirashima, T; Sugio, K; Muro, K; Takahashi, T; Naito, T; Yasui, H; Akinaga, S; Koh, Y; Boku, N

    2013-06-01

    Tivantinib (formerly ARQ 197) is a selective inhibitor of c-Met mainly metabolized by CYP2C19. CYP2C19 is known for genetic polymorphisms, and ~20% of Asians are poor metabolizers (PMs), while others are extensive metabolizers (EMs). In this study, we examined the safety, pharmacokinetics (PK), and preliminary efficacy of tivantinib as a single agent to determine recommended phase II doses (RPIIDs). Forty-seven patients (EMs, 33; PMs, 14) with solid tumors were orally treated with tivantinib, from 70 to 360 mg bid in a 3 + 3 dose-escalation scheme. EMs and PMs were separately enrolled at the doses >120 mg bid. Tivantinib was well tolerated up to 360 mg bid for EMs and 240 mg bid for PMs. Neutropenia, leukopenia, anemia, fatigue, and anorexia were the frequent adverse events related to tivantinib and were commonly observed in both EMs and PMs. PMs had 1.9-fold higher AUC(0-12) compared with EMs at 240 mg bid. Regardless of CYP2C19 phenotype, Gr.4 neutropenia occurred in patients with relatively high exposure to tivantinib. A confirmed partial response was achieved in two non-small-cell lung cancer (NSCLC) patients. Two different settings of RPIIDs, 360 mg bid for EMs and 240 mg bid for PMs, were determined.

  1. Equilibration in the reaction of 175 and 252 MeV /sup 20/Ne with /sup 197/Au. [Energy, element, and angular distributions

    Energy Technology Data Exchange (ETDEWEB)

    Moulton, J.B.

    1978-06-01

    The highly inelastic nuclear reaction of /sup 197/Au with /sup 20/Ne at 175 and 252 MeV laboratory energies is studied. Energy-, elemental-, and angular- distributions for atomic numbers 5 to 30 (175 MeV) or 34 (252 MeV) are presented. The means and widths of the kinetic energy spectra for detected elements are compared with a theoretical calculation. The calculation postulates thermalization of the incident projectile kinetic energy, and includes one sha(e-vibrational degree of freedom and rigid rotation of the reaction complex. The effect of particle evaporation is considered. Good agreement of the expurimental mean energies with the theory is obtained. Poorer agreement of the kinetic energy widths with the theory may be due to a low-temperature quantal effect. The relative elemental yields are analyzed for their degree of equilibration, based on a model of diffusive nucleon exchange as described by the master equation. A similar degree of equilibration is observed for both reaction energies. The absolute elemental yields are reproduced qualitatively by employing an advanced diffusion code, coupled with calculation of the subsequent fission of heavy reaction products, including the compound nucleus. The angular distributions are analyzed with a simple model, to estimate the reaction lifetime of selected elements.

  2. Characterization of Citrobacter sp. line 328 as a source of Vi for a Vi-CRM(197) glycoconjugate vaccine against Salmonella Typhi.

    Science.gov (United States)

    Rondini, Simona; Micoli, Francesca; Lanzilao, Luisa; Pisoni, Ivan; Di Cioccio, Vito; Saul, Allan J; Martin, Laura B

    2012-11-26

    Salmonella enterica serovar Typhi is the causative agent of typhoid fever with over 22 million cases and over 200,000 deaths reported annually. A vaccine is much needed for use in young children and the Novartis Vaccines Institute for Global Health (NVGH) is developing a conjugate vaccine which targets S. Typhi Vi capsular polysaccharide. Here we describe a method suitable for industrial scale production of the Vi antigen based on expression by a Citrobacter line. We optimized the production of Vi by selecting a suitable Citrobacter strain (Citrobacter 328) that yields high and stable expression of Vi in chemically defined medium under industrial-scale fermentation conditions. Vi-CRM197 made using Vi from Citrobacter 328 elicited high anti-Vi antibody levels in mice and rabbits. Citrobacter 328 is a suitable strain for production of Vi for conjugate anti-Typhi vaccines. Being a BSL-1 organism, which grows in defined medium and stably produces high yields of Vi, it offers excellent potential for safe production of inexpensive vaccines for populations at risk of typhoid fever.

  3. Percutaneous Excision of a Benign Breast Mass Using Ultrasound-guided, Vacuum-assisted Core Biopsy:A Review of 197 Cases with Long Term Follow-up

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, Hoi Soo; Han, Heon; Kim, Sam Soo; Jeon, Yong Hwan; Lee, Ji Won; Kim, Hyoung Rae [Kangwon National University College of Medicine, Chuncheon (Korea, Republic of); Moon, Jin Hee; Lee, Hyun; Koh, Sung Hye [Hallym University College of Medicine, Chuncheon (Korea, Republic of); Kim, Sun Mi [Bundang Seoul National University Hospital, Seoul (Korea, Republic of)

    2010-03-15

    To assess long term results of excising benign masses using ultrasound (US)-guided, vacuum-assisted core biopsy (Mammotome). We enrolled 163 patients (197 masses) receiving US guided excision using vacuum-assisted core biopsy and follow-up sonography in this retrospective study. The masses were category 3 as determined by ultrasound imaging according to the Breast Imaging Reporting and Data System (BI-RADS) (n=145) or pathologically confirmed as benign masses by a previous core-needle biopsy although category 4a and 4b (n = 52). Pathology, the presence of hematoma and residual tissue, as well as scar formation were assessed. We diagnosed 190 (96.5%) benign masses, 4 (2.0%) malignant masses, and 3 (1.5%) high-risk lesions. Most (176 masses, 91.2%) were excised completely as demonstrated by the follow-up ultrasound examination. Scar changes were minimal (68.7%) or moderate (31.3%), with regression in 53%. US-guided excision using vacuum-assisted core biopsy is effective for the removal of benign breast masses. The majority of scars are minimal, with good cosmetic effect. However, subsequent excision should be done for malignant masses or phyllodes tumor because radiologic absence does not guarantee complete removal

  4. Study of the A(e,e'$\\pi^+$) Reaction on $^1$H, $^2$H, $^{12}$C, $^{27}$Al, $^{63}$Cu and $^{197}$Au

    Energy Technology Data Exchange (ETDEWEB)

    Qian, X; Clasie, B; Arrington, J; Asaturyan, R; Benmokhtar, F; Boeglin, W; Bosted, P; Bruell, A; Christy, M E; Chudakov, E; Dalton, M M; Daniel, A; Day, D; Dutta, D; El Fassi, L; Ent, R; Fenker, H C; Ferrer, J; Fomin, N; Gao, H; Garrow, K; Gaskell, D; Gray, C; Huber, G M; Jones, M K; Kalantarians, N; Keppel, C E; Kramer, K; Li, Y; Liang, Y; Lung, A F; Malace, S; Markowitz, P; Matsumura, A; Meekins, D G; Mertens, T; Miyoshi, T; Mkrtchyan, H; Monson, R; Navasardyan, T; Niculescu, G; Niculescu, I; Okayasu, Y; Opper, A K; Perdrisat, C; Punjabi, V; Rauf, A W; Rodriquez, V M; Rohe, D; Seely, J; Segbefia, E; Smith, G R; Sumihama, M; Tadevosyan, V; Tang, L; Villano, A; Vulcan, W F; Wesselmann, F R; Wood, S A; Yuan, L; Zheng, X

    2010-05-01

    Cross sections for the p($e,e'\\pi^{+}$)n process on $^1$H, $^2$H, $^{12}$C, $^{27}$Al, $^{63}$Cu and $^{197}$Au targets were measured at the Thomas Jefferson National Accelerator Facility (Jefferson Lab) in order to extract the nuclear transparencies. Data were taken for four-momentum transfers ranging from $Q^2$=1.1 to 4.8 GeV$^2$ for a fixed center of mass energy of $W$=2.14 GeV. The ratio of $\\sigma_L$ and $\\sigma_T$ was extracted from the measured cross sections for $^1$H, $^2$H, $^{12}$C and $^{63}$Cu targets at $Q^2$ = 2.15 and 4.0 GeV$^2$ allowing for additional studies of the reaction mechanism. The experimental setup and the analysis of the data are described in detail including systematic studies needed to obtain the results. The results for the nuclear transparency and the differential cross sections as a function of the pion momentum at the different values of $Q^2$ are presented. Global features of the data are discussed and the data are compared with the results of model calculations for the p($e,e'\\pi^{+}$)n reaction from nuclear targets.

  5. 197 - 205 _Saeed and Oladeji

    African Journals Online (AJOL)

    User

    ISSN 2006 – 6996. ASSESSMENT OF MANGANESE. VEGETABLE SAMPLES GROWN A. ZARIA, KADU .... MATERIALS AND METHODS. Study Area. Zaria city is in northern Nigeria on longitude 7˚42˙E ... Wastewater samples were collected using composite sampling in a polyethylene plastic container that were previously.

  6. Tivantinib (ARQ 197), a selective inhibitor of MET, in patients with microphthalmia transcription factor-associated tumors: results of a multicenter phase 2 trial.

    Science.gov (United States)

    Wagner, Andrew J; Goldberg, John M; Dubois, Steven G; Choy, Edwin; Rosen, Lee; Pappo, Alberto; Geller, James; Judson, Ian; Hogg, David; Senzer, Neil; Davis, Ian J; Chai, Feng; Waghorne, Carol; Schwartz, Brian; Demetri, George D

    2012-12-01

    Microphthalmia transcription factor (MITF)-associated (MiT) tumors are a family of rare malignancies, including alveolar soft part sarcoma (ASPS), clear cell sarcoma (CCS), and translocation-associated renal cell carcinoma (tRCC) that have dysregulated expression of oncogenic MITF family proteins. The MET receptor tyrosine kinase gene is transcriptionally activated by MITF family proteins, making MET a potential therapeutic target for MiT tumors. This study assessed the activity of tivantinib (ARQ 197), a selective MET inhibitor, in patients with MiT-associated tumors. This multicenter, single-arm, phase 2 trial enrolled patients with advanced MiT tumors. Patients initially received tivantinib 120 mg orally twice daily, then 360 mg twice daily per protocol amendment. The primary endpoint was overall response rate. Secondary endpoints included safety, progression-free survival, pharmacokinetics, and correlative studies. A total of 47 patients (median age, 25 years; range, 11-73 years) with ASPS (n = 27), CCS (n = 11), tRCC (n = 6), or other tumor types (n = 3) were enrolled. Common grade 3/4 drug-related adverse events included anemia (4%) and neutropenia (4%). Three patients (6.4%) experienced 4 treatment-related serious adverse events (grade 3 febrile neutropenia, thrombocytopenia, and deep vein thrombosis, and grade 4 thrombocytopenia). Best response was partial response in 1 CCS patient (2%) and stable disease in 28 patients (60%). Median progression-free survival was 3.6 months (overall), 5.5 months (ASPS), and 1.9 months (CCS and tRCC). Baseline MET expression was strongly or focally positive in tumor samples from 14 of 19 patients (74%). Tivantinib was safe and tolerable in patients with MiT tumors, but antitumor activity was modest. Copyright © 2012 American Cancer Society.

  7. Phase 1 dose-escalation trial evaluating the combination of the selective MET (mesenchymal-epithelial transition factor) inhibitor tivantinib (ARQ 197) plus erlotinib.

    Science.gov (United States)

    Goldman, Jonathan W; Laux, Isett; Chai, Feng; Savage, Ronald E; Ferrari, Dora; Garmey, Edward G; Just, Richard G; Rosen, Lee S

    2012-12-01

    Amplification of the mesenchymal-epithelial transition factor (MET) gene can promote tumor resistance to epidermal growth factor receptor (EGFR) inhibition. Dual EGFR-MET inhibition may overcome this resistance. Tivantinib (ARQ 197) is a selective, oral, non-ATP-competitive, small-molecule inhibitor of the MET receptor tyrosine kinase. This phase 1 trial assessed the safety, pharmacokinetics, and preliminary antitumor activity of tivantinib combined with the EGFR inhibitor erlotinib. Patients with advanced solid malignancies were administered oral tivantinib at escalating doses of 120, 240, 360, and 480 mg twice daily (BID) plus 150 mg erlotinib once daily (QD). Single or multiple intrapatient dose escalation was planned in the absence of dose-limiting toxicity in the first cycle of therapy (21 days). Thirty-two patients received combination treatment. Tivantinib serum concentrations were not dose-proportional. The most common (≥ 20%) adverse events (AEs) regardless of causality included rash (n = 17), fatigue (n = 12), nausea (n = 10), abdominal pain (n = 10), diarrhea (n = 9), bradycardia (n = 9), and anemia (n = 7). AEs considered related to study treatment occurred in 28 patients (87.5%), and 5 patients (15.6%) had treatment-related serious AEs, including neutropenia, leukopenia, syncope, sinus bradycardia, and sick sinus syndrome. Fifteen of 32 patients (46.8%) had a partial response (n = 1) or stable disease (n = 14) as assessed by Response Evaluation Criteria in Solid Tumors. Six of 8 patients with nonsmall cell lung cancer achieved stable disease. The recommended phase 2 dose is tivantinib 360 mg BID plus erlotinib 150 mg QD. Tivantinib plus erlotinib was well tolerated with encouraging clinical activity, especially in patients with nonsmall cell lung cancer. Copyright © 2012 American Cancer Society.

  8. A Unified Timing and Spectral Model for the Anomalous X-ray Pulsars XTE J1810-197 and CXOU J164710.2-455216

    Science.gov (United States)

    Albano, A.; Turolla, R.; Israel, G. L.; Zane, S.; Nobili, L.; Stella, L.

    2010-10-01

    Anomalous X-ray pulsars (AXPs) and soft gamma repeaters (SGRs) are two small classes of X-ray sources strongly suspected to host a magnetar, i.e., an ultra-magnetized neutron star with B ≈ 1014-1015 G. Many SGRs/AXPs are known to be variable, and recently the existence of genuinely "transient" magnetars was discovered. Here, we present a comprehensive study of the pulse profile and spectral evolution of the two transient AXPs (TAXPs) XTE J1810-197 and CXOU J164710.2-455216. Our analysis was carried out in the framework of the twisted magnetosphere model for magnetar emission. Starting from three-dimensional Monte Carlo simulations of the emerging spectrum, we produced a large database of synthetic pulse profiles which was fitted to observed light curves in different spectral bands and at different epochs. This allowed us to derive the physical parameters of the model and their evolution with time, together with the geometry of the two sources, i.e., the inclination of the line of sight and the magnetic axis with respect to the rotation axis. We then fitted the (phase-averaged) spectra of the two TAXPs at different epochs using a model similar to that used to calculate the pulse profiles (ntzang in XSPEC) freezing all parameters to the values obtained from the timing analysis and leaving only the normalization free to vary. This provided acceptable fits to XMM-Newton data in all the observations we analyzed. Our results support a picture in which a limited portion of the star surface close to one of the magnetic poles is heated at the outburst onset. The subsequent evolution is driven both by the cooling/varying size of the heated cap and by a progressive untwisting of the magnetosphere.

  9. Measurement of cross sections for alpha-induced reactions on 197Au and thick-target yields for the ((alpha),(gamma)) process on 64Zn and 63Cu

    Energy Technology Data Exchange (ETDEWEB)

    Basunia, M S; Shugart, H A; Smith, A R; Norman, E B

    2006-08-14

    We have measured the cross sections for the {sup 197}Au({alpha},{gamma}){sup 201}Tl and {sup 197}Au({alpha},2n){sup 199}Tl reactions in the 17.9- to 23.9-MeV energy range, and {sup 197}Au({alpha},n){sup 200}Tl reaction in the 13.4- to 23.9-MeV energy range using an activation technique. Thick-target yields for the {sup 64}Zn({alpha},{gamma}){sup 68}Ge (7- to 14-MeV) and {sup 63}Cu({alpha},{gamma}){sup 67}Ga (7-MeV) reactions were measured. For all measurements, natural elements were bombarded with He{sup +} beams from the 88'' Cyclotron at the Lawrence Berkeley National Laboratory (LBNL). Irradiated samples were counted using a g-spectrometry system at LBNL's Low Background Facility. Measured {sup 197}Au({alpha},{gamma}){sup 201}Tl cross-sections were compared with the NON-SMOKER theoretical values. The thick-target yields for the {sup 64}Zn({alpha},{gamma}){sup 68}Ge and {sup 63}Cu({alpha},{gamma}){sup 67}Ga reactions are also compared with the theoretical yield, calculated numerically using the energy dependent NON-SMOKER cross section data. In both cases, measured values are found to follow a trend of overlapping the predicted value near the alpha nucleus barrier height and fall below with a slowly widening difference between them in the sub barrier energy points.

  10. Nuclear Effect in Higher-Dimensional Factorial Moment Analysis of the $^{16}O$-, $^{32}S$- and $^{197}Au$-$Em$ Interaction Data at 200, 60 and 11 AGeV/c

    CERN Document Server

    Adamovich, M I; Alexander, Yu; Amirikas, R; Andreeva, N P; Avetyan, F A; Badyal, S K; Bakich, A M; Basova, E S; Bhalla, K B; Bhasin, A; Bhatia, V S; Bogdanov, V G; Bradnova, V; Bubnov, V I; Cai, X; Chasnikov, I Yu; Chen, L; Chernova, L P; Chernyavsky, M M; Dhamija, S; El-Chenawi, K F; Felea, D; Feng, S Q; Gaitinov, A S; Ganssauge, E R; Garpman, S I A; Gerassimov, S G; Gheata, A; Gheata, M; Grote, J; Gulamov, K G; Sen-Gupta, S K; Gupta, V K; Haiduc, M; Hasegan, D; Hu, Z R; Jakobsson, B; Just, L; Kanygina, E K; Karabova, M; Kharlamov, S P; Kim, Y C; Kovalenko, A D; Krasnov, S A; Kumar, V; Larionova, V G; Lee, G C; Lepekhin, F G; Levitskya, O V; Li, Y X; Liang, L; Liu, L S; Liu, Z G; Lokanathan, S; Lord, J J; Lukicheva, N S; Lu, Y; Luo, S B; Mangotra, L K; Marutyan, N A; Mitra, I S; Nasyrov, S Z; Navotny, V S; Nilsson, P O; Nystrand, J; Orlova, G I; Otterlund, I; Pavukova, A; Peak, L S; Peresadko, N G; Petrov, N V; Plyushchev, V A; Qian, W Y; Qin, Y M; Raniwala, R; Rao, N K; Rhee, J T; Röper, M D; Rusakova, V V; Saidkhanov, N S; Salmanova, N A; Sarkisova, L G; Sarkisian, V R; Seitimbetov, A M; Sethi, R; Shakhova, T I; Seliverstov, D M; Singh, B; Simonov, B B; Skelding, D; Söderström, K; Skorobogatova, V I; Stenlund, E; Svechnikova, L N; Svensson, T; Tawfik, A M; Tothova, M; Tretyakova, M I; Trofimova, T P; Tuleeva, U I; Vashisht, V; Vokal, S; Vrláková, J; Wang, H Q; Wang, S H; Wang, X R; Weng, Z Q; Wilkes, R J; Yang, C B; Yin, Z B; Yu, L Z; Zhang, D H; Zheng, P Y; Zhokhova, S I; Zhou, D C

    1997-01-01

    The anomalous behavior of 2-dimensional factorial moment in nucleus-nucleus collisions is studied in some detail using both mini-bias and central collision data of ^{16}O-, ^{32}S- and ^{197}Au-Em interactions from EMU01 experiment. The correct value for the effective Hurst exponent in the analysis of higher-dimensional factorial moment is found to be greater than unity, showing clearly the existence of superposition effect in nucleus-nucleus collisions.

  11. Discovery of New 2-[(4,6-Dimethoxy-1,3,5-triazin-2-yl)oxy]-6-(substituted phenoxy)benzoic Acids as Flexible Inhibitors of Arabidopsis thaliana Acetohydroxyacid Synthase and Its P197L Mutant.

    Science.gov (United States)

    Qu, Ren-Yu; Yang, Jing-Fang; Devendar, Ponnam; Kang, Wei-Ming; Liu, Yu-Chao; Chen, Qiong; Niu, Cong-Wei; Xi, Zhen; Yang, Guang-Fu

    2017-12-27

    In the search for new antiresistance acetohydroxyacid synthase (AHAS, EC 2.2.1.6) inhibitors to combat weed resistance associated with AHAS mutations, a series of 2-[(4,6-dimethoxy-1,3,5-triazin-2-yl)oxy]-6-(substituted phenoxy)benzoic acids 11-38 were designed and synthesized via the strategy of conformational flexibility analysis. Compounds 21, 22, 26, 33, 36, and 38 with high potency against both wild-type AtAHAS and its P197L mutant were identified as promising candidates with low resistance factors (RF, defined as the ratio between the ki values toward P197L mutant and wild-type AHAS) ranging from 0.73 to 6.32. Especially, compound 22 (RF = 0.73) was further identified as the most potent antiresistance AHAS inhibitor because of its significantly reduced resistance level compared with that of tribenuron-methyl (RF = 2650) and bispyribac (RF = 4.57). Furthermore, compounds 26, 33, 36, and 38 also displayed promising herbicidal activities against sensitive and resistant (P197L) Descurainia sophia at the dosage of 75-150 g of active ingredient (ai)/ha. Notably, compounds 33 and 38 still maintained over 60% herbicidal activity toward the resistant weed even at much lower dosages (37.5 g ai/ha). Therefore, the designed scaffold has the great potential to discover new candidate compounds for the control of weed resistance associated with AHAS mutation.

  12. Network of vascular diseases, death and biochemical characteristics in a set of 4,197 patients with type 1 diabetes (The FinnDiane Study

    Directory of Open Access Journals (Sweden)

    Wadén Johan

    2009-10-01

    Full Text Available Background Cardiovascular disease is the main cause of premature death in patients with type 1 diabetes. Patients with diabetic kidney disease have an increased risk of heart attack or stroke. Accurate knowledge of the complex inter-dependencies between the risk factors is critical for pinpointing the best targets for research and treatment. Therefore, the aim of this study was to describe the association patterns between clinical and biochemical features of diabetic complications. Methods Medical records and serum and urine samples of 4,197 patients with type 1 diabetes were collected from health care centers in Finland. At baseline, the mean diabetes duration was 22 years, 52% were male, 23% had kidney disease (urine albumin excretion over 300 mg/24 h or end-stage renal disease and 8% had a history of macrovascular events. All-cause mortality was evaluated after an average of 6.5 years of follow-up (25,714 patient years. The dataset comprised 28 clinical and 25 biochemical variables that were regarded as the nodes of a network to assess their mutual relationships. Results The networks contained cliques that were densely inter-connected (r > 0.6, including cliques for high-density lipoprotein (HDL markers, for triglycerides and cholesterol, for urinary excretion and for indices of body mass. The links between the cliques showed biologically relevant interactions: an inverse relationship between HDL cholesterol and the triglyceride clique (r P -16, a connection between triglycerides and body mass via C-reactive protein (r > 0.3, P -16 and intermediate-density cholesterol as the connector between lipoprotein metabolism and albuminuria (r > 0.3, P -16. Aging and macrovascular disease were linked to death via working ability and retinopathy. Diabetic kidney disease, serum creatinine and potassium, retinopathy and blood pressure were inter-connected. Blood pressure correlations indicated accelerated vascular aging in individuals with kidney disease

  13. A phase I dose escalation study of oral c-MET inhibitor tivantinib (ARQ 197) in combination with gemcitabine in patients with solid tumors.

    Science.gov (United States)

    Pant, S; Saleh, M; Bendell, J; Infante, J R; Jones, S; Kurkjian, C D; Moore, K M; Kazakin, J; Abbadessa, G; Wang, Y; Chen, Y; Schwartz, B; Camacho, L H

    2014-07-01

    Tivantinib (ARQ 197) is an orally available, non-adenosine triphosphate competitive, selective c-MET inhibitor. The primary objective of this study was to evaluate the safety, tolerability and to establish the recommended phase II dose (RP2D) of tivantinib and gemcitabine combination. Patients with advanced or metastatic solid tumors were treated with escalating doses of tivantinib (120-360 mg capsules) in combination with gemcitabine (1000 mg/m(2) weekly for 3 of 4 weeks). Different schedules of administration were tested and modified based on emerging preclinical data. Tivantinib was given continuously, twice a day (b.i.d.) for 2, 3 or 4 weeks of a 28-day cycle or on a 5-day on, 2-day off schedule (the day before and day of gemcitabine administration). Twenty-nine patients were treated with gemcitabine and escalating doses of tivantinib: 120 mg b.i.d. (n = 4), 240 mg b.i.d. (n = 6) and 360 mg b.i.d. (n = 19). No dose-limiting toxicities were observed in escalation. The RP2D was 360 mg b.i.d. daily, and 45 additional patients were enrolled in the expansion cohort. Grade ≥3 treatment-related toxicities were observed in 54 of 74 (73%) patients with the most common being neutropenia (43%), anemia (30%), thrombocytopenia (28%) and fatigue (15%). There was one treatment-related death due to neutropenia. Administration of gemcitabine did not affect tivantinib concentration. Fifty-six patients were assessable for response. Eleven (20%) patients achieved a partial response and 26 (46%) had stable disease (SD), including 15 (27%) who achieved SD for over 4 months. Ten of 37 patients with clinical benefit had prior exposure to gemcitabine. The combination of tivantinib at its monotherapy dose and standard dose gemcitabine was safe and tolerable. Early signs of antitumor activity may warrant further development of this combination in nonsmall-cell lung cancer, ovarian, pancreatic and cholangiocarcinoma. NCT00874042. © The Author 2014. Published by Oxford University Press

  14. Enhanced and long term immunogenicity of a Her-2/neu multi-epitope vaccine conjugated to the carrier CRM197 in conjunction with the adjuvant Montanide.

    Science.gov (United States)

    Tobias, Joshua; Jasinska, Joanna; Baier, Karin; Kundi, Michael; Ede, Nicholas; Zielinski, Christoph; Wiedermann, Ursula

    2017-02-09

    We previously identified three short single peptides (P4, P6 and P7) representing different B-cell epitopes on the extracellular domain of Her-2/neu for a vaccine that was tested in a phase-I clinical trial. Here we describe the improvement of the multi peptide vaccine by fusing the single peptides to a hybrid peptide P467. After coupling to either virosomes or to diphtheria toxoid CRM197 (CRM), the hybrid peptide was tested in different concentrations in combination with either Montanide or Aluminium hydroxide (Alum) in preclinical studies. Already low amount (10 μg) of P467 conjugated to CRM led to faster onset of high antibody levels compared to the P467-virosome. The formulation P467-CRM-Montanide induced higher serum IgG antibody titers, compared with P467-CRM-Alum, as examined by ELISA using recombinant Her-2/neu or Her-2/neu natively expressed on the tumor cell line SK-BR-3. Compared to P467-CRM-Alum, higher in vitro production of IL-2 and IFNγ in the Montanide-immunized mice was induced after re-stimulation of splenocytes with CRM but also with P467, indicating a clear Th1-biased response. In contrast to the single B cell peptides, the hybrid peptide led to T cell proliferation and cytokine production as CD4 T cell epitopes were generated in the fusion region of the single peptides P4 and P6 or P6 and P7. Additionally, a significantly higher proportion IFNγ-producing CD8+ T cells was found in the P467-CRM-Montanide immunized mice, probably by Montanide-driven bystander activation. Importantly, anti-P467 IgG antibodies exhibited anti-tumor properties and the combination of anti-P467 specific IgG with Herceptin® was found to inhibit the proliferation of Her-2/neu-overexpressing cell line SK-BR-3 in a significantly higher capacity than Herceptin® alone. Fusion of the B cell peptides has led to additional generation of CD4 T cell epitopes, and this P467-multi epitope vaccine was found to induce polyclonal antibody responses with anti

  15. Recent Origin and Spread of a Common Lithuanian Mutation, G197del LDLR, Causing Familial Hypercholesterolemia: Positive Selection Is Not Always Necessary to Account for Disease Incidence among Ashkenazi Jews

    Science.gov (United States)

    Durst, Ronen; Colombo, Roberto; Shpitzen, Shoshi; Avi, Liat Ben; Friedlander, Yechiel; Wexler, Roni; Raal, Frederick J.; Marais, David A.; Defesche, Joep C.; Mandelshtam, Michail Y.; Kotze, Maritha J.; Leitersdorf, Eran; Meiner, Vardiella

    2001-01-01

    G197del is the most prevalent LDL receptor (LDLR) mutation causing familial hypercholesterolemia (FH) in Ashkenazi Jew (AJ) individuals. The purpose of this study was to determine the origin, age, and population distribution of G197del, as well as to explore environmental and genetic effects on disease expression. Index cases from Israel (n=46), South Africa (n=24), Russia (n=7), The Netherlands (n=1), and the United States (n=1) were enlisted. All trace their ancestry to Lithuania. A highly conserved haplotype (D19S221:104-D19S865:208-D19S413:74) was identified in G197del chromosomes, suggesting the occurrence of a common founder. When two methods were used for analysis of linkage disequilibrium (LD) between flanking polymorphic markers and the disease locus and for the study of the decay of LD over time, the estimated age of the deletion was found to be 20 ± 7 generations (the 95% confidence interval is 15–26 generations), so that the most recent common ancestor of the mutation-bearing chromosomes would date to the 14th century. This corresponds with the founding of the Jewish community of Lithuania (1338 a.d.), as well as with the great demographic expansion of AJ individuals in eastern Europe, which followed this settlement. The penetrance of mutation-linked severe hypercholesterolemia is high (94% of heterozygotes have a baseline concentration of LDL cholesterol (LDL-C) that is >160 mg/dl), and no significant differences in the mean baseline lipid level of G197del carriers from different countries were found. Polymorphisms of apolipoprotein E and of scavenger-receptor class B type I were observed to have minor effects on the plasma lipid profile. With respect to determinative genetic influences on the biochemical phenotype, there is no evidence that could support the possibility of a selective evolutionary metabolic advantage. Therefore, the founder effect in a rapidly expanding population from a limited number of families remains a simple, parsimonious

  16. Recent origin and spread of a common Lithuanian mutation, G197del LDLR, causing familial hypercholesterolemia: positive selection is not always necessary to account for disease incidence among Ashkenazi Jews.

    Science.gov (United States)

    Durst, R; Colombo, R; Shpitzen, S; Avi, L B; Friedlander, Y; Wexler, R; Raal, F J; Marais, D A; Defesche, J C; Mandelshtam, M Y; Kotze, M J; Leitersdorf, E; Meiner, V

    2001-05-01

    G197del is the most prevalent LDL receptor (LDLR) mutation causing familial hypercholesterolemia (FH) in Ashkenazi Jew (AJ) individuals. The purpose of this study was to determine the origin, age, and population distribution of G197del, as well as to explore environmental and genetic effects on disease expression. Index cases from Israel (n=46), South Africa (n=24), Russia (n=7), The Netherlands (n=1), and the United States (n=1) were enlisted. All trace their ancestry to Lithuania. A highly conserved haplotype (D19S221:104-D19S865:208-D19S413:74) was identified in G197del chromosomes, suggesting the occurrence of a common founder. When two methods were used for analysis of linkage disequilibrium (LD) between flanking polymorphic markers and the disease locus and for the study of the decay of LD over time, the estimated age of the deletion was found to be 20 +/- 7 generations (the 95% confidence interval is 15-26 generations), so that the most recent common ancestor of the mutation-bearing chromosomes would date to the 14th century. This corresponds with the founding of the Jewish community of Lithuania (1338 a.d.), as well as with the great demographic expansion of AJ individuals in eastern Europe, which followed this settlement. The penetrance of mutation-linked severe hypercholesterolemia is high (94% of heterozygotes have a baseline concentration of LDL cholesterol (LDL-C) that is >160 mg/dl), and no significant differences in the mean baseline lipid level of G197del carriers from different countries were found. Polymorphisms of apolipoprotein E and of scavenger-receptor class B type I were observed to have minor effects on the plasma lipid profile. With respect to determinative genetic influences on the biochemical phenotype, there is no evidence that could support the possibility of a selective evolutionary metabolic advantage. Therefore, the founder effect in a rapidly expanding population from a limited number of families remains a simple, parsimonious

  17. Cross-resistance patterns to acetolactate synthase (ALS)-inhibiting herbicides of flixweed (Descurainia sophia L.) conferred by different combinations of ALS isozymes with a Pro-197-Thr mutation or a novel Trp-574-Leu mutation.

    Science.gov (United States)

    Deng, Wei; Yang, Qian; Zhang, Yongzhi; Jiao, Hongtao; Mei, Yu; Li, Xuefeng; Zheng, Mingqi

    2017-03-01

    Acetolactate synthase (ALS) is the common target of ALS-inhibiting herbicides, and target-site ALS mutations are the main mechanism of resistance to ALS-inhibiting herbicides. In this study, ALS1 and ALS2 genes with full lengths of 2004bp and 1998bp respectively were cloned in individual plants of susceptible (S) or resistant (R) flixweed (Descurainia sophia L.) populations. Two ALS mutations of Pro-197-Thr and/or Trp-574-Leu were identified in plants of three R biotypes (HB24, HB30 and HB42). In order to investigate the function of ALS isozymes in ALS-inhibiting herbicide resistance, pHB24 (a Pro-197-Thr mutation in ALS1 and a wild type ALS2), pHB42 (a Trp-574-Leu mutation in ALS1 and a wild type ALS2) and pHB30 (a Trp-574-Leu mutation in ALS1 and a Pro-197-Thr mutation in ALS2) subpopulations individually homozygous for different ALS mutations were generated. Individuals of pHB30 had mutations in each isozyme of ALS and had higher resistance than pHB24 and pHB42 populations containing mutations in only one ALS isozyme. Moreover, the pHB24 had resistance to SU, TP and SCT herbicides, whereas pHB24 and pHB42 had resistance to these classes of herbicides as well as IMI and PTB herbicides. The sensitivity of isolated ALS enzyme to inhibition by herbicides in these populations correlated with whole plant resistance levels. Therefore, reduced ALS sensitivity resulting from the mutations in ALS was responsible for resistance to ALS-inhibiting herbicides in flixweed. Copyright © 2016 Elsevier Inc. All rights reserved.

  18. The IL-17A G-197A and IL-17F 7488T/C polymorphisms are associated with increased risk of cancer in Asians: a meta-analysis

    Directory of Open Access Journals (Sweden)

    Wang H

    2015-09-01

    Full Text Available Huifen Wang,1,* Yanli Zhang,1,* Zhaolan Liu,2 Yin Zhang,3 Hongchuan Zhao,1 Shiyu Du1 1Department of Gastroenterology, China-Japan Friendship Hospital, 2Center for Evidence-Based Chinese Medicine, Beijing University of Chinese Medicine, 3Institute of Basic Research in Clinical Medicine, China Academy of Chinese Medical Sciences, Beijing, People’s Republic of China *These authors contributed equally to this work Background: Interleukin-17 (IL-17 is a family of emerged pro-inflammatory cytokines. The IL-17A and IL-17F are two important members of IL-17 family. Previous studies have shown that the functional IL-17A G-197A and IL-17F 7488T/C polymorphisms may contribute to susceptibility to cancer but the results were inconclusive. This meta-analysis was performed to determine the exact association between IL-17 polymorphisms and cancer risk.Methods: Online databases were searched to identify eligible case–control studies. Pooled odds ratios (ORs and confidence intervals (CIs were calculated by fixed-effect models or random-effect models. Publication bias was detected by Egger’s test and Begg’s test.Results: Nine eligible case–control studies of IL-17A G-197A and seven studies of IL-17F 7488T/C, including 3,181 cases and 4,005 controls, were identified. Pooled analysis suggested the variant IL-17A-197A allele was associated with increased risk cancer (GA/AA vs GG, OR =1.27, 95% CI: 1.15, 1.41, Pheterogeneity =0.374; and A vs G, OR =1.30, 95% CI: 1.17, 1.45, Pheterogeneity =0.021. For IL-17F 7488T/C, the homozygote 7488CC genotype significantly increased risk of cancer (CC vs TC/TT, OR =1.36, 95% CI: 0.97, 1.91, Pheterogeneity =0.875; and CC vs TT, OR =1.39, 95% CI: 1.03, 1.88, Pheterogeneity =0.979, especially for gastric cancer.Conclusion: The variant IL-17A-197A allele and IL-17F 7488CC genotype were associated with increased risk of cancer, especially for gastric cancer. Keywords: interleukin-17, gene polymorphism, gastric cancer, risk

  19. Validation of absolute axial neutron flux distribution calculations with MCNP with 197Au(n,γ)198Au reaction rate distribution measurements at the JSI TRIGA Mark II reactor.

    Science.gov (United States)

    Radulović, Vladimir; Štancar, Žiga; Snoj, Luka; Trkov, Andrej

    2014-02-01

    The calculation of axial neutron flux distributions with the MCNP code at the JSI TRIGA Mark II reactor has been validated with experimental measurements of the (197)Au(n,γ)(198)Au reaction rate. The calculated absolute reaction rate values, scaled according to the reactor power and corrected for the flux redistribution effect, are in good agreement with the experimental results. The effect of different cross-section libraries on the calculations has been investigated and shown to be minor. Copyright © 2013 Elsevier Ltd. All rights reserved.

  20. NiCo2O4 surface coating Li[Ni0.03Mn1.97]O4 micro-/nano- spheres as cathode material for high-performance lithium ion battery

    Science.gov (United States)

    Ye, Pan; Dong, Hui; Xu, Yunlong; Zhao, Chongjun; Liu, Dong

    2018-01-01

    Here we report a novel transitional metal oxide (NiCo2O4) coated Li[Ni0.03Mn1.97]O4 micro-/nano- spheres as high-performance Li-ion battery cathode material. A thin layer of ∼10 nm NiCo2O4 was formed by simple wet-chemistry approach adjacent to the surface of Li[Ni0.03Mn1.97]O4 micro-/nano- spheres, leading to significantly enhanced battery electrochemical performance. The optimized sample(1 wt%) not only delivers excellent discharge capacity and cycling stability improvement at both room temperature and elevated temperatures, but also effectively prevents Mn dissolution while retaining its coating structure intact according to XRF and TEM results. The CV and EIS break-down analysis indicated a much faster electrochemical reaction kinetics, more reversible electrode process and greatly reduced charge transfer and Warburg resistance, clearly illustrating the dual role of NiCo2O4 coating to boost electron transport and Li+ diffusion, and alleviation of manganese dissolving. This approach may render as an efficient technique to realize high-performance lithium ion battery cathode material.

  1. Immunogenicity and safety of the Vi-CRM197 conjugate vaccine against typhoid fever in adults, children, and infants in south and southeast Asia: results from two randomised, observer-blind, age de-escalation, phase 2 trials.

    Science.gov (United States)

    Bhutta, Zulfiqar A; Capeding, Maria Rosario; Bavdekar, Ashish; Marchetti, Elisa; Ariff, Shabina; Soofi, Sajid B; Anemona, Alessandra; Habib, Muhammad A; Alberto, Edison; Juvekar, Sanjay; Khan, Rana M Qasim; Marhaba, Rachid; Ali, Noshad; Malubay, Nelia; Kawade, Anand; Saul, Allan; Martin, Laura B; Podda, Audino

    2014-02-01

    Typhoid vaccination is a public health priority in developing countries where young children are greatly affected by typhoid fever. Because present vaccines are not recommended for children younger than 2 years, the Novartis Vaccines Institute for Global Health developed a conjugate vaccine (Vi-CRM197) for infant immunisation. We aimed to assess the immunogenicity and safety of Vi-CRM197 in participants of various ages in endemic countries in south and southeast Asia. We did two randomised, observer-blind, age de-escalation, phase 2 trials at two sites in Pakistan and India (study A), and at one site in the Philippines (study B), between March 2, 2011, and Aug 9, 2012. Adults aged 18-45 years, children aged 24-59 months, older infants aged 9-12 months, and infants aged 6-8 weeks were randomly assigned (1:1) with a computer-generated randomisation list (block size of four) to receive either 5 μg Vi-CRM197 or 25 μg Vi-polysaccharide vaccine (or 13-valent pneumococcal conjugate vaccine in children younger than 2 years). Both infant populations received Vi-CRM197 concomitantly with vaccines of the Expanded Programme on Immunization (EPI), according to WHO schedule. With the exception of designated study site personnel responsible for vaccine preparation, study investigators, those assessing outcomes, and data analysts were masked to treatment allocation. We specified no a-priori null hypothesis for the immunogenicity or safety objectives and all analyses were descriptive. Analyses were by modified intention-to-treat. These studies are registered with ClinicalTrials.gov, numbers NCT01229176 and NCT01437267. 320 participants were enrolled and vaccinated in the two trials: 200 in study A (all age groups) and 120 in study B (children and infants only), of whom 317 (99%) were included in the modified intention-to-treat analysis. One dose of Vi-CRM197 significantly increased concentrations of anti-Vi antibody in adults (from 113 U/mL [95% CI 67-190] to 208 U/mL [117

  2. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  3. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  4. Measurement of Fragment Production Cross Sections in the $^{12}$C+$^{12}$C and $^{12}$C+$^{197}$Au Reactions at 62 $A$ MeV for Hadrontherapy and Space Radiation Protection

    CERN Document Server

    Tropea, S; Agodi, C; Blancato, A A; Bondì, M; Cappuzzello, F; Carbone, D; Cavallaro, M; Cirrone, G A P; Cuttone, G; Giacoppo, F; Nicolosi, D; Pandola, L; Raciti, G; Rapisarda, E; Romano, F; Sardina, D; Scuderi, V; Sfienti, C

    2014-01-01

    Over the last twenty years, there has been a renewed interest in nuclear fragmentation studies for both hadrontherapy applications and space radiation protection. In both fields, fragmentation cross sections are needed to predict the effects of the ions nuclear interactions within the patient’s and the astronaut’s body. Indeed, the Monte Carlo codes used in planning tumor treatments and space missions must be tuned and validated by experimental data. However, only a limited set of fragmentation cross sections are available in literature, especially at Fermi energies. Therefore, we have studied the production of secondary fragments in the 12 C+ 12 C and 12 C+ 197 Au reactions at 62 A MeV. In this work, the measured 4 He cross sections angular distributions at four selected angles are presented and compared.

  5. Angular distributions of target fragments from the reactions of 292 MeV - 25. 2 GeV /sup 12/C with /sup 197/Au and /sup 238/U

    Energy Technology Data Exchange (ETDEWEB)

    Morita, Y.

    1983-05-20

    Angular distributions of target fragments from the reactions of /sup 12/C with /sup 197/Au and /sup 238/U were measured at projectile energies of 292 MeV, 1.0 GeV, 3.0 GeV, 12.0 GeV and 25.2 GeV. The angular distributions of the /sup 197/Au target fragments were all forwardly peaked. Extensively forward peaked angular distributions were observed at the non-relativistic projectile energies (292 MeV, 1.0 GeV). No obvious differences were observed in the angular distributions at the different relativistic projectile energies of 3.0 GeV, 12.0 GeV and 25.2 GeV. The characteristic angular distribution pattern from the relativistic projectile energy experiments was also observed in the non-relativistic energy experiments. Maximum degree of forward-peaking in the angular distributions at each projectile energy was observed at the product mass number (A) around 190 from the 292 MeV projectile energy, at A=180 from 1.0 GeV and at A=175 from 3.0 GeV and 12.0 GeV. In general, two different types of angular distributions were observed in the relativistic projectile energy experiments with the /sup 238/U target. Isotropic angular distributions were observed for the fission product nuclides. The angular distributions of the fission products at the intermediate (292 MeV) energy showed slightly forward- peaked angular distributions. Because of the long projectile-target interaction time in the primary nuclear reaction, larger momentum was transferred from the projectile to the target nucleus. Steep forward-peaked angular distributions were also observed with the /sup 238/U target.

  6. Critical appraisal of a quadrivalent CRM(197) conjugate vaccine against meningococcal serogroups A, C W-135 and Y (Menveo) in the context of treatment and prevention of invasive disease.

    Science.gov (United States)

    Bröker, Michael; Cooper, Brian; Detora, Lisa M; Stoddard, Jeffrey J

    2011-01-01

    Worldwide, invasive meningococcal disease affects about 500,000 people annually. Case fatality in developed countries averages 10%, and higher rates are reported in less prosperous regions. According to the World Health Organization, the most important pathogenic serogroups are A, B, C, W-135, X, and Y. Clinical features of invasive meningococcal disease make diagnosis and management difficult. Antibiotic measures are recommended for prophylaxis after exposure and for treatment of invasive meningococcal disease cases; however, resistant strains may be emerging. Vaccines are generally regarded as the best preventative measure for invasive meningococcal disease. Polysaccharide vaccines against serogroups A, C, W-135, and Y using protein conjugation technology have clear advantages over older plain polysaccharide formulations without a protein component. The first quadrivalent meningococcal conjugate vaccine (MenACWY-D) was licensed in the US in 2005. More recently, MenACWY-CRM (Menveo(®)) was licensed in Europe, the US, the Middle East, and Latin America. MenACWY-CRM uses cross-reactive material 197, a nontoxic mutant of diphtheria toxin, as the carrier protein. MenACWY-CRM offers robust immunogenicity in all age groups, with a tolerability profile similar to that of a plain polysaccharide vaccine. Given its potential for protecting persons from infancy to old age, MenACWY-CRM offers the opportunity to protect broad populations against invasive meningococcal disease. The most optimal strategy for use of the vaccine has to be assessed country by country on the basis of local epidemiology, individual health care systems, and need.

  7. Absolute photofission cross section of sup 197 Au, @Pb, sup 209 Bi, sup 232 Th, sup 238 U, and sup 235 U nuclei by 69-MeV monochromatic and polarized photons

    Energy Technology Data Exchange (ETDEWEB)

    Martins, J.B.; Moreira, E.L.; Tavares, O.A.P.; Vieira, J.L. (Conselho Nacional de Desenvolvimento Cientifico e Tecnologico-CNPq (BR) Centro Brasileiro de Pesquisas Fisicas-CBPF, Rua Dr. Xavier Sigaud 150, 22290 Rio de Janeiro-RJ, (Brazil)); Casano, L.; D' Angelo, A.; Schaerf, C. (Dipartimento di Fisica, II Universita' degli Studi di Roma Tor Vergata' ' , Via E. Carnevale, 00173 Roma, (Italy) Istituto Nazionale di Fisica Nucleare-INFN, Sezione di Roma 2, Roma, (Italy)); Terranova, M.L. (Dipartimento di Scienze e Tecnologie Chimiche, II Universita' degli Studi di Rom Torr Vergata' ' , Via E. Carnevale, 00173 Roma, (Italy) Istituto Nazionale di Fisica Nucleare-INFN, Sezione di Roma 2, Roma, Italy); Babusci, D. (Istituto Nazionale di Fisica Nucleare-INFN, Laboratori Nazionali di Frascati-LNF, Casella Postale 13, 00044 Frascati, (Italy)); Girolami, B. (Laboratorio di Fisica dell' Istituto Superiore di Sanita, Viale Regina Elena 299, 00161 Roma, (Italy) Istituto Nazionale di Fisica Nuclea

    1991-07-01

    Absolute cross-section measurements for the photofission reactions of {sup 197}Au, {sup nat}Pb, {sup 209}Bi, {sup 232}Th, {sup 238}U, and {sup 235}U nuclei have been performed at an incident photon energy of 69 MeV using monochromatic and polarized photon beams and dielectric fission-track detectors. Nuclear fissility values have been obtained and results are in agreement with those from other laboratories, although in some cases discrepancies are observed between one other. For nuclei in the region of the actinides the fissility result is {approx gt}0.4, while for Au, Pb, and Bi nuclei it only is {similar to}10{sup {minus}3}--10{sup {minus}2}. Results have been interpreted in terms of the primary Levinger's quasideuteron nuclear photoabsorption followed by a mechanism of evaporation-fission competition for the excited nuclei. Shell effects have been taken into account, and they are clearly manifested when fissility is evaluated. The influence of photon polarization on photofission of {sup 238}U also has been investigated, and results have shown isotropy in the fragment azimuthal distribution.

  8. Computer-assisted static/dynamic renal imaging: a screening test for renovascular hypertension. [Effectiveness of /sup 197/Hg-chlormerondrin and /sup 99m/Tc-pertechnetate scanning as screening procedures

    Energy Technology Data Exchange (ETDEWEB)

    Keim, H.J.; Johnson, P.M.; Vaughan, E.D. Jr.; Beg, K.; Follett, D.A.; Freeman, L.M.; Laragh, J.H.

    1979-01-01

    Computer-assisted static/dynamic renal imaging with (/sup 197/Hg) chlormerodrin and (/sup 99m/Tc) pertechnetate was evaluated prospectively as a screening test for renovascular hypertension. Results are reported for 51 patients: 33 with benign essential hypertension and 18 with renovascular hypertension, and for 21 normal controls. All patients underwent renal arteriography. Patients with significant obesity, renal insufficiency, or renoparenchymal disease were excluded from this study. Independent visual analyses of renal gamma images and time-activity transit curves identified 17 of the 18 patients with renovascular hypertension; one study was equivocal. There were five equivocal and three false-positive results in the essential hypertension and normal control groups. The sensitivity of the method was 94% and the specificity 85%. Since the prevalence of the renovascular subset of hypertension is approximately 5%, the predictive value is only 25%. Inclusion of computer-generated data did not improve this result. Accordingly, this method is not recommended as a primary screening test for renovascular hypertension.

  9. 46 CFR 197.420 - Operations manual.

    Science.gov (United States)

    2010-10-01

    ... COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE OCCUPATIONAL SAFETY AND HEALTH STANDARDS... planned. (c) The operations manual must provide for the safety and health of the divers. (d) The...) Hand-held power tools; (ii) Welding and burning equipment; and (iii) Explosives. specific diving mode...

  10. 28_197 - 204_Saminu et al.,

    African Journals Online (AJOL)

    pc

    Thurechtand Howdle, 2009) and other various media (Mertoglu, et.al., 2005). ism involved in RAFT polymerisation ... 2009; Smith, et.al., 2010; Wager, et.al., 2004; Wang, et.al., 2006; Zhou, et.al., 2007).Synthetic procedures require the .... The decomposition pro of the copolymers were measured u thermogravimetric analysis ...

  11. Publications | Page 197 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Climate Change Adaptation in Africa (CCAA) final report (open access). As much as climate change variability and other physical processes, it is very often poverty - in terms of lack of resources or choices - that creates vulnerability. For example, reduced rainfall doesn''t have to be disastrous for farming communities if they ...

  12. Publications | Page 197 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Many of Port-au-Prince`s graffiti-stained neighborhoods are experiencing a dramatic escalation in homicidal violence. The surge in murder, property crime and assault began less than... ASSIST Pakistan : Action to Stop Smoking In Suspected Tuberculosis in Pakistan; an intervention to stop tobacco use among patients ...

  13. 46 CFR 197.202 - Applicability.

    Science.gov (United States)

    2010-10-01

    ... GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE OCCUPATIONAL SAFETY AND HEALTH STANDARDS... issued by the Coast Guard including mobile offshore drilling units regardless of their geographic... advancement of diving equipment and technology; or (3) Performed solely for search and rescue or related...

  14. Reference: 197 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available bidopsis thaliana CAX2 cation transporter. 6 959-71 15821993 2004 Dec Plant molecular biology Cheng Ning-Hui|Hirschi Kendal D|Marshall Joy L|Morris Jay L|Pittman Jon K|Shigaki Toshiro

  15. 46 CFR 197.560 - Medical surveillance.

    Science.gov (United States)

    2010-10-01

    ... COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE OCCUPATIONAL SAFETY AND HEALTH STANDARDS... medicinal drugs routinely taken, a history of previous exposure to ionizing radiation, and a history of... level criteria of paragraph (b)(2) of this section without having undergone an initial medical...

  16. 202 197 Heavy Metals and Microbial Contamin

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... ABSTRACT: The heavy metal and microbial contaminants levels were evaluated in a commercial polyherbal .... (Cowan and Steel) was carried out to identify ... Statistical Analysis. Analysis of data obtained from this study was done using Excel Microsoft software. Analysis of Variance (ANOVA) was used for.

  17. 46 CFR 197.436 - Liveboating.

    Science.gov (United States)

    2010-10-01

    ... GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE OCCUPATIONAL SAFETY AND HEALTH STANDARDS... visibility; (3) The propellers of the vessel are stopped before the diver enters or exits the water; and (4... work function; (3) A means is used to prevent the diver's hose from entangling in the propellers of the...

  18. 46 CFR 197.204 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... structurally. Commercial diver means a diver engaged in underwater work for hire excluding sport and... mode means a type of diving requiring SCUBA, surface-supplied air, or surface-supplied mixed-gas...

  19. 46 CFR 197.346 - Diver's equipment.

    Science.gov (United States)

    2010-10-01

    ..., and knife; and (5) A hose group consisting of the breathing gas hose and fittings, the control valve...-supplied dive operation outside the no-compression limits, deeper than 130 fsw, or using mixed-gas as a... using mixed-gas must have a diver-carried reserve breathing gas supply except when using a heavy-weight...

  20. Intermittency in {sup 197}Au fragmentation

    Energy Technology Data Exchange (ETDEWEB)

    Dabrowska, A.; Holynski, R.; Olszewski, A.; Szarska, M.; Wilczynska, B.; Wolter, W.; Wosiek, B. [Institute of Nuclear Physics, Cracow (Poland); Cherry, M.L.; Deines-Jones, P.; Jones, W.V.; Sengupta, K.; Wefel, B. [Louisiana State Univ., Baton Rouge, LA (United States). Dept. of Physics and Astronomy; Waddington, C.J. [Minnesota Univ., Minneapolis, MN (United States). School of Physics and Astronomy; Pozharova, E.A.; Skorodko, T.Yu. [Inst. of Theoretical and Experimental Physics, Moscow (Russian Federation); KLMM Collaboration

    1995-07-01

    The concept of factorial moments was applied to an analysis of the dynamical fluctuations in the charge distributions of the fragments emitted from gold nuclei with energies 10.6 and < 1.0 GeV/n interacting with emulsion nuclei. Clear evidence for intermittent fluctuations has been found in an analysis using all the particles released from the gold projectile, with a stronger effect observed below 1 GeV/n than at 10.6 GeV/n. For the full data sets, however, the intermittency effect was found to be very sensitive to the singly charged particles, and neglecting these particles strongly reduces the intermittency signal. When the analysis is restricted to the multiply charged fragments, an intermittency effect is revealed only for multifragmentation events, although one that is enhanced as compared to the analysis of all, singly and multiply charged, particles. The properties of the anomalous fractal dimensions suggest a sequential decay mechanism, rather than the existence of possible critical behaviour in the process of nuclear fragmentation. The likely influence of the charge conservation effects and the finite size of decaying systems on the observed intermittency signals was pointed out. (author). 37 refs, 9 figs, 5 tabs.

  1. Burrowing Owl - Palo Verde Valley [ds197

    Data.gov (United States)

    California Department of Resources — These burrowing owl observations were collected during the spring and early summer of 1976 in the Palo Verde Valley, eastern Riverside County, California. This is an...

  2. Critical appraisal of a quadrivalent CRM197 conjugate vaccine against meningococcal serogroups A, C W-135 and Y (Menveo® in the context of treatment and prevention of invasive disease

    Directory of Open Access Journals (Sweden)

    Bröker M

    2011-07-01

    Full Text Available Michael Bröker, Brian Cooper, Lisa M DeTora, Jeffrey J StoddardGlobal Medical Affairs, Novartis Vaccines and Diagnostics, Marburg, Germany, and Cambridge, MA, USAAbstract: Worldwide, invasive meningococcal disease affects about 500,000 people annually. Case fatality in developed countries averages 10%, and higher rates are reported in less prosperous regions. According to the World Health Organization, the most important pathogenic serogroups are A, B, C, W-135, X, and Y. Clinical features of invasive meningococcal disease make diagnosis and management difficult. Antibiotic measures are recommended for prophylaxis after exposure and for treatment of invasive meningococcal disease cases; however, resistant strains may be emerging. Vaccines are generally regarded as the best preventative measure for invasive meningococcal disease. Polysaccharide vaccines against serogroups A, C, W-135, and Y using protein conjugation technology have clear advantages over older plain polysaccharide formulations without a protein component. The first quadrivalent meningococcal conjugate vaccine (MenACWY-D was licensed in the US in 2005. More recently, MenACWY-CRM (Menveo® was licensed in Europe, the US, the Middle East, and Latin America. MenACWY-CRM uses cross-reactive material 197, a nontoxic mutant of diphtheria toxin, as the carrier protein. MenACWY-CRM offers robust immunogenicity in all age groups, with a tolerability profile similar to that of a plain polysaccharide vaccine. Given its potential for protecting persons from infancy to old age, MenACWY-CRM offers the opportunity to protect broad populations against invasive meningococcal disease. The most optimal strategy for use of the vaccine has to be assessed country by country on the basis of local epidemiology, individual health care systems, and need.Keywords: invasive meningococcal disease, quadrivalent meningococcal conjugate vaccine, Neisseria meningitidis

  3. Phase II study of erlotinib plus tivantinib (ARQ 197) in patients with locally advanced or metastatic EGFR mutation-positive non-small-cell lung cancer just after progression on EGFR-TKI, gefitinib or erlotinib.

    Science.gov (United States)

    Azuma, Koichi; Hirashima, Tomonori; Yamamoto, Nobuyuki; Okamoto, Isamu; Takahashi, Toshiaki; Nishio, Makoto; Hirata, Taizo; Kubota, Kaoru; Kasahara, Kazuo; Hida, Toyoaki; Yoshioka, Hiroshige; Nakanishi, Kaoru; Akinaga, Shiro; Nishio, Kazuto; Mitsudomi, Tetsuya; Nakagawa, Kazuhiko

    2016-01-01

    Patients with epidermal growth factor receptor (EGFR) activation mutation-positive non-small-cell lung cancer (NSCLC) respond well to EGFR tyrosine kinase inhibitors (EGFR-TKIs), but eventually become resistant in most cases. The hepatocyte growth factor/c-Met (HGF/c-Met) pathway is reported as a poor prognostic factor in various cancers. As c-Met is involved in EGFR-TKI resistance, a c-Met inhibitor and EGFR-TKI combination may reverse the resistance. This study evaluated the efficacy and safety of a c-Met selective inhibitor, tivantinib (ARQ 197), in combination with erlotinib, in Japanese EGFR mutation-positive patients with NSCLC who progressed while on EGFR-TKIs. This study enrolled 45 patients with NSCLC with acquired resistance to EGFR-TKIs, who were orally administered a daily combination of tivantinib/erlotinib. The primary end point was the overall response rate (ORR) and secondary end points included disease control rate, progression-free survival (PFS) and overall survival (OS). The patients underwent a mandatory second biopsy just after progression on EGFR-TKIs. The predictive biomarkers were extensively analysed using tumour and blood samples. The ORR was 6.7% (95% CI 1.4% to 18.3%), and the lower limit of 95% CI did not exceed the target of 5%. The median PFS (mPFS) and median OS (mOS) were 2.7 months (95% CI 1.4 to 4.2) and 18.0 months (95% CI 13.4 to 22.2), respectively. Both were longer in c-Met high patients (c-Met high vs low: mPFS 4.1 vs 1.4 months; mOS 20.7 vs 13.9 months). Partial response was observed in three patients, all of whom were c-Met and HGF high. The common adverse events and their frequencies were similar to those known to occur with tivantinib or erlotinib alone. Although this study did not prove clinical benefit of tivantinib in patients with acquired resistance to EGFR-TKIs, activated HGF/c-Met signalling, a poor prognostic factor, may define a patient subset associated with longer survival by the tivantinib

  4. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  5. Decay of {sup 185}Tl, {sup 185m+g}Hg, {sup 189m+g}Pb and energy location of the 13/2{sup +} isomeric states in {sup 185}Hg, {sup 189}Pb, {sup 193}Po and {sup 197}Rn

    Energy Technology Data Exchange (ETDEWEB)

    Sauvage, J.; Roussiere, B.; Franchoo, S.; Barre, N.; Bourgeois, C.; Clavelin, J.F.; Grave, X.; Kilcher, P.; Oms, J. [IN2P3-CNRS/Universite Paris-Sud, Institut de Physique Nucleaire, Orsay Cedex (France); Genevey, J. [IN2P3-CNRS/Universite Joseph Fourier, Laboratoire de Physique Subatomique et de Cosmologie, Grenoble Cedex (France); Andreyev, A.N. [University of York, Department of Physics, York (United Kingdom); Ben Braham, A. [Faculte des sciences de Tunis, Tunis (Tunisia); Witte, H. de; Huyse, M.; Mukha, I.; Vel, K.V. de; Duppen, P. van [Instituut voor Kern- en Stralingsfysica, Leuven (Belgium); Fedorov, D.V.; Volkov, Yu.M. [Petersburg Nuclear Physics Institute, Gatchina (Russian Federation); Fedoseyev, V.N.; Marsh, B.A. [ISOLDE, CERN, Geneve (Switzerland); Fraile, L.M. [Universidad Complutense, Grupo de Fisica Nuclear, Madrid (Spain); Huber, G. [Johannes Gutenberg Universitaet, Institut fuer Physik, Mainz (Germany); Koester, U. [Institut Laue-Langevin, Grenoble Cedex 9 (France); Kunz, P. [TRIUMF, Vancouver (Canada); Lesher, S.R. [University of Wisconsin-La Crosse, La Crosse (United States); Porquet, M.G. [Centre de Sciences Nucleaires et de Sciences de la Matiere, Orsay (France); Seliverstov, M. [Petersburg Nuclear Physics Institute, Gatchina (Russian Federation); Johannes Gutenberg Universitaet, Institut fuer Physik, Mainz (Germany); Stefanescu, I. [Technische Universitaet Muenchen, Forschungs-Neutronenquelle Heinz Maier-Leibnitz, Garching (Germany); Wojtasiewicz, A. [University of Warsaw, Institute of Experimental Physics, Warsaw (Poland)

    2013-09-15

    The {beta}{sup +} /EC decay of {sup 185}Tl was studied at the ISOLDE facility, the {gamma} -rays belonging to {sup 185}Hg have been identified and a partial low-spin level scheme of {sup 185}Hg has been built. The decay of {sup 185m+g}Hg was studied at the ISOCELE facility. Conversion electron lines of very low-energy transitions were observed for the first time. Electron data have been obtained for four transitions in {sup 185}Au and two transitions in {sup 185}Hg. From the analysis performed using an internal energy calibration procedure the energy location of the {sup 185m}Hg has been determined to be E{sub IS}= 103.7(4) keV. This E{sub IS} value is consistent with that determined independently, E{sub IS}=94(13) keV, using {sup 185m+g}Hg {alpha} -decay data from literature. New {alpha} particles emitted from {sup 189m+g}Pb have been detected and their origins determined by in-source laser spectroscopy at the ISOLDE facility. {alpha} - {gamma} coincidence results have served to locate the 13/2{sup +} isomeric state of {sup 189}Pb at E{sub IS}=40(4) keV. This latter E{sub IS} value added to {alpha} -decay data from literature have allowed the energy location of the 13/2{sup +} isomeric states of {sup 193}Po and {sup 197}Rn at 95(7)keV and 194(12)keV, respectively. The nuclear structure of the isomeric and ground states in the nuclei of the three {alpha} -emitter chains starting with {sup 195m+g,} {sup 197m+g,} {sup 199m+g}Rn are discussed. (orig.)

  6. 26 CFR 1.197-0 - Table of contents.

    Science.gov (United States)

    2010-04-01

    ...) Interests under certain financial contracts. (3) Interests in land. (4) Certain computer software. (i... software defined. (5) Certain interests in films, sound recordings, video tapes, books, or other similar... copyrights. (8) Interests under leases of tangible property. (i) Interest as a lessor. (ii) Interest as a...

  7. 197 Obnoxious Labels as Language of Class Struggle in Nigeria ...

    African Journals Online (AJOL)

    FIRST LADY

    2011-01-18

    Jan 18, 2011 ... Obnoxious labels such as people with dog hand or Ndi aka Nkita promote inferiority complex in people. In Igbo society, for example, Uche (2004:139) says dogs are seen as very unclean animals and are not models of behaviour. A person that is referred to as a dog is often seen as being sexually loose.

  8. Dynamics of Populations of Planetary Systems (IAU C197)

    Science.gov (United States)

    Knezevic, Zoran; Milani, Andrea

    2005-05-01

    1. Resonances and stability of extra-solar planetary systems C. Beaugé, N. Callegari, S. Ferraz-Mello and T. A. Michtchenko; 2. Formation, migration, and stability of extrasolar planetary systems Fred C. Adams; 3. Dynamical evolution of extrasolar planetary systems Ji-Lin Zhou and Yi-Sui Sun; 4. Dynamics of planetesimals: the role of two-body relaxation Eiichiro Kokubo; 5. Fitting orbits Andrzej J. Maciejewski, Krzysztof Gozdziewski and Szymon Kozlowski; 6. The secular planetary three body problem revisited Jacques Henrard and Anne-Sophie Libert; 7. Dynamics of extrasolar systems at the 5/2 resonance: application to 47 UMa Dionyssia Psychoyos and John D. Hadjidemetriou; 8. Our solar system as model for exosolar planetary systems Rudolf Dvorak, Áron Süli and Florian Freistetter; 9. Planetary motion in double stars: the influence of the secondary Elke Pilat-Lohinger; 10. Planetary orbits in double stars: influence of the binary's orbital eccentricity Daniel Benest and Robert Gonczi; 11. Astrometric observations of 51 Peg and Gliese 623 at Pulkovo observatory with 65 cm refractor N. A. Shakht; 12. Observations of 61 Cyg at Pulkovo Denis L. Gorshanov, N. A. Shakht, A. A. Kisselev and E. V. Poliakow; 13. Formation of the solar system by instability Evgeny Griv and Michael Gedalin; 14. Behaviour of a two-planetary system on a cosmogonic time-scale Konstantin V. Kholshevnikov and Eduard D. Kuznetsov; 15. Boundaries of the habitable zone: unifying dynamics, astrophysics, and astrobiology Milan M. Cirkovic; 16. Asteroid proper elements: recent computational progress Fernando Roig and Cristian Beaugé; 17. Asteroid family classification from very large catalogues Anne Lemaitre; 18. Non-gravitational perturbations and evolution of the asteroid main belt David Vokrouhlicky, M. Broz and W. F. Bottke, D. Nesvorny and A. Morbidelli; 19. Diffusion in the asteroid belt Harry Varvoglis; 20. Accurate model for the Yarkovsky effect David Capek and David Vokrouhlicky; 21. The population of asteroids in the 2:1 mean motion resonance with Jupiter revised Miroslav Broz, D. Vokrouhlicky, F. Roig, D. Nesvorny, W. F. Bottke and A. Morbidelli; 22. On the reliability of computation of maximum Lyapunov Characteristic Exponents for asteroids Zoran Knezevic and Slobodan Ninkovic; 23. Nekhoroshev stability estimates for different models of the Trojan asteroids Christos Efthymiopoulos; 24. The role of the resonant 'stickiness' in the dynamical evolution of Jupiter family comets A. Alvarez-Canda and F. Roig; 25. Regimes of stability and scaling relations for the removal time in the asteroid belt: a simple kinetic model and numerical tests Mihailo Cubrovic; 26. Virtual asteroids and virtual impactors Andrea Milani; 27. Asteroid population models Alessandro Morbidelli; 28. Linking Very Large Telescope asteroid observations M. Granvik, K. Muinonen, J. Virtanen, M. Delbó, L. Saba, G. De Sanctis, R. Morbidelli, A. Cellino and E. Tedesco; 29. Collision orbits and phase transition for 2004 AS1 at discovery Jenni Virtanen, K. Muinonen, M. Granvik and T. Laakso; 30. The size of collision solutions in orbital elements space G. B. Valsecchi, A. Rossi, A. Milani and S. R. Chesley; 31. Very short arc orbit determination: the case of asteroid 2004 FU162 Steven R. Chesley; 32. Nonlinear impact monitoring: 2-dimensional sampling Giacomo Tommei; 33. Searching for gravity assisted trajectories to accessible near-Earth asteroids Stefan Berinde; 34. KLENOT - Near Earth and other unusual objects observations Michal Kocer, Jana Tichá and M. Tichy; 35. Transport of comets to the Inner Solar System Hans Rickman; 36. Nongravitational Accelerations on Comets Steven R. Chesley and Donald K. Yeomans; 37. Interaction of planetesimals with the giant planets and the shaping of the trans-Neptunian belt Harold F. Levison and Alessandro Morbidelli; 38. Transport of comets to the outer p

  9. 49 CFR 173.197 - Regulated medical waste.

    Science.gov (United States)

    2010-10-01

    ... constructed of metal, rigid plastic, or fiberglass fitted with a lid to prevent leakage during transport. (iii... minimize the risk of breakage. (3) Bulk outer packaging (BOP). A BOP is authorized as an outer packaging... constructed of metal or fiberglass and have a capacity of at least 3.5 cubic meters (123.6 cubic feet) and not...

  10. Page 1 Scalable concurrent computing 197 [M] [N] . . . [M] " memory ...

    Indian Academy of Sciences (India)

    Each instruction stream operates on multiple units of data such as a vector or array instead of on a single operand. A single control unit coordinates the operation of the multiple processors. Synchronous computers using global clocks are quite special purpose and rather restrictive in their model of concurrent computation.

  11. Page 1 Optically selective coatings - 197 transparent layer between ...

    Indian Academy of Sciences (India)

    films play a major role in the performance of various solar selective black metal coatings. Grading of optical constants is possible only by varying the composition of a film consisting of a mixture of two or more components of different optical constants. Alternatively, the grading is obtained by depositing ultrathin (a fraction of ...

  12. 46 CFR 197.328 - PVHO-General.

    Science.gov (United States)

    2010-10-01

    ..., contracted for or purchased after February 1, 1979, must be built and stamped in accordance with ASME PVHO-1... in accordance with section VIII, division 1 or division 2 of the ASME Code; and— (i) Have the plans... of welded joints required by section VIII, division 1 or division 2, as appropriate, of the ASME Code...

  13. 197 impact of project funding on the implementation of leemp ...

    African Journals Online (AJOL)

    2007-10-31

    Oct 31, 2007 ... Abstract. Project success depends on good planning and implementation strategy. The implementation process could make a project succeed, fail or even abandoned midstream. Information gathered from LEEMP in Imo State indicates that out of the 258 development projects embarked upon by LEEMP, ...

  14. 38 CFR 21.197 - “Interrupted” status.

    Science.gov (United States)

    2010-07-01

    ... evidence indicates the veteran will be able to resume the program at some future date, which can be... case in independent living program status; or (v) A case in employment services status. (2...

  15. Ethiopian Journal of Environmental Studies & Management 7(2): 197

    African Journals Online (AJOL)

    Osondu

    2013-12-16

    Dec 16, 2013 ... in Delta State, Nigeria Agricultura. Tropica et Subtropica, 42(2): 90-97. National Population Commission (NPC). (2006). National Population Commission. Report, pp. 3. Available at http://www.qtsnigeria.com. Ogunsanya, A.A. (1987). Rural Accessibility. Problem and Human Resources. Development: Case ...

  16. All projects related to | Page 197 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2017-01-26

    The flood-prone Poyang Lake is the largest freshwater lake in China, accounting for 9% of the drainage area of the Yangtze River Basin. End Date: January 26, 2017. Topic: WATER MANAGEMENT, AGRICULTURE, POLICY MAKING, Climate change, ADAPTATION. Region: China, Canada. Program: Climate Change.

  17. 27 CFR 24.197 - Production by fermentation.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Production by fermentation... fermentation. In producing special natural wine by fermentation, flavoring materials may be added before or during fermentation. Special natural wine produced by fermentation may be ameliorated in the same manner...

  18. Southern Forests: a Journal of Forest Science - Vol 197 (2003)

    African Journals Online (AJOL)

    Genetic improvement of Eucalyptus grandis using breeding seedling orchards and the multiple population breeding strategy in Zimbabwe: scientific paper · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. WJ Gapare, RD Barnes, DP Gwaze, BI Nyoka, 13-20 ...

  19. 46 CFR 197.565 - Notifying personnel of benzene hazards.

    Science.gov (United States)

    2010-10-01

    ..., control measures such as personal protection equipment, and first aid procedures for benzene. A copy of...) Material safety data sheet. A material safety data sheet (MSDS) addressing benzene must be made available... personal protective equipment in emergency situations; (vi) The meaning of a regulated area and the means...

  20. 197. Development of Chitosan Nanoparticles for Gene Delivery System

    National Research Council Canada - National Science Library

    Yang, Zhi-Hong; Sato, Toshinori; Koyama, Yoshiyuki

    2006-01-01

    .... In this study, microinjection method was employed to investigate it. The effect of pDNA concentration, post-injection time, cell cycle and stoichiometry of pDNA/chitosan complexes on expression efficiency were investigated...

  1. Publications | Page 197 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  2. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  3. 197 Diagnostic et caractérisation microbiologique des procédés ...

    African Journals Online (AJOL)

    HP

    transformed into drink, concentrate, powder, etc. by small and medium enterprises (SMEs) and Groupings of ... Conventional techniques of food microbiology were used to research each seed according standard ... pour causes de fermentation des boissons et / ou présence de moisissures sur les produits semi solides.

  4. 26 CFR 1.167(a)-14 - Treatment of certain intangible property excluded from section 197.

    Science.gov (United States)

    2010-04-01

    ... include certain computer software and certain other separately acquired rights, such as rights to receive tangible property or services, patents and copyrights, certain mortgage servicing rights, and rights of... subject to the allowance for depreciation under section 167(a). (b) Computer software—(1) In general. The...

  5. Ma et al., Afr J Tradit Complement Altern Med. (2016) 13(3):197-202 ...

    African Journals Online (AJOL)

    processing methods, utilizes sulfur dioxide generated during sulfur combustion to bleach herbs and control microorganisms, parasites and ... voucher specimens were deposited in the Technology Development Division, School of Chinese Medicine, Hong Kong Baptist ..... This compound can cause skin and eye irritation ...

  6. April 2001 EAST AFRICAN MEDICAL JOURNAL 197 East Afiican ...

    African Journals Online (AJOL)

    2001-04-04

    Apr 4, 2001 ... central nervous system, in this case the spinal cord, has frequently been secondary to TB in the lungs(15). Our series identified three patients (1 1.1%) of the 27 with full clinical data having pulmonary TB. Complicated spinal TB is recognised when there is spinal deformity, paresis or paralysis. All the 27 ...

  7. Statistical Abstract of Higher Education in North Carolina, 1996-97. Research Report 1-97.

    Science.gov (United States)

    Balfour, Linda F., Comp.

    This statistical abstract presents 84 tables and 17 graphs that profile the current status of public and private higher education in North Carolina. Data were gathered from a survey conducted in the summer and fall of 1996. The tables and graphs contain both current and trend data on enrollment (including headcount, full-time equivalent, and…

  8. La prévalence des maux de dos chez 197 femmes enceintes ...

    African Journals Online (AJOL)

    Les maux de dos sont des douleurs fréquentes durant la grossesse. En effet, ils se présentent chez environ 56 % des femmes. Souvent considérée comme faisant partie des « petits maux de la grossesse », la lombalgie apparaît comme un symptôme mineur pour la majorité des cas. Cette étude prospective a déterminé la ...

  9. 197 Diagnostic et caractérisation microbiologique des procédés ...

    African Journals Online (AJOL)

    HP

    Tous ces problèmes font que ces produits finis ne sont pas compétitifs sur les marchés régionaux et ... Pour l'analyse microbiologique, des échantillons sont prélevés au niveau de toutes les étapes du procédé de ..... fait de ces traitements, le risque sanitaire d'origine microbiologique lié à la consommation des produits.

  10. Page 1 Bull. Mater. Sci, Vol. 14, No. 2, April 1991, pp. 195-197. (C ...

    Indian Academy of Sciences (India)

    role in high temperature superconductivity (Siegrist et al 1987). The role of oxygen in determining the structural symmetry and its correlation with T. has been reported earlier (Jorgensen et al 1987) but the specific role and relative importance of the. Cul-O planes and the Cu-O chains are more controversial. The asymmetric ...

  11. Minimal intervention dentistry--a review. FDI Commission Project 1-97.

    Science.gov (United States)

    Tyas, M J; Anusavice, K J; Frencken, J E; Mount, G J

    2000-02-01

    The concept of minimal intervention dentistry has evolved as a consequence of our increased understanding of the caries process and the development of adhesive restorative materials. It is now recognised that demineralised but noncavitated enamel and dentine can be 'healed', and that the surgical approach to the treatment of a caries lesion along with 'extension for prevention' as proposed by G V Black is no longer tenable. This paper gives an overview of the concepts of minimal intervention dentistry, describes suggested techniques for a minimally invasive operative approach, and reviews clinical studies which have been carried out in this area.

  12. Page 1 So-parameter of polymers 197 molecules in a polymer can ...

    Indian Academy of Sciences (India)

    polystyrene, nylon 6 and teflon at various temperatures from 173 K to 383 K has been calculated using experimental data on 6 from literature (Urzendowski and Guenther. 1970). A plot of So as a function of temperature for these polymers is shown in figure 1. 3. Isochoric temperature coefficient of heat capacity and bulk ...

  13. A Survey of Cognition in Handicapped Children. Technical Report No. 197.

    Science.gov (United States)

    Suppes, Patrick

    Reviewed was research on the development of the cognitive skills of language, concept formation, and arithmetic in children handicapped by blindness, mental retardation, or deafness. Research on the language skills of the blind included a rejection of sensory compensation, while research on language in the retarded was seen to focus on linguistic…

  14. La novela fantástica española (1940-197

    Directory of Open Access Journals (Sweden)

    Pilar de la PUENTE SAMANIEGO

    2009-11-01

    Full Text Available ¿Qué es lo fantástico? Los criterios de definición no son coincidentes. Para Todorov se forma por una parte de lo real y por otra parte de lo imaginario. Lo fantástico es la vacilación experimentada por un ser que no conoce más que las leyes naturales, frente a un acontecimiento aparentemente sobrenatural; son congénitos a lo fantástico «el tiempo de una incertidumbre». Lo fantástico se define por la percepción antigua que el propio lector tiene de los acontecimientos relatados; se caracteriza por una instrusión del misterio en el marco de la vida real, hombres que, como nosotros, habitan el mundo real, pero que de pronto se encuentran ante lo inexplicable.

  15. 40 CFR 197.12 - What definitions apply in subpart B?

    Science.gov (United States)

    2010-07-01

    ... land surface and in a saturated zone. Human intrusion means breaching of any portion of the Yucca Mountain disposal system, within the repository footprint, by any human activity. Passive institutional...) Than five kilometers from the repository footprint in any other direction; and (2) The subsurface...

  16. 77 FR 197 - Federal Acquisition Regulation; Public Access to the Federal Awardee Performance and Integrity...

    Science.gov (United States)

    2012-01-03

    ... will soon be able to evaluate the business ethics and quality of potential contractor clients... public the data in FAPIIS will benefit contractors with records of business integrity and performance... and authorized users performing business on behalf of the Government will be able to view the...

  17. Fission anisotropy of 197 Tl produced in fusion reactions in the ...

    Indian Academy of Sciences (India)

    It was shown that in the framework of the modified statistical model, by choosing appropriate values for the temperature coefficient of the effective potential, , and scaling factor of the fission-barrier height, s, one can satisfactorily reproduce the above-mentioned experimental data. It was also shown that the appropriate ...

  18. : tous les projets | Page 197 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Date de début : 20 juin 2012. End Date: 20 mars 2013. Sujet: NUTRITION, FOOD POLICY, FOOD RESOURCES, DISADVANTAGED GROUPS, HEALTH POLICY, Food security, DISEASES, LOW INCOME GROUPS. Région: Pakistan, Central Asia, Far East Asia, South Asia. Programme: Alimentation, environnement et santé.

  19. Renal defects and limb deficiencies in 197 infants: is it possible to define the "acrorenal syndrome"?

    NARCIS (Netherlands)

    Kroes, Hester Y.; Olney, Richard S.; Rosano, Aldo; Liu, Yecai; Castilla, Eduardo E.; Cocchi, Guido; de Vigan, Catherine; Martínez-Frías, María L.; Mastroiacovo, Pierpaolo; Merlob, Paul; Mutchinick, Osvaldo; Ritvanen, Annukka; Stoll, Claude; van Essen, Anthonie J.; Cobben, Jan Maarten; Cornel, Martina C.

    2004-01-01

    Dieker and Opitz in 1969 described the simultaneous occurrence of limb deficiencies (LDs) and renal anomalies (RAs) in three patients. Curran and Curran introduced in 1972 the term "acrorenal syndrome." Since then, the term "acrorenal syndrome" is used occasionally, but a well-circumscribed

  20. Yeast Interacting Proteins Database: YHR197W, YLR423C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available protein responsible for phagophore assembly site organization; regulatory subunit of an autophagy-specific...protein responsible for phagophore assembly site organization; regulatory subunit of an autophagy-specific

  1. Page 1 Removal of Sediments from mud bank region 197 762d ...

    Indian Academy of Sciences (India)

    is evident in both the seasons. Grain size does not clearly reflect the seasonal changes of process-related factors influencing the granulometric variation. Hence hydro- dynamics of the transport and deposition were evaluated based on the results obtained from the detailed textural analysis of the post-mud bank sediments.

  2. Ce que nous faisons | Page 197 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Région(s) Mondial. En 2009, le CRDI et l'Agence canadienne de développement international (qui fait aujourd'hui partie d'Affaires étrangères, Commerce et Développement Canada) ont lancé le Fonds canadien de recherche sur la sécurité alimentaire internationale (FCRSAI), un fonds quinquennal doté de 62 millions ...

  3. 14 CFR Sec. 19-7 - Passenger origin-destination survey.

    Science.gov (United States)

    2010-01-01

    ... statement describing the process the carrier proposed to employ in examining, selecting and editing the data from reportable flight coupons for the O&D Survey, as well as a flow chart diagramming the proposed... quantity and quality controls on the flow of all lifted flight coupons through their system processes to...

  4. Renal defects and limb deficiencies in 197 infants : Is it possible to define the "acrorenal syndrome"?

    NARCIS (Netherlands)

    Kroes, HY; Olney, RS; Rosano, A; Liu, YC; Castilla, EE; Cocchi, G; De Vigan, C; Martinez-Frias, ML; Mastroiacovo, P; Merlob, P; Mutchinick, O; Ritvanen, A; Stoll, C; van Essen, AJ; Cobben, JM; Cornel, MC

    2004-01-01

    Dieker and Opitz in 1969 described the simultaneous occurrence of limb deficiencies (LDs) and renal anomalies (RAs) in three patients. Curran and Curran introduced in 1972 the term "acrorenal syndrome." Since then, the term "acrorenal syndrome" is used occasionally, but a well-circumscribed

  5. S. Afr. J. Anim. Sci. I , I 77- 182 ( 197I ) BODY COMPOSITION: ITS ...

    African Journals Online (AJOL)

    confirmed by those of Moulton (1923), in studies on body composition at Missouri Experimental Station. Further progress in the understanding of the basic re- lationship between the chemical components of the body resulted fronr Reid, Wellington & Dunn's (1955) ob- servation that protein and ash form a remarkably con-.

  6. FCJ-197 Entanglements with Media and Technologies in the Occupy Movement

    Directory of Open Access Journals (Sweden)

    Megan Boler

    2015-06-01

    Full Text Available This essay explores the paradox of activists using corporate-owned platforms—the ‘master’s tools’ (Lorde, 1984—in the context of the Occupy Wall Street movement. Grounded in findings from interviews with 30 women activists from eight North American Occupy sites, this essay reveals the frictions that result from the entangled paradox between philosophies embedded within technologies and activists’ philosophies. We document entanglements between corporate platforms and radical democratic ideals, and subsequent frictions between activists’ ideals and more pragmatic, DIY practices. We also investigate frictions between aspirations of openness, and the realities of surveillance and infiltration by the police state. We examine entanglements through the theoretical lenses of ‘connective labor’ (Boler et al, 2014, ‘veillance’ (Mann, 2004, and the ‘master’s tools’ (Lorde, 1984, and lay the groundwork for ‘queering the binary of individuals and groups’ (Barad, 2012 and recognising the non-linear, dynamic relations of social movements.

  7. Bull.Chem.Soc.Ethiop. 19%,7['l) as-41.

    African Journals Online (AJOL)

    chloroacetic, oxalic, picric and nitric acids in ethanol solutions, and of the first three acids in benzene solutions, on the reaction rate were examined at 25°. Reactions were carried out under pseudo-first-order conditions and it was observed that the reaction showed no marked variation in the rate of decomposition of 1-aryi-3 ...

  8. Creative Accounting Model for Increasing Banking Industries’ Competitive Advantage in Indonesia (P.197-207

    Directory of Open Access Journals (Sweden)

    Supriyati Supriyati

    2017-01-01

    Full Text Available Bank Indonesia demands that the national banks should improve their transparency of financial condition and performance for public in line with the development of their products and activities. Furthermore, the banks’ financial statements of Bank Indonesia have become the basis for determining the status of their soundness. In fact, they tend to practice earnings management in order that they can meet the criteria required by Bank Indonesia. For internal purposes, the initiative of earning management has a positive impact on the performance of management. However, for the users of financial statements, it may differ, for example for the value of company, length of time the financial audit, and other aspects of tax evasion by the banks. This study tries to find out 1 the effect of GCG on Earnings Management, 2 the effect of earning management on Company value, the Audit Report Lag, and Taxation, and 3 the effect of Audit Report Lag on Corporate Value and Taxation. This is a quantitative research with the data collected from the bank financial statements, GCG implementation report, and the banks’ annual reports of 2003-2013. There were 41 banks taken using purposive sampling, as listed on the Indonesia Stock Exchange. The results showed that the implementation of GCG affects the occurrence of earning management. Accounting policy flexibility through earning management is expected to affect the length of the audit process and the accuracy of the financial statements presentation on public side. This research is expected to provide managerial implications in order to consider the possibility of earnings management practices in the banking industry. In the long term, earning management is expected to improve the banks’ competitiveness through an increase in the value of the company. Explicitly, earning management also affects the tax avoidance; therefore, the banks intend to pay lower taxes without breaking the existing legislation Taxation Provisions.Keywords: Good Corporate Governance (GCG, earning management, Audit Report lag, Company value, and tax avoidance

  9. SU-E-J-197: Investigation of Microsoft Kinect 2.0 Depth Resolution for Patient Motion Tracking

    Energy Technology Data Exchange (ETDEWEB)

    Silverstein, E; Snyder, M [Wayne State University, Detroit, MI (United States)

    2015-06-15

    Purpose: Investigate the use of the Kinect 2.0 for patient motion tracking during radiotherapy by studying spatial and depth resolution capabilities. Methods: Using code written in C#, depth map data was abstracted from the Kinect to create an initial depth map template indicative of the initial position of an object to be compared to the depth map of the object over time. To test this process, simple setup was created in which two objects were imaged: a 40 cm × 40 cm board covered in non reflective material and a 15 cm × 26 cm textbook with a slightly reflective, glossy cover. Each object, imaged and measured separately, was placed on a movable platform with object to camera distance measured. The object was then moved a specified amount to ascertain whether the Kinect’s depth camera would visualize the difference in position of the object. Results: Initial investigations have shown the Kinect depth resolution is dependent on the object to camera distance. Measurements indicate that movements as small as 1 mm can be visualized for objects as close as 50 cm away. This depth resolution decreases linearly with object to camera distance. At 4 m, the depth resolution had decreased to observe a minimum movement of 1 cm. Conclusion: The improved resolution and advanced hardware of the Kinect 2.0 allows for increase of depth resolution over the Kinect 1.0. Although obvious that the depth resolution should decrease with increasing distance from an object given the decrease in number of pixels representing said object, the depth resolution at large distances indicates its usefulness in a clinical setting.

  10. A phase I dose-escalation study of Tivantinib (ARQ 197) in adult patients with metastatic solid tumors.

    Science.gov (United States)

    Rosen, Lee S; Senzer, Neil; Mekhail, Tarek; Ganapathi, Ram; Chai, Feng; Savage, Ronald E; Waghorne, Carol; Abbadessa, Giovanni; Schwartz, Brian; Dreicer, Robert

    2011-12-15

    Tivantinib, an oral, non-ATP competitive, selective c-MET inhibitor, exhibited antitumor activity in preclinical models. This open-label, phase I, dose-escalation study evaluated the safety, tolerability, pharmacokinetics, and pharmacodynamics of tivantinib in patients with advanced or metastatic solid tumors refractory to standard therapy. Thirteen dose levels of tivantinib ranging from 10 to 360 mg twice a day were administered to patient cohorts in 21-day cycles (14 days on/7 days off); three active pharmaceutical ingredient forms of tivantinib (amorphous, crystalline A, and crystalline B) were also investigated. Treatment was continued until the occurrence of unacceptable toxicity, tumor progression, patient withdrawal, or death. A total of 79 patients with advanced solid tumors were enrolled. A maximum tolerated dose was not determined. Tivantinib was well tolerated, with mild to moderate toxicities. Two patients discontinued the study drug due to treatment-emergent adverse events. Dose-limiting grade of 3 or more toxicities including leukopenia, neutropenia, thrombocytopenia, vomiting, and dehydration, were observed in 2 patients treated with tivantinib 360 mg twice a day. The rate of absorption of tivantinib peaked approximately 2 to 4 hours after initial dosing, followed by a linear decrease in plasma concentrations. Increases in tivantinib exposure were not dose proportional. There was significant interpatient pharmacokinetic variability; however the clinical safety of tivantinib seemed unaffected. Three patients (3.8%) achieved a partial response and 40 patients (50.6%) maintained stable disease for a median of 19.9 weeks. Tivantinib 360 mg twice a day was well tolerated in patients with refractory advanced solid tumors. The results of this trial warrant further clinical investigation. Clin Cancer Res; 17(24); 7754-64. ©2011 AACR. ©2011 AACR.

  11. Tivantinib (ARQ-197) exhibits anti-tumor activity with down-regulation of FAK in oral squamous cell carcinoma.

    Science.gov (United States)

    Xi, Wei-Hong; Yang, Li-Yun; Cao, Zhong-Yi; Qian, Yong

    2015-02-20

    Oral squamous cell carcinoma (OSCC) is one of the most common cancers worldwide and the 5 years survival rate of the patients is about 60% in the USA, due to acquired chemotherapeutic resistance and metastasis of the disease. In this study, we found that tivantinib, a selective MET inhibitor, suppresses OCSS cell proliferation and colony formation, however, anti-tumor activities induced by tivantinib are independent of the inhibition of MET signaling pathway. In addition, tivantinib cause G2/M cell cycle arrest and caspases-dependent apoptosis in OSCC cell lines. We also found that tivantinib dose-dependently suppressed the activation and expression of FAK. In all, these data suggested that tivantinib may be developed as a chemotherapeutic agent to effectively treat certain cancers including OSCC. Copyright © 2015 Elsevier Inc. All rights reserved.

  12. Evaluation of the pharmacokinetic drug interaction potential of tivantinib (ARQ 197) using cocktail probes in patients with advanced solid tumours.

    Science.gov (United States)

    Tachibana, Masaya; Papadopoulos, Kyriakos P; Strickler, John H; Puzanov, Igor; Gajee, Roohi; Wang, Yibin; Zahir, Hamim

    2017-09-02

    This phase 1, open-label, crossover study sought to evaluate drug-drug interactions between tivantinib and cytochrome P450 (CYP) substrates and tivantinib and P-glycoprotein. The effect of tivantinib doses on the pharmacokinetics of the probe drugs for CYP1A2 (caffeine), CYP2C9 (warfarin), CYP2C19 (omeprazole), and CYP3A4 (midazolam), and for P-glycoprotein (digoxin) was investigated in 28 patients with advanced cancer using a cocktail probe approach. Patients received single doses of probe drugs alone and after 5 days of treatment with tivantinib 360 mg twice daily. The ratios of geometric least squares mean (90% confidence interval) for the area under the concentration-time curve from time zero to the last quantifiable concentration in the presence/absence of tivantinib were 0.97 (0.89-1.05) for caffeine; 0.88 (0.76-1.02) for S-warfarin; 0.89 (0.60-1.31) for omeprazole; 0.83 (0.67-1.02) for midazolam; and 0.69 (0.51-0.94) for digoxin. Similar effects were observed for maximum plasma concentrations; the ratio for digoxin in the presence/absence of tivantinib was 0.75 (0.60-0.95). The data suggest that tivantinib 360 mg twice daily has either a minimal or no effect on the pharmacokinetics of probe drugs for CYP1A2, CYP2C9, CYP2C19, and CYP3A4 substrates, and decreases the systemic exposure of P-glycoprotein substrates when administered with tivantinib. This article is protected by copyright. All rights reserved.

  13. A phase 2 multicenter study of tivantinib (ARQ 197) monotherapy in patients with relapsed or refractory germ cell tumors.

    Science.gov (United States)

    Feldman, Darren R; Einhorn, Lawrence H; Quinn, David I; Loriot, Yohann; Joffe, Johnathan K; Vaughn, David J; Fléchon, Aude; Hajdenberg, Julio; Halim, Abdel-Baset; Zahir, Hamim; Motzer, Robert J

    2013-08-01

    Tivantinib is a selective, small-molecule inhibitor of the MET receptor tyrosine kinase. Preclinical and phase 1 data suggested a possible role for MET in the pathophysiology of germ cell tumors (GCTs) and a potential clinical benefit from tivantinib in patients with these tumors. Men (≥ 16 years) with relapsed or refractory, histologically confirmed, non-central nervous system GCTs received oral tivantinib 360 mg twice daily in 28-day cycles until progressive disease or unacceptable toxicity. The primary endpoint was objective response rate in the first 4 cycles, with study termination for <2 responses among the first 21 patients. Secondary endpoints included 12-week progression-free survival (PFS), overall survival (OS), and safety. Twenty-seven patients were enrolled in 9 months (median age, 32 years). Most patients had tumors with nonseminoma histology (n = 25), and primary tumor sites were testis (n = 24) and mediastinum (n = 3). Among 25 evaluable patients, no objective responses were observed; accrual was halted when the 21st patient became evaluable. Best response was stable disease (n = 5). Median PFS was 1 month, the 12-week PFS rate was 21 %, and median OS was 6 months. Grade 3 or 4 adverse events considered related to study drug included grade 3 pneumonia and grade 3 syncope (n = 1, each). Tivantinib was well tolerated but did not demonstrate single-agent activity in patients with relapsed/refractory GCTs. Rapid accrual to this phase 2 trial was achieved in this rare patient population through multicenter collaboration.

  14. SU-F-J-197: A Novel Intra-Beam Range Detection and Adaptation Strategy for Particle Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Chen, M; Jiang, S; Shao, Y; Lu, W [UT Southwestern Medical Center, Dallas, TX (United States)

    2016-06-15

    Purpose: In-vivo range detection/verification is crucial in particle therapy for effective and safe delivery. The state-of-art techniques are not sufficient for in-vivo on-line range verification due to conflicts among patient dose, signal statistics and imaging time. We propose a novel intra-beam range detection and adaptation strategy for particle therapy. Methods: This strategy uses the planned mid-range spots as probing beams without adding extra radiation to patients. Such choice of probing beams ensures the Bragg peaks to remain inside the tumor even with significant range variation from the plan. It offers sufficient signal statistics for in-beam positron emission tomography (PET) due to high positron activity of therapeutic dose. The probing beam signal can be acquired and reconstructed using in-beam PET that allows for delineation of the Bragg peaks and detection of range shift with ease of detection enabled by single-layered spots. If the detected range shift is within a pre-defined tolerance, the remaining spots will be delivered as the original plan. Otherwise, a fast re-optimization using range-shifted beamlets and accounting for the probing beam dose is applied to consider the tradeoffs posed by the online anatomy. Simulated planning and delivery studies were used to demonstrate the effectiveness of the proposed techniques. Results: Simulations with online range variations due to shifts of various foreign objects into the beam path showed successful delineation of the Bragg peaks as a result of delivering probing beams. Without on-line delivery adaptation, dose distribution was significantly distorted. In contrast, delivery adaptation incorporating detected range shift recovered well the planned dose. Conclusion: The proposed intra-beam range detection and adaptation utilizing the planned mid-range spots as probing beams, which illuminate the beam range with strong and accurate PET signals, is a safe, practical, yet effective approach to address range uncertainty issues in particle therapy.

  15. Preparation of Burkholderia pseudomallei Polysaccharide-CRM197 Conjugate, a Potential Vaccine Candidate for Glanders and Melioidosis

    Science.gov (United States)

    2005-10-01

    Glanders Glanders is an infectious disease that is caused by the bacterium Burkholderia mallei The types of infection include localized, pus- forming...Glanders Burkholderia mallei and B. pseudomallei are the causative agents for glanders and melioidosis, respectively Both of these organisms have... virulence factor : – Dave DeShazer prepared a capsule mutant (DD3008) and demonstrated that the mouse aerosol LD50 was at least 103 times greater than the

  16. 40 CFR 197.36 - Are there limits on what DOE must consider in the performance assessments?

    Science.gov (United States)

    2010-07-01

    ... effects of climate change. The climate change analysis may be limited to the effects of increased water flow through the repository as a result of climate change, and the resulting transport and release of radionuclides to the accessible environment. The nature and degree of climate change may be represented by...

  17. 32 CFR Appendix A to Part 197 - Explanation of Freedom of Information Act (5 U.S.C. 552) Exemptions

    Science.gov (United States)

    2010-07-01

    ... competitive harm to the company; (b)(5) Applies to inter- and intra-Agency memoranda that are deliberative in... information; (c) Intelligence activities (including special activities), intelligence sources or methods, or...

  18. Neutron capture measurements on 62Ni, 63Ni and 197Au and their relevance for stellar nucleosynthesis

    CERN Document Server

    Lederer, Claudia

    Neutron capture reactions in stars are responsible for forming about 99% of the elemental abundances heavier than Fe. Two processes contribute about equally to the overall abundance pattern: the slow neutron capture process (s process) where neutron densities are small and therefore radioactive decay is generally faster than subsequent neutron capture on radionuclides, and the rapid neutron capture process (r process) which takes place in environments of high neutron densities, driving the reaction path towards the neutron rich side. The key nuclear physics input for s process studies are stellar neutron capture cross sections, called MACS (Maxwellian-averaged cross section). In the course of this work, dierent reactions relevant to s process nucleosynthesis have been studied. To improve and check existing information, neutron capture cross sections of most stable Fe and Ni isotopes were measured via the time-of-flight technique at the n TOF facility at CERN. This campaign was triggered by a work of Sneden et...

  19. Page 1 i. Bull. Mater. Sci., Vol. 10, No. 3, May 1988, pp. 187-197. (C ...

    Indian Academy of Sciences (India)

    Electrolytic growth and properties of single crystals of ammonium hydrogen tartrate. C C DESAI. Department of Physics, Sardar Patel University, Vallabh Vidyanagar 388 120, India. MS received 23 September 1987; revised 14 January 1988. Abstract. The growth of orthorhombic disphenoidal and long needle habit single ...

  20. Tivantinib (ARQ-197) exhibits anti-tumor activity with down-regulation of FAK in oral squamous cell carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Xi, Wei-Hong [Department of Oral and Maxillofacial Surgery, First Affiliated Hospital, Nanchang University, Nanchang 330006 (China); Yang, Li-Yun [Department of Blood Transfusion, First Affiliated Hospital, Nanchang University, Nanchang 330006 (China); Cao, Zhong-Yi, E-mail: m18070383032@163.com [Department of Oral and Maxillofacial Surgery, First Affiliated Hospital, Nanchang University, Nanchang 330006 (China); Qian, Yong, E-mail: yfykqkqy@163.com [Department of Oral and Maxillofacial Surgery, First Affiliated Hospital, Nanchang University, Nanchang 330006 (China)

    2015-02-20

    Oral squamous cell carcinoma (OSCC) is one of the most common cancers worldwide and the 5 years survival rate of the patients is about 60% in the USA, due to acquired chemotherapeutic resistance and metastasis of the disease. In this study, we found that tivantinib, a selective MET inhibitor, suppresses OCSS cell proliferation and colony formation, however, anti-tumor activities induced by tivantinib are independent of the inhibition of MET signaling pathway. In addition, tivantinib cause G2/M cell cycle arrest and caspases-dependent apoptosis in OSCC cell lines. We also found that tivantinib dose-dependently suppressed the activation and expression of FAK. In all, these data suggested that tivantinib may be developed as a chemotherapeutic agent to effectively treat certain cancers including OSCC. - Highlights: • Tivantinib suppresses OSCC cell growth independent of the inhibition of HGF/MET signaling pathway. • Tivantinib blocks cell cycle and induces caspases-mediated apoptosis. • Tivantinib elicits its anti-tumor activity with the inhibition of FAK signaling pathway.

  1. Results From a Pressure Sensitive Paint Test Conducted at the National Transonic Facility on Test 197: The Common Research Model

    Science.gov (United States)

    Watkins, A. Neal; Lipford, William E.; Leighty, Bradley D.; Goodman, Kyle Z.; Goad, William K.; Goad, Linda R.

    2011-01-01

    This report will serve to present results of a test of the pressure sensitive paint (PSP) technique on the Common Research Model (CRM). This test was conducted at the National Transonic Facility (NTF) at NASA Langley Research Center. PSP data was collected on several surfaces with the tunnel operating in both cryogenic mode and standard air mode. This report will also outline lessons learned from the test as well as possible approaches to challenges faced in the test that can be applied to later entries.

  2. Safety and immunogenicity of an investigational quadrivalent meningococcal CRM(197) conjugate vaccine, MenACWY-CRM, compared with licensed vaccines in adults in Latin America.

    Science.gov (United States)

    Stamboulian, D; Lopardo, G; Lopez, P; Cortes-Barbosa, C; Valencia, A; Bedell, L; Karsten, A; Dull, P M

    2010-10-01

    This study compared the investigational quadrivalent meningococcal CRM₁₉₇ conjugate vaccine, MenACWY-CRM, with licensed quadrivalent polysaccharide (MPSV4) and conjugate (MenACWY-D) meningococcal vaccines. In this phase III multicenter study, 2505 adults (aged 19-55 years) were randomized to receive either MenACWY-CRM or MenACWY-D, and 326 adults (aged 56-65 years) were randomized to receive either MenACWY-CRM or MPSV4. Sera obtained pre-vaccination and at 1-month post-vaccination were tested for serogroup-specific serum bactericidal activity using human complement (hSBA) for immunogenicity non-inferiority and superiority analyses. The vaccines in all groups were well tolerated. In the 19-55 years age group, post-vaccination geometric mean titers (GMTs) were consistently higher for MenACWY-CRM than for MenACWY-D for all four serogroups. MenACWY-CRM was non-inferior to MenACWY-D for all serogroups, and superior for serogroup Y. In the 56-65 years age group, post-vaccination GMTs were 1.2- to 5.4-fold higher for MenACWY-CRM than for MPSV4 for the four serogroups. MenACWY-CRM is well tolerated and immunogenic in adults aged 19-65 years, with at least non-inferior immunogenicity compared with the currently licensed meningococcal vaccines. Copyright © 2010 International Society for Infectious Diseases. Published by Elsevier Ltd. All rights reserved.

  3. Study of hadronic event shape in flavour tagged events in $e^{+} e^{-}$ annihilation at $<\\sqrt{S}>$ = 197 GeV

    CERN Document Server

    Achard, P.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Anderhub, H.; Andreev, V.P.; Anselmo, F.; Arefiev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Bajo, A.; Baksay, G.; Baksay, L.; Baldew, S.V.; Banerjee, S.; Banerjee, Sw.; Barczyk, A.; Barillere, R.; Bartalini, P.; Basile, M.; Batalova, N.; Battiston, R.; Bay, A.; Becker, U.; Behner, F.; Bellucci, L.; Berbeco, R.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Biasini, M.; Biglietti, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bottai, S.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brochu, F.; Burger, J.D.; Burger, W.J.; Cai, X.D.; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.; Casaus, J.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Chamizo, M.; Chang, Y.H.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Clare, I.; Clare, R.; Coignet, G.; Colino, N.; Costantini, S.; de la Cruz, B.; Cucciarelli, S.; de Asmundis, R.; Deglon, P.; Debreczeni, J.; Degre, A.; Dehmelt, K.; Deiters, K.; della Volpe, D.; Delmeire, E.; Denes, P.; DeNotaristefani, F.; De Salvo, A.; Diemoz, M.; Dierckxsens, M.; Dionisi, C.; Dittmar, M.; Doria, A.; Dova, M.T.; Duchesneau, D.; Duda, M.; Echenard, B.; Eline, A.; El Hage, A.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Extermann, P.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisher, W.; Forconi, G.; Freudenreich, K.; Furetta, C.; Galaktionov, Yu.; Ganguli, S.N.; Garcia-Abia, P.; Gataullin, M.; Gentile, S.; Giagu, S.; Gong, Z.F.; Grenier, G.; Grimm, O.; Gruenewald, M.W.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hatzifotiadou, D.; Hebbeker, T.; Herve, A.; Hirschfelder, J.; Hofer, H.; Hohlmann, M.; Holzner, G.; Hou, S.R.; Jin, B.N.; Jindal, P.; Jones, L.W.; de Jong, P.; Josa-Mutuberria, I.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, J.K.; Kirkby, J.; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopal, M.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Kruger, A.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Le Goff, J.M.; Leiste, R.; Levtchenko, M.; Levtchenko, P.; Li, C.; Likhoded, S.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Luci, C.; Luminari, L.; Lustermann, W.; Ma, W.G.; Malgeri, L.; Malinin, A.; Mana, C.; Mans, J.; Martin, J.P.; Marzano, F.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Muanza, G.S.; Muijs, A.J.M.; Musy, M.; Nagy, S.; Natale, S.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Nisati, A.; Novak, T.; Nowak, H.; Ofierzynski, R.; Organtini, G.; Pal, I.; Palomares, C.; Paolucci, P.; Paramatti, R.; Passaleva, G.; Patricelli, S.; Paul, T.; Pauluzzi, M.; Paus, C.; Pauss, F.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Piccolo, D.; Pierella, F.; Pieri, M.; Pioppi, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Pothier, J.; Prokofiev, D.; Rahal-Callot, G.; Rahaman, M.A.; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Ranieri, R.; Raspereza, A.; Razis, P.; Rembeczki, S.; Ren, D.; Rescigno, M.; Reucroft, S.; Riemann, S.; Riles, K.; Roe, B.P.; Romero, L.; Rosca, A.; Rosemann, C.; Rosenbleck, C.; Rosier-Lees, S.; Roth, S.; Rubio, J.A.; Ruggiero, G.; Rykaczewski, H.; Sakharov, A.; Saremi, S.; Sarkar, S.; Salicio, J.; Sanchez, E.; Schafer, C.; Schegelsky, V.; Schopper, H.; Schotanus, D.J.; Sciacca, C.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Son, D.; Souga, C.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Sushkov, S.; Suter, H.; Swain, J.D.; Szillasi, Z.; Tang, X.W.; Tarjan, P.; Tauscher, L.; Taylor, L.; Tellili, B.; Teyssier, D.; Timmermans, C.; Ting, Samuel C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Ulbricht, J.; Valente, E.; Van de Walle, R.T.; Vasquez, R.; Vesztergombi, G.; Vetlitsky, I.; Viertel, G.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobiev, I.; Vorobyov, A.A.; Wadhwa, M.; Wang, Q.; Wang, X.L.; Wang, Z.M.; Weber, M.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yamamoto, J.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Yeh, S.C.; Zalite, An.; Zalite, Yu.; Zhang, Z.P.; Zhao, J.; Zhu, G.Y.; Zhu, R.Y.; Zhuang, H.L.; Zichichi, A.; Zimmermann, B.; Zoller, M.

    2008-01-01

    Results are presented from a study of the structure of hadronic events in highenergy (e^+)(e^-) interactions detected by the L3 detector at LEP. Various event shape distributions and their moments are measured at several energy points at and above the Z-boson mass. The event avour is tagged by using the decay characteristics of b-hadrons. Measurements of distributions of event shape variables for all hadronic events, for light (u, d, s, c) and heavy (b) quark avours are compared to several QCD models with improved leading log approximation: Jetset, Herwig and Ariadne. A good description of the data is provided by the models.

  4. 32 CFR Appendix C to Part 197 - Procedures for the Department of State (DoS) Foreign Relations of the United States (FRUS) Series

    Science.gov (United States)

    2010-07-01

    .... Obtain written verification from the DoS Diplomatic Security staff of all security clearances, including... their research. (1) According to appendix F to this part, provide a staff member to supervise the... clearances in writing to the Security Manager for the office of the OSD Records Administrator. d. According...

  5. Phase II study of the c-MET inhibitor tivantinib (ARQ 197) in patients with relapsed or relapsed/refractory multiple myeloma.

    Science.gov (United States)

    Baljevic, Muhamed; Zaman, Shadia; Baladandayuthapani, Veerabhadran; Lin, Yan Heather; de Partovi, Claudia Morales; Berkova, Zuzana; Amini, Behrang; Thomas, Sheeba K; Shah, Jatin J; Weber, Donna M; Fu, Min; Cleeland, Charles S; Wang, Xin Shelley; Stellrecht, Christine M; Davis, Richard E; Gandhi, Varsha; Orlowski, Robert Z

    2017-06-01

    The hepatocyte growth factor/c-MET pathway has been implicated in the pathobiology of multiple myeloma, and c-MET inhibitors induce myeloma cell apoptosis, suggesting that they could be useful clinically. We conducted a phase II study with the c-MET inhibitor tivantinib in patients with relapsed, or relapsed and refractory myeloma whose disease had progressed after one to four prior therapies. Tivantinib, 360 mg orally per dose, was administered twice daily continuously over a 4-week treatment cycle without a cap on the number of allowed cycles, barring undue toxicities or disease progression. Primary objectives were to determine the overall response rate and the toxicities of tivantinib in this patient population. Sixteen patients were enrolled in a two-stage design. Notable grade 3 and 4 hematological adverse events were limited to neutropenia in five and four patients, respectively. Nonhematological adverse events of grade 3 or higher included hypertension (in four patients); syncope, infection, and pain (two each); and fatigue, cough, and pulmonary embolism (one each). Four of 11 evaluable patients (36%) had stable disease as their best response, while the remainder showed disease progression. Overall, tivantinib as a single agent did not show promise for unselected relapsed/refractory myeloma patients. However, the ability to achieve stable disease does suggest that combination regimens incorporating targeted inhibitors in patients with c-MET pathway activation could be of interest.

  6. Tivantinib (ARQ 197) affects the apoptotic and proliferative machinery downstream of c-MET: role of Mcl-1, Bcl-xl and Cyclin B1.

    Science.gov (United States)

    Lu, Shuai; Török, Helga-Paula; Gallmeier, Eike; Kolligs, Frank T; Rizzani, Antonia; Arena, Sabrina; Göke, Burkhard; Gerbes, Alexander L; De Toni, Enrico N

    2015-09-08

    Tivantinib, a c-MET inhibitor, is investigated as a second-line treatment of HCC. It was shown that c-MET overexpression predicts its efficacy. Therefore, a phase-3 trial of tivantinib has been initiated to recruit "c-MET-high" patients only. However, recent evidence indicates that the anticancer activity of tivantinib is not due to c-MET inhibition, suggesting that c-MET is a predictor of response to this compound rather than its actual target. By assessing the mechanisms underlying the anticancer properties of tivantinib we showed that this agent causes apoptosis and cell cycle arrest by inhibiting the anti-apoptotic molecules Mcl-1 and Bcl-xl, and by increasing Cyclin B1 expression regardless of c-MET status. However, we found that tivantinib might antagonize the antiapoptotic effects of c-MET activation since HGF enhanced the expression of Mcl-1 and Bcl-xl. In summary, we show that the activity of tivantinib is independent of c-MET and describe Mcl-1, Bcl-xl and Cyclin B1 as effectors of its antineoplastic effects in HCC cells. We suggest that the predictive effect of c-MET expression in part reflects the c-MET-driven overexpression of Mcl-1 and Bcl-xl in c-MET-high patients and that these molecules are considered as possible response predictors.

  7. Breast cancer-derived bone metastasis can be effectively reduced through specific c-MET inhibitor tivantinib (ARQ 197) and shRNA c-MET knockdown.

    Science.gov (United States)

    Previdi, Sara; Abbadessa, Giovanni; Dalò, Francesca; France, Dennis S; Broggini, Massimo

    2012-01-01

    Breast cancer exhibits a propensity to metastasize to bone, resulting in debilitating skeletal complications associated with significant morbidity and poor prognosis. The cross-talk between metastatic cancer cells and bone is critical to the development and progression of bone metastases. We have shown the involvement of the HGF/c-MET system in tumor-bone interaction contributing to human breast cancer metastasis. Therefore, disruption of HGF/c-MET signaling is a potential targeted approach to treating metastatic bone disease. In this study, we evaluated the effects of c-MET inhibition by both an oral, selective, small-molecule c-MET inhibitor, tivantinib, and a specific short hairpin RNA (shRNA) against c-MET in a mouse model of human breast cancer. Tivantinib exhibited dose-dependent antimetastatic activity in vivo, and the 120 mg/kg dose, proven to be suboptimal in reducing subcutaneous tumor growth, induced significant inhibition of metastatic growth of breast cancer cells in bone and a noteworthy reduction of tumor-induced osteolysis. shRNA-mediated c-MET silencing did not affect in vitro proliferation of bone metastatic cells, but significantly reduced their migration, and this effect was further enhanced by tivantinib. Both observations were confirmed in vivo. Indeed, more pronounced tumor growth suppression with concomitant marked decreases of lytic lesions and prolongation of survival were achieved by dual c-MET inhibition using both tivantinib and RNA interference strategies. Overall, our findings highlighted the effectiveness of c-MET inhibition in delaying the onset and progression of bone metastases and strongly suggest that targeting c-MET may have promising therapeutic value in the treatment of bone metastases from breast cancer. ©2011 AACR.

  8. Hermes III endpoint energy calculation from photonuclear activation of 197Au and 58Ni foils

    Energy Technology Data Exchange (ETDEWEB)

    Parzyck, Christopher Thomas [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2014-09-01

    A new process has been developed to characterize the endpoint energy of HERMES III on a shot-to-shot basis using standard dosimetry tools from the Sandia Radiation Measurements Laboratory. Photonuclear activation readings from nickel and gold foils are used in conjunction with calcium fluoride thermoluminescent dosimeters to derive estimated electron endpoint energies for a series of HERMES shots. The results are reasonably consistent with the expected endpoint voltages on those shots.

  9. Development of Optical Fiber Technology in Poland, International Journal of Electronics and Telecommunication, vol. 57, no 2, pp.191-197, July 2011

    CERN Document Server

    Dorosz, J

    2011-01-01

    In this paper, the authors, chairmen of the 13th Conference on Optical Fibers and Their Applications OFA2011, and editors of the conference proceedings summarize the development of optical fiber technology in Poland (during the period of 2009- 2011) on the basis of papers presented there and consecutively published in this volume. The digest is thus not full but covers the periodically presented material every 18 months during the meetings on optical fibers in Białystok-Białowie˙za and Lublin- Krasnobród. OFC systems are developed for HEP experiments and accelerators. OFC systems are also developed for virtual atomic clocks. EuCARD information presentation was organized during this meeting. Keywords— optical fibers, optical communication systems, photonic sources and detectors, photonic sensors, integrated optics, photonics applications, photonic materials.

  10. Does the use of high-heeled shoes lead to fore-foot pathology? A controlled cohort study comprising 197 women.

    Science.gov (United States)

    Borchgrevink, Grethe E; Viset, Annja T; Witsø, Eivind; Schei, Berit; Foss, Olav A

    2016-12-01

    High-heeled shoes have been suggested as a main explanation for the female dominance in foot pain and deformities. Aim of study was to test this hypothesis scientifically. Women 40-66 years were included in two groups. 95 women who had worn high-heeled shoes at work for at least 5 years were compared to 102 women who had never worn high-heeled shoes at work. The investigations were weight bearing radiographs of foot and ankle, the SEFAS questionnaire and the AOFAS Clinical Rating System. Evaluators were blinded to the group-affiliation. Radiographs showed no statistically significant differences between the two groups concerning deformities or joint disease. Foot function measured by SEFAS and AOFAS total score, were similar in the two groups. The high-heeled group had more pain and more callosities. For women aged 40-66 years wearing of high-heeled shoes had not caused foot deformation, but more foot pain and callosities. Copyright © 2015 The Authors. Published by Elsevier Ltd.. All rights reserved.

  11. 197. Trombosis masiva biauricular intervenida mediante cirugía cardíaca con circulación extracorpórea

    Directory of Open Access Journals (Sweden)

    R. Sánchez Pérez

    2012-04-01

    Conclusión: Destacamos la importancia del diagnóstico precoz y preciso de la trombosis biauricular con embolismo paradójico en aurícula izquierda a través de fosa oval, en el contexto de trombosis venosa profunda, debido a que puede beneficiarse de la cirugía cardíaca como tratamiento inicial.

  12. Production of neutron-rich isotopes by cold fragmentation in the reaction {sup 197}Au + Be at 950 A MeV

    Energy Technology Data Exchange (ETDEWEB)

    Benlliure, J.; Pereira, J. [Universidad de Santiago de Compostela (Spain)]|[Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany); Schmidt, K.H.; Cortina-Gil, D.; Enqvist, T.; Heinz, A.; Junghans, A.R. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany); Farget, F. [Institut de Physique Nucleaire, 91 - Orsay (France); Taieb, J. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany)]|[Institut de Physique Nucleaire, 91 - Orsay (France)

    1999-09-01

    The production cross sections and longitudinal-momentum distributions of very neutron-rich isotopes have been investigated in the fragmentation of a 950 A MeV {sup 179}Au beam in a beryllium target. Seven new isotopes ({sup 193}Re, {sup 194}Re, {sup 191}W, {sup 192}W, {sup 189}Ta, {sup 187}Hf and {sup 188}Hf) and the five-proton-removal channel were observed for the first time. The reaction mechanism leading to the formation of these very neutron-rich isotopes is explained in terms of the cold-fragmentation process. An analytical model describing this reaction mechanism is presented. (orig.)

  13. Projeto sala de espera: uma proposta para a educação em diabetes - doi:10.5020/18061230.2006.p197

    Directory of Open Access Journals (Sweden)

    Clarisse Mourão Melo Ponte

    2012-01-01

    Full Text Available A educação é um aspecto fundamental do cuidado do diabético. Para tal, várias estratégias têm sido buscadas. Os objetivos do presente estudo foram descrever o “Projeto Sala de Espera”, uma proposta que se baseia na utilização do período em que o paciente aguarda o atendimento individual para promover educação em diabetes; e avaliar o perfil clínico-epidemiológico dos diabéticos participantes deste projeto. Foram realizadas 20 reuniões, de março a outubro de 2006, com 350 pacientes seguidos no Ambulatório de Diabetes, do Hospital Universitário Walter Cantídio - UFC e seus acompanhantes. Desses, 76 pacientes, selecionados aleatoriamente, foram entrevistados. As reuniões ocorriam a cada sexta-feira, em 2 sessões de aproximadamente meia-hora, que eram dirigidas por equipe uma multidisciplinar, e contavam com 25 participantes em cada. Ao término, era servido um café da manhã, o qual era utilizado para a educação nutricional. Entre os entrevistados, predominaram mulheres (85,5%, com média de idade 60,4±9,1 anos e tempo médio de diagnóstico de 10,6±5,9anos. Em relação ao tratamento, dos participantes, 40,7% usavam insulina; 63,1% antidiabéticos orais e 9,2% adotavam apenas mudanças no estilo de vida. A adesão às drogas era contínua em apenas 47,8% e a maioria (67,1% não praticava atividades físicas. Quanto a dietoterapia, somente 31,5% aderiam plenamente. Mais de 75% dos avaliados eram alfabetizados e recebiam um salário mínimo ou menos. A partir das observações oriundas da prática, pode-se perceber: maior motivação dos pacientes após cada reunião, participação mais ativa nas consultas médicas e um crescente interesse sobre a sua enfermidade e o seu cuidado. Proporcionar a participação do diabético no seu tratamento, estimulando o autocuidado, é um desafio a ser alcançado por todos os serviços de saúde e que pode ser facilitada com a utilização de propostas como a descrita.

  14. Challenges for landslide hazard and risk management in ‘low-risk’ regions, Czech Republic—landslide occurrences and related costs (IPL project no. 197)

    Czech Academy of Sciences Publication Activity Database

    Klimeš, Jan; Stemberk, Jakub; Blahůt, Jan; Krejčí, V.; Krejčí, O.; Hartvich, Filip; Kycl, P.

    2017-01-01

    Roč. 14, č. 2 (2017), s. 771-780 ISSN 1612-510X R&D Projects: GA MŠk(CZ) LG15007 Institutional support: RVO:67985891 Keywords : landslide inventory * ICL/IPL activities * landslide cost * landslide risk * fatal landslides * public awareness Subject RIV: DE - Earth Magnetism, Geodesy, Geography OBOR OECD: Physical geography Impact factor: 3.657, year: 2016

  15. 40 CFR 197.15 - How must DOE take into account the changes that will occur during the period of geologic stability?

    Science.gov (United States)

    2010-07-01

    ... Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) RADIATION PROTECTION PROGRAMS PUBLIC HEALTH AND ENVIRONMENTAL RADIATION PROTECTION STANDARDS FOR YUCCA MOUNTAIN, NEVADA Public Health and Environmental... related to the geology, hydrology, and climate based upon cautious, but reasonable assumptions of the...

  16. Fabrice Audié, Spinoza et les mathématiques, Paris, PUPS, 2005, 197 pages, 18 €.

    Directory of Open Access Journals (Sweden)

    Cécile Nicco

    2007-01-01

    Full Text Available Si, comme le souligne Pierre-François Moreau dans la préface, le rapport de la philosophie spinoziste aux mathématiques est « fort visible », il n’est pas pour autant facile à interpréter. En effet, l’intérêt de Spinoza pour les mathématiques est manifeste dans la forme géométrique de l’Éthique, des Principes de la philosophie de Descartes, et du premier Appendice du Court Traité ; mais elles sont aussi présentes en tant que problèmes à traiter ou comme illustrations dans la correspondance et...

  17. 25 CFR 900.197 - Does FTCA cover employees of the contractor who are paid by the contractor from funds other than...

    Science.gov (United States)

    2010-04-01

    ... SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES CONTRACTS UNDER THE INDIAN SELF-DETERMINATION AND... those provided through the self-determination contract? Yes, as long as the services out of which the... 25 Indians 2 2010-04-01 2010-04-01 false Does FTCA cover employees of the contractor who are paid...

  18. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  19. δ37Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.

  20. δ³⁷Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine

  1. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  2. Influence of neutron halo in the interaction of {sup 6}He nucleus of 35 MeV/nucleon with {sup 197}Au and {sup 238}U; Influence du halo de neutrons dans l`interaction du noyau {sup 6}He de 35 MeV/nucleon avec {sup 197}Au et {sup 238}U

    Energy Technology Data Exchange (ETDEWEB)

    Perier, Yann [Grand Accelerateur National d`Ions Lourds (GANIL), 14 - Caen (France)

    1997-10-27

    In this study, we have attempted to answer some of the questions still open concerning neutron halo nuclei. The interest of the latter lies in their very peculiar structure. The analysis of the kinematical features of the halo nucleus fragments originating from the dissociation following the interaction with a target nucleus is an essential tool for probing this structure. We studied the {sup 6}He + Au, U at 35 A.MeV system with a new method. Simultaneous measurements of the halo nucleus core, the halo neutrons and the excitation energy deposited in the target nucleus assessed with ORION allowed us to obtain information about the formation of the {sup 5}He nucleus and about the partial validity of the sudden approximation at moderate bombarding energy. The study of the core nucleus and neutron angular distributions confirmed that it is difficult to extract information on the internal structure at the halo neutrons from their widths. The halo neutron longitudinal momentum distributions were studied. Their widths were found to increase as the impact parameter decreases. The {sup 4}He - core parallel momentum distributions were also investigated. The widths are weakly dependent on the excitation energy deposited in the target nucleus, but increase with the {sup 4}He emission angle as for the halo neutrons. The ratio between one- and two-neutron stripping cross sections seems to indicate that the two halo neutrons are strongly correlated with a large dineutron component, as ascertained by a calculation in the framework of the Serber model. (author) 84 refs., 98 figs., 17 tabs.

  3. Measure of thermal neutron flux in the IPEN/MB-01 reactor using {sup 197} Au wire activation detectors; Medida do fluxo de neutrons termicos do reator IPEN/MB-01 com detectores de ativacao de fios de {sup 197} Au

    Energy Technology Data Exchange (ETDEWEB)

    Marques, Andre Luis Ferreira

    1995-12-31

    This dissertation has aimed at developing a neutron flux measurement technique by means of detectors activation analysis. The main task of this work was the implementation of this thermal neutron flux measurement technique, using gold wires as activation detectors in the IPEN/MB-01 reactor core. The neutron thermal flux spatial distribution was obtained by gold wire activation technique, with wire diameters of 0.125 mm and 0.250 mm in seven selected reactor experimental channels. The values of thermal flux were about 10{sup 9} neutrons/cm{sup 2}.s. This experiment has been the first one conducted with gold wires in the IPEN/MB-01 reactor, being this technique implemented for use by experiments in flux mapping of the core 73 refs., 60 figs., 31 tabs.

  4. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  5. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  6. Production cross section of At radionuclides from 7Li+natPb and 9Be+natTl reactions

    Science.gov (United States)

    Maiti, Moumita; Lahiri, Susanta

    2011-12-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from 6,7Li- and 9Be-induced reactions on natural lead and thallium targets, respectively. The production of astatine radionuclides were investigated experimentally with two heavy-ion-induced reactions: 9Be + natTl and 7Li + natPb. Formation cross sections of the evaporation residues, 207,208,209,210At, produced in the (HI,xn) channel, were measured by the stacked-foil technique followed by off-line γ spectrometry at low incident energies (<50 MeV). Measured excitation functions were interpreted in terms of a compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach models. Measured cross-section values are lower than the respective theoretical predictions.

  7. Persistence of immune responses after a single dose of Novartis meningococcal serogroup A, C, W-135 and Y CRM-197 conjugate vaccine (Menveo®) or Menactra® among healthy adolescents.

    Science.gov (United States)

    Gill, Christopher J; Baxter, Roger; Anemona, Alessandra; Ciavarro, Giuseppe; Dull, Peter

    2010-11-01

    The persistence of human bactericidal activity (hSBA) responses in adolescents was assessed 22 months after vaccination with one dose of Menveo® (MenACWY-CRM; Novartis) or Menactra® (MCV4) (sanofi pasteur). The proportion of subjects with hSBA titers ≥8 was significantly higher among recipients of MenACWY-CRM than MCV4 for serogroups A, W-135 and Y.

  8. Development of new synthetic oligosaccharide vaccines : the immunogenicity of oligosaccharide-CRM197 neoconjugates and oligosaccharide/peptide hybrid gold nanoparticles based on the capsular polysaccharide structure of Streptococcus pneumoniae type 14

    OpenAIRE

    Safari, D.

    2010-01-01

    Streptococcus pneumoniae is a leading cause of bacterial pneumonia, meningitis, and sepsis in children worldwide. Nowadays, the antibiotic resistance of S. pneumoniae bacteria has increased worldwide. This makes treatment of S. pneumoniae infections more difficult and stresses the importance of the development of effective vaccines as a strategy to reduce morbidity and mortality caused by S. pneumoniae infection. Currently, two vaccine types are commercially available: a 23-valent pneumococca...

  9. Development of new synthetic oligosaccharide vaccines : the immunogenicity of oligosaccharide-CRM197 neoconjugates and oligosaccharide/peptide hybrid gold nanoparticles based on the capsular polysaccharide structure of Streptococcus pneumoniae type 14

    NARCIS (Netherlands)

    Safari, D.

    2010-01-01

    Streptococcus pneumoniae is a leading cause of bacterial pneumonia, meningitis, and sepsis in children worldwide. Nowadays, the antibiotic resistance of S. pneumoniae bacteria has increased worldwide. This makes treatment of S. pneumoniae infections more difficult and stresses the importance of the

  10. A randomized, placebo-controlled, phase 1/2 study of tivantinib (ARQ 197) in combination with irinotecan and cetuximab in patients with metastatic colorectal cancer with wild-type KRAS who have received first-line systemic therapy.

    Science.gov (United States)

    Eng, Cathy; Bessudo, Alberto; Hart, Lowell L; Severtsev, Aleksey; Gladkov, Oleg; Müller, Lothar; Kopp, Mikhail V; Vladimirov, Vladimir; Langdon, Robert; Kotiv, Bogdan; Barni, Sandro; Hsu, Ching; Bolotin, Ellen; von Roemeling, Reinhard; Schwartz, Brian; Bendell, Johanna C

    2016-07-01

    Cetuximab in combination with an irinotecan-containing regimen is a standard treatment in patients with KRAS wild-type (KRAS WT), metastatic colorectal cancer (mCRC). We investigated the addition of the oral MET inhibitor tivantinib to cetuximab + irinotecan (CETIRI) based on preclinical evidence that activation of the MET pathway may confer resistance to anti-EGFR therapy. Previously treated patients with KRAS WT advanced or mCRC were enrolled. The phase 1, open-label 3 + 3, dose-escalation study evaluated the safety and maximally tolerated dose of tivantinib plus CETIRI. The phase 2, randomized, double-blinded, placebo-controlled study of biweekly CETIRI plus tivantinib or placebo was restricted to patients who had received only one prior line of chemotherapy. The phase 2 primary endpoint was progression-free survival (PFS). The recommended phase 2 dose was tivantinib (360 mg/m(2) twice daily) with biweekly cetuximab (500 mg/m(2)) and irinotecan (180 mg/m(2)). Among 117 patients evaluable for phase 2 analysis, no statistically significant PFS difference was observed: 8.3 months on tivantinib vs. 7.3 months on placebo (HR, 0.85; 95% confidence interval, 0.55-1.33; P = 0.38). Subgroup analyses trended in favor of tivantinib in patients with MET-High tumors by immunohistochemistry, PTEN-Low tumors, or those pretreated with oxaliplatin, but subgroups were too small to draw conclusions. Neutropenia, diarrhea, nausea and rash were the most frequent severe adverse events in tivantinib-treated patients. The combination of tivantinib and CETIRI was well tolerated but did not significantly improve PFS in previously treated KRAS WT mCRC. Tivantinib may be more active in specific subgroups. © 2016 The Authors International Journal of Cancer published by John Wiley & Sons Ltd on behalf of UICC.

  11. Phase III Multinational, Randomized, Double-Blind, Placebo-Controlled Study of Tivantinib (ARQ 197) Plus Erlotinib Versus Erlotinib Alone in Previously Treated Patients With Locally Advanced or Metastatic Nonsquamous Non-Small-Cell Lung Cancer.

    Science.gov (United States)

    Scagliotti, Giorgio; von Pawel, Joachim; Novello, Silvia; Ramlau, Rodryg; Favaretto, Adolfo; Barlesi, Fabrice; Akerley, Wallace; Orlov, Sergey; Santoro, Armando; Spigel, David; Hirsh, Vera; Shepherd, Frances A; Sequist, Lecia V; Sandler, Alan; Ross, Jeffrey S; Wang, Qiang; von Roemeling, Reinhard; Shuster, Dale; Schwartz, Brian

    2015-08-20

    Tivantinib, a MET receptor tyrosine kinase inhibitor, demonstrated increased anticancer activity in preclinical and early clinical studies when combined with erlotinib. Our study aimed to confirm efficacy and safety of the combination in previously treated patients with non-small-cell lung cancer (NSCLC). Patients with advanced nonsquamous NSCLC previously treated with one to two systemic regimens, including a platinum doublet, were randomly assigned at a 1:1 ratio to receive erlotinib 150 mg daily plus oral tivantinib 360 mg twice daily (E + T) or erlotinib plus placebo (E + P) until disease progression. Tumor specimens were evaluated for EGFR and KRAS mutations, MET expression, and MET gene amplification. The primary end point was overall survival (OS). Secondary and exploratory objectives included progression-free survival (PFS), OS in molecular subgroups, and safety. The study enrolled 1,048 patients and was discontinued for futility at the interim analysis. OS did not improve with E + T versus E + P (median OS, 8.5 v 7.8 months, respectively; hazard ratio [HR], 0.98; 95% CI, 0.84 to 1.15; P = .81), even though PFS increased (median PFS, 3.6 v 1.9 months; HR, 0.74; 95% CI, 0.62 to 0.89; P < .001). Exploratory subgroup analyses suggested OS improvement in patients with high MET expression (HR, 0.70; 95% CI, 0.49 to 1.01). Most common adverse events occurring with E + T versus E + P were rash (33.1% v 37.3%, respectively), diarrhea (34.6% v 41.0%), asthenia or fatigue (43.5% v 38.1%), and neutropenia (grade 3 to 4; 8.5% v 0.8%). E + T was well tolerated and increased PFS but did not improve OS in the overall nonsquamous NSCLC population. © 2015 by American Society of Clinical Oncology.

  12. A phase II trial of a selective c-Met inhibitor tivantinib (ARQ 197) monotherapy as a second- or third-line therapy in the patients with metastatic gastric cancer.

    Science.gov (United States)

    Kang, Yoon-Koo; Muro, Kei; Ryu, Min-Hee; Yasui, Hirofumi; Nishina, Tomohiro; Ryoo, Baek-Yeol; Kamiya, Yukimasa; Akinaga, Shiro; Boku, Narikazu

    2014-04-01

    Tivantinib is a selective, non-ATP competitive, small-molecule inhibitor of c-Met and is under development in several cancers including non-small cell lung and hepatocellular carcinoma. Activation of c-Met has been frequently found in metastatic gastric cancer (MGC) and is associated with poor prognosis. In this single-arm study, we evaluated the efficacy of tivantinib monotherapy in Asian patients with previously treated MGC. This is the first clinical report from the trials evaluating the efficacy of a selective c-Met inhibitor for MGC. Eligibility criteria included: MGC with at least one measurable lesion; 1 or 2 prior chemotherapy regimens; and ECOG PS 0 or 1. Tivantinib was daily administered orally. The primary endpoint was the disease control rate (DCR). Pre-treatment tumor tissue was collected to evaluate the biomarkers related to efficacy. Thirty patients, including 12 patients with prior gastrectomy, received tivantinib: median age 62.5 years; ECOG PS 0/1 (8/22); 1/2 prior regimen (16/14). No objective response was observed, and DCR was 36.7 %. Median progression-free survival was 43 days (95 % CI: 29.0-92.0). Grade 3 or 4 adverse events occurred in 13 patients (43.3 %), in whom neutropenia (N = 4) and anemia (N = 4) were recognized as drug-related. c-Met gene amplification was observed in 2 patients (6.9 %). No obvious relationship was identified between efficacy and biomarkers including gene amplification of c-Met, expression of c-Met, p-Met and HGF. Tivantinib as a monotherapy showed a modest efficacy in previously treated MGC, and further studies taking account of predictive biomarkers and/or combination with other chemotherapy may be needed in MGC.

  13. A reavaliação da Guerra do Vietnã apresentada no romance The short timer (197(), de Gustav Hasford, e em sua adaptação fílmica Fullmetal JAcket (1987), de Stanley Kubrick

    OpenAIRE

    Paula, Rodrigo Martini [UNESP

    2010-01-01

    Este projeto examina as maneiras pelas quais a obra The Short-Timers (1979), de Gustav Hasford, e o filme Full Metal Jacket (1987), de Stanley Kubrick, revisitam a Guerra do Vietnã, dessacralizando a História oficial. Em seu romance The Short Timers (1979), o veterano Gustav Hasford narra a trajetória de um soldado e de seus companheiros durante o treinamento militar e o posterior combate no Vietnã. Tomando a perspectiva desse soldado, o narrador focaliza esse episódio da história dos Estados...

  14. Quark Nova interpretation of the 13 keV emission feature seen in three AXPs: 1E 1048.1-5937, XTE J1810-197 and 4U 0142+61

    Science.gov (United States)

    Koning, N.; Leahy, D.; Ouyed, R.

    2014-10-01

    Three anomalous X-ray pulsars (AXPs) have significant emission lines in their burst spectra. Remarkably, the line occurs at 13 keV in all cases. This coincidence argues against the common proton-cyclotron interpretation of its origin. Previous work by Koning et al. has analysed the line using an atomic interpretation and derived constraints on the line energy and bursting environment. We build upon this work and examine the atomic interpretation in light of the quark nova model for AXPs. We find that the emission is consistent with the disk location, composition and temperature expected around AXPs in this model.

  15. Multibeam collection for KN197-08: Multibeam data collected aboard Knorr from 2010-05-22 to 2010-06-24, departing from Bridgetown, Barbados and returning to Bridgetown, Barbados

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  16. Multibeam collection for KN197-04: Multibeam data collected aboard Knorr from 2010-02-19 to 2010-03-12, departing from Bridgetown, Barbados and returning to Fortaleza, Brazil

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  17. Multibeam collection for KN197-05: Multibeam data collected aboard Knorr from 2010-03-14 to 2010-03-28, Fortaleza, Brazil to Cape Town, South Africa

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  18. Multibeam collection for KN197-06: Multibeam data collected aboard Knorr from 2010-04-04 to 2010-04-23, Cape Town, South Africa to Cape Town, South Africa

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  19. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Koziorowski, J

    1998-10-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on {sup 211}At and {sup 124}I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[{sup 211}At]astato-2`-deoxyuridine (AUdR) and N-succinimidyl-4-[{sup 211}At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [{sup 124}I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[{sup 124}I]iodo-2`-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for

  20. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...

  1. Protein (Cyanobacteria): 348661 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available C7001_197 Cyanobium sp. PCC 7001 MSPGADLPDLNVWLALASSQHIHHRQALHYWEQLAAEQVLFCTVTALGLVRLVSQPRLMGDAVKNAAEASELLAAFCRQPGVALAPAEHDGWDVFHRLMRKGELPPRLCTDAHLAALAMTHGWRLVSFDRDFKRFEGLHWLALS ...

  2. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VLAREVARRMDERLDYIRIEPKRILDLGCGTGADFGGLGRRYPKAMRI 60 ... Query: 138 ADPLPALREMHRVLETDGLLMFSSLGPDTLKELRAALPDTHGTRVHRFID...MHDLGDALVA 197 ... ADPLPALREMHRVLETDGLLMFSSLGPDTLKELRAALPDTHGTRVHRFIDMHDLGDALVA Sbjct: 121 ADPLPALREMHRVLETDGLLMFSSLGPDTLKELRAALPDTHGTRVHRFIDMHDLGDALVA 180 ...

  3. A randomized, double-blind, placebo-controlled, phase III trial of erlotinib with or without a c-Met inhibitor tivantinib (ARQ 197) in Asian patients with previously treated stage IIIB/IV nonsquamous nonsmall-cell lung cancer harboring wild-type epidermal growth factor receptor (ATTENTION study).

    Science.gov (United States)

    Yoshioka, H; Azuma, K; Yamamoto, N; Takahashi, T; Nishio, M; Katakami, N; Ahn, M J; Hirashima, T; Maemondo, M; Kim, S W; Kurosaki, M; Akinaga, S; Park, K; Tsai, C M; Tamura, T; Mitsudomi, T; Nakagawa, K

    2015-10-01

    A previous randomized phase II study demonstrated that the addition of a c-Met inhibitor tivantinib to an epidermal growth factor receptor (EGFR) tyrosine kinase inhibitor erlotinib might prolong progression-free survival (PFS) in patients with previously treated, nonsquamous nonsmall-cell lung cancer (NSCLC). On a subset analysis, the survival benefit was greater in patients with wild-type EGFR (WT-EGFR) than in those with activating EGFR mutations. Herein, this phase III study compared overall survival (OS) between Asian nonsquamous NSCLC patients with WT-EGFR who received erlotinib plus tivantinib (tivantinib group) or erlotinib plus placebo (placebo group). A total of 460 NSCLC patients were planned to be randomized to the tivantinib or placebo group. Primary end point was OS. Secondary end points were PFS, tumor response, and safety. Tissue was collected for biomarker analysis, including c-Met and HGF expression. Enrollment was stopped when 307 patients were randomized, following the Safety Review Committee's recommendation based on an imbalance in the interstitial lung disease (ILD) incidence between the groups. ILD developed in 14 patients (3 deaths) and 6 patients (0 deaths) in the tivantinib and the placebo groups, respectively. In the enrolled patients, median OS was 12.7 and 11.1 months in the tivantinib and the placebo groups, respectively [hazard ratio (HR) = 0.891, P = 0.427]. Median PFS was 2.9 and 2.0 months in the tivantinib and the placebo groups, respectively (HR = 0.719, P = 0.019). The commonly observed grade ≥ 3 adverse events in the tivantinib group were neutropenia (24.3%), leukopenia (18.4%), febrile neutropenia (13.8%), and anemia (13.2%). This study was prematurely terminated due to the increased ILD incidence in the tivantinib group. Although this study lacked statistical power because of the premature termination and did not demonstrate an improvement in OS, our results suggest that tivantinib plus erlotinib might improve PFS than erlotinib alone in nonsquamous NSCLC patients with WT-EGFR. NCT01377376. © The Author 2015. Published by Oxford University Press on behalf of the European Society for Medical Oncology. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  4. Characterization of the microbiota of the skin and oral cavity of Oreochromis niloticusCaracterização da microbiota da pele e cavidade oral de Oreochromis niloticusdoi:10.12662/2317-3076jhbs.v4i3.767.p193-197.2016

    Directory of Open Access Journals (Sweden)

    Edmar Maciel Lima Junior

    2016-09-01

    Full Text Available Introduction: Fish are usually exposed to higher microbial loads than land or air animals. The microbiota of fish mostly consists of Pseudomonas spp., Aeromonas spp., Shewanella putrefasciens, Acinetobacter spp. and Moraxella spp. The objective of this study was to analyze the oral cavity, and skin tissue microbiota on the Nile tilapia (Oreochromis niloticus, a fish species raised commercially in Brazil. Methods: Samples were collected from the oral cavity and skin of 20 Nile tilapia specimens (Oreochromis niloticus, each weighing approximately 1,000 grams. The samples were cultures for quantitative analysis on sheep blood agar (SBA and chromID™ CPS® agar (CPS. Results: Eleven different bacterial species were identified on CPS and SBA plates. Gram-negative species were the most prevalent, while gram-positive Globicatella spp, Streptococcus spp and Enterococcus faecalis were also found. Pseudomonas aeruginosa species were isolated from all samples. Gram-positive Enterococcus faecalis was found in 70 and 60% of the skin and oral samples, respectively. Conclusion: For all samples studied, the microbial load was less than 100,000 CFU/g of tissue. This value is a cutoff standardized for the American Society of Microbiology to differentiate the causal agent from the colonizers. In light of this result and considering the absence of infectious signs in the fish samples, we conclude that the CFU values found in this study reflect a normal, non-infectious colonization/microbiota.

  5. Quando a beleza põe a mesa: uma análise das condições de trabalho do profissional de educação física em mega-academias DOI:10.5007/2175-8042.2011v23n36p197

    Directory of Open Access Journals (Sweden)

    José Carlos de Moraes Guimarães

    2011-01-01

    Full Text Available O estudo objetiva identificar as condições de trabalho dos profissionais de educação física em mega-academias do Rio de Janeiro. A metodologia utilizada foi a pesquisa de campo com 12 informantes. Encontraram-se os seguintes resultados: carga horária elevada, baixa quantidade no sono, alto esforço laboral e uma grande importância à estética corporal. Outro fator que se torna fundamental na discussão é o exacerbado culto ao corpo, visto como um modelo buscado por grande parte dos alunos dessas mega-academias. Neste contexto, o culto ao corpo é visto como capital simbólico na busca por um espaço no mercado de trabalho.

  6. 77 FR 20884 - Proposed Collection; Comment Request for Regulation

    Science.gov (United States)

    2012-04-06

    ... regulations under section 197 of the Internal Revenue Code (Code) that apply to a section 197 intangible...) estimates of capital or start-up costs and costs of operation, maintenance, and purchase of services to...

  7. Unedited version published online

    Indian Academy of Sciences (India)

    微软用户

    Real-time PCR and Western blot assays to analyze the EMT hallmark changes in both the mRNA and protein levels. 3'-UTR reporter luciferase assay to show HIPK2 is a direct target of miR-197. Results: miR-197 enhances LAD cell migration and invasion miR-197. The down-regulation of miR-197 suppresses the EMT and.

  8. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  9. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  10. Nuclear and in-source laser spectroscopy with the ISAC yield station

    Energy Technology Data Exchange (ETDEWEB)

    Kunz, Peter, E-mail: pkunz@triumf.ca; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning [TRIUMF, 4004 Wesbrook Mall, Vancouver, British Columbia V6T 2A3 (Canada); Andreoiu, Corina; Wong, Fiona [Department of Chemistry, Simon Fraser University, Burnaby, British Columbia V5A 1S6 (Canada)

    2014-05-15

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10{sup 11} ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of {sup 46}K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  11. Nuclear and in-source laser spectroscopy with the ISAC yield station.

    Science.gov (United States)

    Kunz, Peter; Andreoiu, Corina; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning; Wong, Fiona

    2014-05-01

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10(11) ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of (46)K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  12. Radiopharmaceutical chemistry of targeted radiotherapeutics, part 4: Strategies for211At labeling at high activities and radiation doses of211At α-particles.

    Science.gov (United States)

    Pozzi, Oscar R; Zalutsky, Michael R

    2017-03-01

    Alpha particles are radiation of high energy and short range, properties that can lead to radiolysis-mediated complications in labeling chemistry at the high radioactivity levels required for clinical application. In previous papers in this series, we have shown that radiation dose has a profound effect on the astatine species that are present in the labeling reaction and their suitability for the synthesis of N-succinimidyl 3-[ 211 At]astatobenzoate. The purpose of this study was to evaluate the effects of adding N-chlorosuccinimide (NCS) to the methanol solution used for initial isolation of 211 At after distillation, a process referred to as 211 At stabilization, on 211 At chemistry after exposure to high radiation doses. High performance liquid chromatography was used to evaluate the distribution of 211 At species present in methanol in the 500-65,000Gy radiation dose range and the synthesis of SAB from N-succinimidyl 3-(tri-n-butylstannyl)benzoate in the 500-120,000Gy radiation dose range using different 211 At timeactivity combinations under conditions with/without 211 At stabilization. In the absence of NCS stabilization, a reduced form of astatine, At(2), increased with increasing radiation dose, accounting for about half the total activity by about 15,000Gy, while with stabilization, At(2) accounted for 60,000Gy. SAB yields without stabilization rapidly declined with increasing dose, falling to ~20% at about 5000Gy while with stabilization, yields >80% were obtained with 211 At solutions stored for more than 23h and receiving radiation doses >100,000Gy. Adding NCS to the methanol solution used for initial isolation of 211 At is a promising strategy for countering the deleterious effects of radiolysis on 211 At chemistry. This strategy could facilitate the ability to perform 211 At labeling at sites remote from its production and at the high activity levels required for clinical applications. Copyright © 2016 Elsevier Inc. All rights reserved.

  13. 14 CFR 399.34 - Intra-Hawaii and Intra-Puerto Rico/Virgin Islands fare flexibility.

    Science.gov (United States)

    2010-01-01

    ... 147 147 147 147 Phildelaphia 1,576 132.69 206.45 American 115 121 109 115 197 208 187 197 Eastern 115 121 109 115 175 196 175 196 Washington 1,565 131.97 205.34 American 114 120 108 114 187 197 176 187... $(74) $811 $(196) $(860) $(1,056) $4,520 Return Element $1,626 $2,509 $4,135 $545 $1,723 $2,268 $7,844...

  14. AcEST: DK943635 [AcEST

    Lifescience Database Archive (English)

    Full Text Available r|Q9F5W3|Q9F5W3_BACCI Cyclodextrin glucanotransferase OS=Bacill... 44 0.007 tr|Q197W1|Q197W1_9BACI Beta-cyclodextrin...lodextrin glycosyltransferase OS=Bacillus sp. N-227 PE=3 SV=1 Length = 713 Score = ...PVNST-TVYIQW 422 G+N T P + T T+ + W Sbjct: 690 EGGANRTFTTPTSGTATMNVNW 711 >tr|Q197W1|Q197W1_9BACI Beta-cyc

  15. Dicty_cDB: Contig-U02852-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NHLIKK EINKVETDQLTHQYTLVISPDNTYKVLVDNKEIQAGNLADDWELLPSKQIKDPKQSKPVD WVDVKEIDDPEDVKPAGHDDIPASIVDPEAVK...NHLIKK EINKVETDQLTHQYTLVISPDNTYKVLVDNKEIQAGNLADDWELLPSKQIKDPKQSKPVD WVDVKEIDDPEDVKPAGHDDIPASIVDPEAVK...196 Query: 655 ADDWELLPSKQIKDPKQSKPVDWVDVKEIDDPEDVKPAGHDDIPASIVDPEAVKPXXXXX 834 ADDWELLPSKQIKDPKQSKPVD...WVDVKEIDDPEDVKPAGHDDIPASIVDPEAVKP Sbjct: 197 ADDWELLPSKQIKDPKQSKPVDWVDVKEIDDPEDVKPAGHDDIPASIVDPEAVKPEDWNE

  16. New data on cross-sections of deuteron induced nuclear reactions on gold up to 50 MeV and comparison of production routes of medically relevant Au and Hg radioisotopes

    Energy Technology Data Exchange (ETDEWEB)

    Tárkányi, F. [Institute for Nuclear Research, Hungarian Academy of Sciences (ATOMKI), Debrecen (Hungary); Hermanne, A. [Cyclotron Laboratory, Vrije Universiteit Brussel (VUB), Brussels (Belgium); Ditrói, F., E-mail: ditroi@atomki.hu [Institute for Nuclear Research, Hungarian Academy of Sciences (ATOMKI), Debrecen (Hungary); Takács, S. [Institute for Nuclear Research, Hungarian Academy of Sciences (ATOMKI), Debrecen (Hungary); Adam Rebeles, R. [Cyclotron Laboratory, Vrije Universiteit Brussel (VUB), Brussels (Belgium); Ignatyuk, A.V. [Institute of Physics and Power Engineering (IPPE), Obninsk (Russian Federation)

    2015-11-01

    Highlights: • Deuteron induced nuclear reactions on natural gold up to 50 MeV. • Stacked foil irradiation technique. • Comparison of results with the ALICE, EMPIRE and TENDL-2014 calculations. • Medical radioisotope production. - Abstract: Investigations of cross-sections of deuteron induced nuclear reactions on gold were extended up to 50 MeV by using the standard stacked foil irradiation technique and high resolution gamma-ray spectrometry. New cross-sections are reported for the {sup 197}Au(d,xn){sup 197m,197g,195m,195g,193m,193g}Hg and {sup 197}Au(d,x){sup 198m,198g,196m,196g,195,194}Au nuclear reactions. The application for production of the medically relevant isotopes {sup 198}Au and {sup 195m,195g,197m,197g}Hg is discussed, including the comparison with other charged particle induced production routes. The possible use of the {sup 197}Au(d,x){sup 197m,197g,195m,193m}Hg and {sup 196m,196g}Au reactions for monitoring deuteron beam parameters is also investigated.

  17. EST Table: BB985574 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BB985574 E_ET_MSV3_06G07_F_0 10/09/28 100 %/197 aa ref|NP_001036887.1| beta-tubulin... 10/08/27 96 %/197 aa B0272.1#CE00850#WBGene00006538#locus:tbb-4#tubulin beta chain#status:Partially_confirm

  18. NCBI nr-aa BLAST: CBRC-CREM-01-1091 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CREM-01-1091 ref|YP_802106.1| Transcriptional regulator, AraC family [Leptospira borgpeter...senii serovar Hardjo-bovis JB197] gb|ABJ77348.1| Transcriptional regulator, AraC family [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_802106.1 0.024 18% ...

  19. NCBI nr-aa BLAST: CBRC-TTRU-01-0492 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0492 ref|YP_801414.1| DltB-related membrane protein [Leptospira borgpeter...senii serovar Hardjo-bovis JB197] gb|ABJ76656.1| DltB-related membrane protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_801414.1 0.042 27% ...

  20. NCBI nr-aa BLAST: CBRC-DNOV-01-2580 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-2580 ref|YP_802284.1| hypothetical protein LBJ_4138 [Leptospira borgpeter...senii serovar Hardjo-bovis JB197] gb|ABJ77526.1| Hypothetical protein LBJ_4138 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_802284.1 1.6 43% ...

  1. 46 CFR Appendix F to Subpart C to... - Sample Worker Certification Form

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Sample Worker Certification Form F Appendix F to Subpart C to Part 197 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE OCCUPATIONAL SAFETY AND HEALTH STANDARDS GENERAL PROVISIONS Benzene Pt. 197, Subpt. C, App. F Appendix F to Subpart C...

  2. 78 FR 73753 - Partnerships; Start-Up Expenditures; Organization and Syndication Fees

    Science.gov (United States)

    2013-12-09

    ... sale or exchange of 50 percent or more of the total interest in partnership capital and profits... intangible business assets described in section 197, and accordingly determined that the period for the... year amortization period for section 197 intangibles. H. Rep. No. 108-755, at 776-77 (October 07, 2004...

  3. 46 CFR Appendix B to Subpart C to... - Substance Technical Guidelines, Benzene

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Substance Technical Guidelines, Benzene B Appendix B to... OCCUPATIONAL SAFETY AND HEALTH STANDARDS GENERAL PROVISIONS Benzene Pt. 197, Subpt. C, App. B Appendix B to Subpart C to Part 197—Substance Technical Guidelines, Benzene I. Physical and Chemical Data (a) Substance...

  4. Measuring Interpersonal Forgiveness in Late Adolescence and Middle Adulthood.

    Science.gov (United States)

    Subkoviak, Michael J.; And Others

    1995-01-01

    The construct of interpersonal forgiveness is operationalized and tested with 197 college students and 197 of their same-gender parents. The Enright Forgiveness Inventory correlates significantly and negatively with anxiety, particularly in relation to deep hurt in a developmentally relevant area. (JPS)

  5. NCBI nr-aa BLAST: CBRC-ACAR-01-1054 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1054 ref|YP_402218.1| putative transport [Shigella dysenteriae Sd197] sp|Q32IX8|ENTS_SHIDS Ente...robactin exporter entS gb|ABB60729.1| putative transport [Shigella dysenteriae Sd197] YP_402218.1 1.7 27% ...

  6. Multistep production of eta and hard pi(0) mesons in subthreshold Au-Au collisions

    NARCIS (Netherlands)

    Appenheimer, M; Averbeck, R; Charbonnier, Y; Diaz, J; Doppenschmidt, A; Hejny, [No Value; Hlavac, S; Holzmann, R; Kugler, A; Lohner, H; Marin, A; Metag, [No Value; Novotny, R; Ostendorf, RW; Pleskac, R; Schubert, A; Schutz, Y; Simon, RS; Stratmann, R; Stroher, H; Tlusty, P; Vogt, PH; Wagner, [No Value; Weiss, J; Wilschut, HW; Wissmann, F; Wolf, M

    1998-01-01

    The neutral pi(o) and eta mesons are studied in Au-197-Au-197 collisions at an incident energy of 800A MeV, substantially below the threshold for eta production in N-N collisions. While the gross pi(o) multiplicity increases almost linearly with the number of participant nucleons, the multiplicities

  7. Gclust Server: 152337 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 152337 Gox_GOX2618 Cluster Sequences - 197 DotG 1 1.00e-99 0.0 0.0 0.0 0.0 3.23 0.0...elated sequences - Sequence length 197 Representative annotation DotG Number of Sequences 1 Homologs 1 Clust

  8. 75 FR 32943 - Food and Drug Administration Modernization Act of 1997: Modifications to the List of Recognized...

    Science.gov (United States)

    2010-06-10

    ... Hospital/General Plastic Surgery 6-9 6-227 ANSI/AAMI/IEC 60601-2-21: 2009 Medical Newer version with.... for the safety of electrically operated Refer to recognition hospital beds no. 6-233 6-197 6-228 IEC... basic safety and essential performance of magnetic resonance equipment for medical diagnosis 12-197 12...

  9. NCBI nr-aa BLAST: CBRC-PVAM-01-1485 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1485 ref|YP_786027.1| benzoate membrane transport protein [Bordetella avium... 197N] emb|CAJ49114.1| benzoate membrane transport protein [Bordetella avium 197N] YP_786027.1 5.2 29% ...

  10. Dicty_cDB: CHP854 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available alignments: (bits) Value (Q6DIP9) RecName: Full=Strumpellin; &BC075486_1(BC075486|pid:no... 199 2e-49 AK223628_1(...Protein KIAA... 197 5e-49 ( Q12768 ) RecName: Full=Strumpellin; &AB463083_1(AB463083|pid:no... 197 5e-49 BC034070_1(

  11. Ostracods of Andaman Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Stephen, R.; Meenakshikunjamma, P.P.

    stream_size 7 stream_content_type text/plain stream_name 2_Workshop_Scient_Result_FORV_Sagar_Sampada_Proc_1996_197.pdf.txt stream_source_info 2_Workshop_Scient_Result_FORV_Sagar_Sampada_Proc_1996_197.pdf.txt Content-Encoding ISO-8859...

  12. Drug: D00059 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D00059 Drug Levodopa (JP16/USP/INN); Dopar (TN) C9H11NO4 197.0688 197.1879 D00059.gif Antiparkinson...4728(1812+1813+1814+1815+1816) Dopaminergic synapse map07057 Antiparkinsonian age... 11 Agents affecting central nervous system 116 Antiparkinsonian agents 1164 Levodopas D00059 Levodopa (JP16

  13. NCBI nr-aa BLAST: CBRC-TTRU-01-0320 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0320 ref|YP_402203.1| putative sensor kinase [Shigella dysenteriae Sd1...97] gb|ABB60714.1| putative sensor kinase [Shigella dysenteriae Sd197] YP_402203.1 0.087 23% ...

  14. NCBI nr-aa BLAST: CBRC-BTAU-01-1528 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-1528 ref|YP_404016.1| putative transport/receptor protein [Shigella dy...senteriae Sd197] gb|ABB62525.1| putative transport/receptor protein [Shigella dysenteriae Sd197] YP_404016.1 2.0 31% ...

  15. The dynamic response of a fungal lipase in the presence of charged surfactants

    DEFF Research Database (Denmark)

    Peters, Günther H.J.

    2002-01-01

    . In the presence of lipid aggregates, fluctuations are observed in the loops Va197-Lys106, Arg202-Gly214 and Trp223-Thr252. In particular, the flexibility of the loop Va197-Lys106 may have fundamental implications for the activation of lipases. This region has been suggested as a possible 'entering gate...

  16. On the momentum distribution of particles participating in nuclear ...

    Indian Academy of Sciences (India)

    Nuclear stopping is studied as a function of incident energy and charge of the fragment produced in central heavy-ion collisions (HIC) of 79 197 Au+ 79 197 Au and 28 58 Ni+ 28 58 Ni using stopping parameter VARXZ. Various momentum constraints were imposed to get better insight into the stopping. The comparison of ...

  17. Author Index

    Indian Academy of Sciences (India)

    ., 97. Qian, B. C., 127. Qin, Y.-P., 243, 257, 269, 273, 277. Rani, B., 217. Reynoso, M. M., 19. Romero, G. E., 19. Ryu, D., 301. Sault, R. J., 13. Shao, Z. Y., 197. Shen, S. Y., 197. Shen, Z. Q., 13, 25, 61, 261. Singh, J., 265. Smith, P. S., 239. Song ...

  18. AcEST: BP911829 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6 YDDANGGALNLTSDNSRHSTQSPSNSVKSATASPVPVISVPSPVPPMISPVLAPSGCGS 184 >sp|Q5PPI7|TMHS_RAT Tetraspan membrane protein of hair cell stereo...---GHCTIRW---AFMLAILSIGDALILSFLAF 197 >sp|Q4KL25|TMHS_MOUSE Tetraspan membrane protein of hair cell stereo...HCTIRW---AFMLAILSIGDALILSFLAF 197 >sp|Q8TAF8|TMHS_HUMAN Tetraspan membrane protein of hair cell stereo

  19. Environmental Law Deskbook

    Science.gov (United States)

    1991-10-01

    19-5 1908 VOLATILE ORGANIC COMPOUNDS (VOCS) 19-5 1909 ACID RAIN 19-6 1910 GLOBAL CLIMATE PROTECTION 19-7 1911 TOXIC AIR POLLUTION 19-7 1912 PERMITS...1910 GLOBAL CLIMATE PROTECTION . Title VI of the 1990 amendments reflects congressional concern for stratospheric ozone and "greenhouse effect." To

  20. 76 FR 39278 - Modification of Treasury Regulations Pursuant to Section 939A of the Dodd-Frank Wall Street...

    Science.gov (United States)

    2011-07-06

    ... intangibles in the third sentence of Sec. 1.197-2(b)(7). No substantive change in the treatment of a favorable credit rating as a supplier-based intangible under section 197 is intended. Section 1.249-1. The... other conditions, the applicant has adequate financial resources to pay its expected fuel tax liability...

  1. JUTH JOURNAL MEDICAL, MAY - AUGUST 2012 EDITION

    African Journals Online (AJOL)

    user

    *Department of Epidemiology and Community Health, College of Health Sciences, Benue State. University, Makurdi. ... during training 63.7% and Media 19.7%. ..... 7.7. Source of information. During training. Media. Friends/relations. Others. 116. 36. 14. 16. 63.7. 19.7. 7.7. 8.8. *Risk factors associated with Breast cancer.

  2. Effect of increased CRM₁₉₇ carrier protein dose on meningococcal C bactericidal antibody response.

    Science.gov (United States)

    Lee, Lucia H; Blake, Milan S

    2012-04-01

    New multivalent CRM(197)-based conjugate vaccines are available for childhood immunization. Clinical studies were reviewed to assess meningococcal group C (MenC) antibody responses following MenC-CRM(197) coadministration with CRM(197)-based pneumococcal or Haemophilus influenzae type b conjugate vaccines. Infants receiving a total CRM(197) carrier protein dose of ∼50 μg and concomitant diphtheria-tetanus-acellular pertussis (DTaP)-containing vaccine tended to have lower MenC geometric mean antibody titers and continued to have low titers after the toddler dose. Nevertheless, at least 95% of children in the reported studies achieved a MenC serum bactericidal antibody (SBA) titer of ≥ 1:8 after the last infant or toddler dose. SBA was measured using an assay with a baby rabbit or human complement source. Additional studies are needed to assess long-term antibody persistence and MenC CRM(197) conjugate vaccine immunogenicity using alternative dosing schedules.

  3. Alpha particle emitters in medicine

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, D.R.

    1989-09-01

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ({sup 211}At) and natural bismuth-212 ({sup 212}Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ({sup 223}Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs.

  4. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Directory of Open Access Journals (Sweden)

    Sherif S Nafee

    Full Text Available Thallium (81(217Tl, Bismuth (83(217Bi, Astatine (85(217At, Francium (87(217Fr, Actinium (89(217Ac and Protactinium (91(217Pa are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221Fr-, (221Ac- and (221Pa-α-decays.

  5. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Science.gov (United States)

    Nafee, Sherif S; Shaheen, Salem A; Al-Ramady, Amir M

    2016-01-01

    Thallium (81(217)Tl, Bismuth (83(217)Bi), Astatine (85(217)At), Francium (87(217)Fr), Actinium (89(217)Ac) and Protactinium (91(217)Pa) are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α) has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF) calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221)Fr-, (221)Ac- and (221)Pa-α-decays.

  6. On the theory of time dilation in chemical kinetics

    Science.gov (United States)

    Baig, Mirza Wasif

    2017-10-01

    The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

  7. SPECT assay of radiolabeled monoclonal antibodies. Progress report, September 1, 1992--August 24, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1993-08-20

    The overall goal of this project is to improve the effectiveness of single photon emission computed tomography (SPECT) to image and quantify radiolabeled monoclonal antibodies. During the past year, we have made significant progress toward this goal, and this report summarizes that work. Our efforts have been mainly directed along three fronts. First, we have developed and tested new reconstruction methods including three-dimensional iterative algorithms that model non-uniform attenuation and distance-dependent detector response. Both fan beam and parallel beam collimator geometries have been modeled and novel ways of improving the efficiency of the computationally intensive methods have been introduced. Second, an ultra-high resolution, small field-of-view pinhole collimator has been constructed and evaluated. Reconstructed spatial resolution of 1 to 3 mm (FWHM) has been achieved in phantom scans with a useful field-of-view of 9 to 10 cm. Finally, we have investigated the ability of SPECT to image and quantify astatine-211 distributions. Reconstructed images of phantom data demonstrated quantitative accuracy to within 10% with proper attenuation and scatter compensation.

  8. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Science.gov (United States)

    Marsh, B. A.; Andel, B.; Andreyev, A. N.; Antalic, S.; Atanasov, D.; Barzakh, A. E.; Bastin, B.; Borgmann, Ch.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Dehairs, M.; Derkx, X.; De Witte, H.; Fedorov, D. V.; Fedosseev, V. N.; Focker, G. J.; Fink, D. A.; Flanagan, K. T.; Franchoo, S.; Ghys, L.; Huyse, M.; Imai, N.; Kalaninova, Z.; Köster, U.; Kreim, S.; Kesteloot, N.; Kudryavtsev, Yu.; Lane, J.; Lecesne, N.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Molkanov, P. L.; Nicol, T.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Schweikhard, L.; Seliverstov, M. D.; Sels, S.; Sjödin, A. M.; Truesdale, V.; Van Beveren, C.; Van Duppen, P.; Wendt, K.; Wienholtz, F.; Wolf, R. N.; Zemlyanoy, S. G.

    2013-12-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  9. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  10. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  11. Evaluating 99mTc Auger electrons for targeted tumor radiotherapy by computational methods.

    Science.gov (United States)

    Tavares, Adriana Alexandre S; Tavares, João Manuel R S

    2010-07-01

    Technetium-99m (99mTc) has been widely used as an imaging agent but only recently has been considered for therapeutic applications. This study aims to analyze the potential use of 99mTc Auger electrons for targeted tumor radiotherapy by evaluating the DNA damage and its probability of correct repair and by studying the cellular kinetics, following 99mTc Auger electron irradiation in comparison to iodine-131 (131I) beta minus particles and astatine-211 (211At) alpha particle irradiation. Computational models were used to estimate the yield of DNA damage (fast Monte Carlo damage algorithm), the probability of correct repair (Monte Carlo excision repair algorithm), and cell kinetic effects (virtual cell radiobiology algorithm) after irradiation with the selected particles. The results obtained with the algorithms used suggested that 99mTc CKMMX (all M-shell Coster-Kroning--CK--and super-CK transitions) electrons and Auger MXY (all M-shell Auger transitions) have a therapeutic potential comparable to high linear energy transfer 211At alpha particles and higher than 131I beta minus particles. All the other 99mTc electrons had a therapeutic potential similar to 131I beta minus particles. 99mTc CKMMX electrons and Auger MXY presented a higher probability to induce apoptosis than 131I beta minus particles and a probability similar to 211At alpha particles. Based on the results here, 99mTc CKMMX electrons and Auger MXY are useful electrons for targeted tumor radiotherapy.

  12. Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

    Energy Technology Data Exchange (ETDEWEB)

    Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se

    2005-08-01

    Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

  13. Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

  14. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  15. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  16. Molecular Cloning, Structural Modeling and the Production of Soluble Triple-Mutated Diphtheria Toxoid (K51E/G52E/E148K) Co-expressed with Molecular Chaperones in Recombinant Escherichia coli.

    Science.gov (United States)

    Uthailak, Naphatsamon; Mahamad, Pornpimol; Chittavanich, Pamorn; Yanarojana, Somchai; Wijagkanalan, Wassana; Petre, Jean; Panbangred, Watanalai

    2017-05-01

    CRM197 is a diphtheria toxin (DT) mutant (G52E) which has been used as a carrier protein for conjugate vaccines. However, it still possesses cytotoxicity toward mammalian cells. The goal of this project was to produce a non-toxic and soluble CRM197EK through introduction of triple amino acid substitutions (K51E/G52E/E148K) in Escherichia coli. The expression of CRM197EKTrxHis was optimized and co-expressed with different molecular chaperones. The soluble CRM197EKTrxHis was produced at a high concentration (97.33 ± 17.47 μg/ml) under the optimal condition (induction with 0.1 mM IPTG at 20 °C for 24 h). Cells containing pG-Tf2, expressing trigger factor and GroEL-GroES, accumulated the highest amount of soluble CRM197EKTrxHis at 111.24 ± 10.40 μg/ml after induction for 24 h at 20 °C. The soluble CRM197EKTrxHis still possesses nuclease activity and completely digest λDNA at 25 and 37 °C with 8- and 4-h incubation, respectively. Molecular modeling of diphtheria toxin, CRM197 and CRM197EK indicated that substitutions of two amino acids (K51E/E148K) may cause poor NAD binding, consistent with the lack of toxicity. Therefore, CRM197EK might be used as a new potential carrier protein. However, further in vivo study is required to confirm its roles as functional carrier protein in conjugate vaccines.

  17. The nucleus 198Au investigated with neutron capture and transfer reactions. I. Experiments and evaluation.

    Science.gov (United States)

    Mayerhofer, Ulrich; von Egidy, Till; Klora, Jörg; Lindner, Helmut; Börner, Hans G.; Judge, Stephen; Krusche, Bernd; Robinson, Stephen; Schreckenbach, Klaus; Sukhovoj, Anatoly M.; Khitrov, Valery A.; Boneva, Stefka T.; Paar, Vladimir; Brant, Slobodan; Pezer, Robert

    The transfer reaction 197Au(d,p)198Au was measured at the Tandem Accelerator in Munich. The 197Au(n,g)198Au and 197Au(n,e)198Au reactions were performed at the High Flux Reactor of ILL, Grenoble. Up to 1560 keV a total of 111 levels were observed by the (d,p) reaction and 125 by the (n,g) reaction. For many of the levels, spins and parities were assigned. Additional information was obtained from summed (n,gg) coincidences measured in Dubna.

  18. Instructie en toetsing in de gesimuleerde beroepspraktijk: de (live) patiëntsimulatie

    NARCIS (Netherlands)

    Wopereis, Iwan; Schotten, Joost

    2013-01-01

    Wopereis, I. G. J. H., & Schotten, J. G. M. (1996). Instructie en toetsing in de gesimuleerde beroepspraktijk: de (live) patiëntsimulatie [Instruction and assessment in simulated professional practice: the (live) patient simulation]. Onderwijs & Gezondheidszorg, 20, 197-201.

  19. DISTINCTIVE BASIC COMPETENCES MANAGEMENT MODEL DESIGN FOR EXPORTING SMES IN MEDELLIN CITY

    National Research Council Canada - National Science Library

    Robert Ng Henao; Abraham Londoño Pineda

    2012-01-01

      NG HENAO, Robert and LONDONO PINEDA, Abraham. DISTINCTIVE BASIC COMPETENCES MANAGEMENT MODEL DESIGN FOR EXPORTING SMES IN MEDELLIN CITY. Semest. Econ. [online]. 2012, vol.15, n.32, pp. 197-224. ISSN 0120-6346...

  20. Using Emotional Intelligence in Personalized Adaptation

    NARCIS (Netherlands)

    Damjanovic, Violeta; Kravcik, Milos

    2008-01-01

    Damjanovic, V. & Kravcik, M. (2007). Using Emotional Intelligence in Personalized Adaptation. In M. D. Lytras & A. Naeve (Eds.), Ubiquitous and Pervasive Knowledge and Learning Management (pp. 158-197). IGI Publishing.

  1. North Carolina Statewide Lidar DEM 2015 Phase 3

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Geographic Extent: North Carolina Area of Interest, covering approximately 7,197 square miles. Dataset Description: The North Carolina LiDAR project called for the...

  2. THE NEW INTEREST; Away from the hype of Carla Bruni, Nicolas Sarkozy's visit will establish France as an all-weather partner of India

    National Research Council Canada - National Science Library

    Saurabh Shukla

    2008-01-01

    Another issue which is expected to crop up during his visit is the multi-billion dollar Eurocopter deal to supply 197 light helicopters to the Army which was scrapped following some technical glitches...

  3. Antibody recognizing 4-sulfated chondroitin sulfate proteoglycans restores memory in tauopathy-induced neurodegeneration

    Czech Academy of Sciences Publication Activity Database

    Yang, S.; Hilton, S.; Alves, J.N.; Saksida, L.M.; Bussey, T.; Matthews, R.T.; Kitagawa, H.; Spillantini, M.G.; Kwok, Jessica; Fawcett, James

    2017-01-01

    Roč. 59, nov (2017), s. 197-209 ISSN 0197-4580 Institutional support: RVO:68378041 Keywords : perineuronal nets * CSPGs * object recognition memory Subject RIV: FH - Neurology Impact factor: 5.117, year: 2016

  4. Černá vlajka pirátů znovu nahání strach? Opatření proti pirátství a ozbrojenému lupičství na moři na začátku 21. století

    Czech Academy of Sciences Publication Activity Database

    Šturma, Pavel

    2009-01-01

    Roč. 8, č. 7 (2009), s. 193-197 ISSN 1213-5313 Institutional research plan: CEZ:AV0Z70680506 Keywords : maritime law * public international law * fight against piracy Subject RIV: AG - Legal Sciences

  5. Relationship between motor and cognitive learning abilities among primary school-aged children

    National Research Council Canada - National Science Library

    Abdelkarim, Osama; Ammar, Achraf; Chtourou, Hamdi; Wagner, Matthias; Knisel, Elke; Hökelmann, Anita; Bös, Klaus

    2017-01-01

    .... Therefore, the aim of this study was to examine the levels of motor and cognitive learning abilities and their independent and combined associations among German primary school-children. Methods: Participants were (n = 197...

  6. 75 FR 14479 - Reallocation of Unused Fiscal Year 2010 Tariff-Rate Quota Volume for Raw Cane Sugar

    Science.gov (United States)

    2010-03-25

    ..., 2009, the Secretary of Agriculture established the FY 2010 TRQ for imported raw cane sugar at the... in the amounts specified below: FY 2010 Country reallocation Argentina 3,729 Australia 7,197 Belize...

  7. 2015 NCFMP Lidar: Statewide North Carolina (Phase 3)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Geographic Extent: North Carolina Area of Interest, covering approximately 7,197 square miles. Dataset Description: The North Carolina LiDAR project called for the...

  8. Global Reservoir and Dam Database, Version 1 (GRanDv1): Reservoirs, Revision 01

    Data.gov (United States)

    National Aeronautics and Space Administration — The Global Reservoir and Dam (GRanD) Database, Version 1.1 contains 6,862 records of reservoirs and their associated dams with a cumulative storage capacity of 6,197...

  9. A comparison of biologically active elements in geese in relation to avian cholera

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Avian cholera caused an estimated mortality of between 166,000 to 197,000 migrating waterfowl in the Rainwater Basin of Nebraska in the 10-year period 1975 through...

  10. Southern African Linguistics and Applied Language Studies - Vol 34 ...

    African Journals Online (AJOL)

    Translanguaging as a class/lecture-room language management strategy in multilingual contexts: Insights from autoethnographic snapshots from Kenya and South Africa · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Munene Mwaniki, 197-209.

  11. Digital Social Norm Enforcement: Online Firestorms in Social Media

    National Research Council Canada - National Science Library

    Rost, Katja; Stahel, Lea; Frey, Bruno S

    2016-01-01

    ... factors that promotes aggression. We underpin this social norm view by analyzing a major social media platform concerned with public affairs over a period of three years entailing 532,197 comments on 1,612 online petitions...

  12. 2010 U.S. Geological Survey (USGS) Topographic Lidar: Channel Islands, California

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Terrapoint collected LiDAR for 197 square miles covering five islands off the coast of Los Angeles, California. These islands are part of the Channel Islands...

  13. Absorption and tunneling effects in one- and two-proton transfer reactions

    Energy Technology Data Exchange (ETDEWEB)

    Marta, H.D. [Facultad de Ingenieria, Montevideo (Uruguay). Inst. de Fisica; Donangelo, R. [Universidade Federal, Rio de Janeiro, RJ (Brazil). Inst. de Fisica; Tomasi, D.; Fernandez Niello, J.O.; Pacheco, A.J. [Comision Nacional de Energia Atomica, Buenos Aires (Argentina). Dept. de Fisica. Lab. TANDAR

    1997-12-31

    We analyze proton transfer data for the {sup 12} C + {sup 197} Au system. Our semiclassical model reproduces the observed energy dependence of the transfer probabilities at large distances. (author) 3 refs., 1 fig.

  14. International Journal of Tropical Agriculture and Food Systems - Vol ...

    African Journals Online (AJOL)

    Wokoma, 197-200 ... Effect of information and communication technology on culture of the people of Saki west local government area of Oyo State, Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  15. Self-esteem Mediates Associations of Physical Activity with Anxiety in College Women

    National Research Council Canada - National Science Library

    HERRING, MATTHEW P; O’CONNOR, PATRICK J; DISHMAN, RODNEY K

    2014-01-01

    ... with elevated risk for developing an anxiety disorder. METHODSCollege women (N = 1036, mean ± SD = 19.7 ± 2.9 yr) completed a physical activity recall, the Psychiatric Diagnostic Screening Questionnaire, and the Physical Self-Description Questionnaire...

  16. Gclust Server: 93598 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 93598 TET_197.m00071 Cluster Sequences Related Sequences(236) 609 aminotransferase, classe...d sequences Related Sequences(236) Sequence length 609 Representative annotation aminotransferase, classe

  17. Genetics Home Reference: chylomicron retention disease

    Science.gov (United States)

    ... Resources (1 link) CLIMB: Children Living with Inherited Metabolic Diseases ... R, Biselli R, Bosman C. Chylomicron retention disease--the role of ultrastructural examination in differential diagnosis. Pathol Res Pract. 2001;197(11):753-7. ...

  18. Airway Science curriculum demonstration project : summary of initial evaluation findings.

    Science.gov (United States)

    1988-10-01

    The performance, perceptions, and characteristics of Airway Science hires were compared with those of traditional hires. As of May 12, 1987. a total of 197 Airway Science candidates had been selected into FAA occupations. The demographic characterist...

  19. Evaluation of culture-proven neonatal sepsis at a tertiary care ...

    African Journals Online (AJOL)

    . *Unless otherwise specified. Table 2. Organisms causing neonatal sepsis. Organism. Neonatal sepsis (N=236), n (%). EOS (N=39), n (%). LOS (N=197), n (%). Gram-positive. CONS. MRSA. Enterococcus faecalis. GBS. Enterococcus faecium.

  20. Activation cross-sections of deuteron induced nuclear reactions on gold up to 40 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Tarkanyi, F. [Institute of Nuclear Research of the Hungarian Academy of Sciences (ATOMKI), Debrecen (Hungary); Ditroi, F., E-mail: ditroi@atomki.hu [Institute of Nuclear Research of the Hungarian Academy of Sciences (ATOMKI), Debrecen (Hungary); Hermanne, A. [Cyclotron Laboratory, Vrije Universiteit Brussel (VUB), Brussels (Belgium); Takacs, S.; Kiraly, B. [Institute of Nuclear Research of the Hungarian Academy of Sciences (ATOMKI), Debrecen (Hungary); Yamazaki, H.; Baba, M.; Mohammadi, A. [Cyclotron and Radioisotope Center (CYRIC), Tohoku University, Sendai (Japan); Ignatyuk, A.V. [Institute of Physics and Power Engineering (IPPE), Obninsk (Russian Federation)

    2011-06-15

    Cross-sections of deuteron induced nuclear reactions on gold were measured up to 40 MeV by using the standard stacked foil irradiation technique and high resolution gamma-ray spectroscopy. Experimental cross-sections and derived integral yields are reported for the {sup 197}Au(d,xn){sup 197m,197g,195m,195g}Hg and {sup 197}Au(d,x){sup 198g,196m,196g,195,194}Au nuclear reactions. The experimental data are analyzed and compared to literature and predictions of the ALICE-IPPE, EMPIRE and TALYS theoretical model codes. The application of the new cross-sections for accelerator technology, medical radioisotope production, thin layer activation and dose calculation is discussed.

  1. Resource needs for regulations on Kenai National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Kenai National Wildlife Refuge (NWR) is one unit of the national wildlife refuge system. Its large size (1.97 million acres), wilderness dependent wildlife, and...

  2. 76 FR 7810 - Certain Hot-Rolled Carbon Steel Flat Products From India: Notice of Court Decision Not in Harmony...

    Science.gov (United States)

    2011-02-11

    ...) (``Essar I''). See Essar Steel Limited v. United States, Slip Op. 11-10, Court No. 09-197 (January 25, 2011... that Essar did not benefit from the CIP, cast ``grave doubt'' upon the Department's findings that Essar...

  3. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 30; Issue 3. Issue front cover thumbnail. Volume 30, Issue 3. June 2007, pages 197-299. pp 197-203 Magnetic Properties. Bulk magnetic properties of CdFe2O4 in nano-regime · Rucha Desai R V Mehta R V Upadhyay Amita Gupta A Praneet K V Rao · More Details ...

  4. EST Table: AU005681 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AU005681 ws31019 10/09/28 56 %/197 aa ref|NP_001164308.1| painless [Tribolium castaneum] gb|EFA02836.1| pain...gnl|Amel|GB10136-PA 10/09/10 56 %/197 aa gi|270006388|gb|EFA02836.1| painless [Tribolium castaneum] FS757636 ws3 ... ...less [Tribolium castaneum] 10/08/28 40 %/207 aa FBpp0138424|DereGG19878-PA 10/08/27

  5. Influence of IL17A polymorphisms on the aberrant methylation of DAPK and CDH1 in non-cancerous gastric mucosa

    Directory of Open Access Journals (Sweden)

    Arisawa Tomiyasu

    2012-07-01

    Full Text Available Abstract Background CpG island aberrant methylation is shown to be an important mechanism in gene silencing. The important role of IL-17 in inflammatory response to H. pylori colonization has been indicated. We investigated the influence of IL17A polymorphisms, -197 G > A (rs2275913 and *1249 C > T (rs3748067, on the methylation of DAPK and CDH1. Methods Gastric mucosal samples were obtained from 401 subjects without malignancies. Methylation status of gene was determined by MSP. The genotyping of IL17A was performed by PCR-SSCP. Results Methylations of DAPK and CDH1 were seen in 196 and 149 of all 401 subjects, respectively. Overall, *1249 T carrier was associated with a decreased risk for DAPK methylation, whereas -197 G > A was not. In the subjects older than 60 years old, *1249 T carrier was more strongly associated with gene methylation and -197 A carrier tended to be associated with an increased risk for CDH1 methylation. When evaluating by inflammation promoting haplotype (-197 mutant carrier with *1249 homozygote, this haplotype had a more strongly increased risk for both DAPK and CDH1 methylations in comparatively older subjects. Both atrophy and metaplasia scores were significantly increased with age in -197 A carrier or *1249 CC homozygote, whereas were not in -197 GG homozygote or *1249 T carrier. PG I/II ratio was more significantly decreased in -197 A carrier than in GG homozygote under influence of H. pylori infection. Conclusions In -197 A allele carrier with *1249 CC homozygote, the methylations of both DAPK and CDH1 may be increased gradually, but more rapidly than the other genotypes, with age and altered gastric mucosal structure induced by H. pylori infection.

  6. Behavior and Effectiveness of First-Line Supervisors

    Science.gov (United States)

    1985-11-01

    Stogdill’s Handbook of Leadership , has reviewed much of the leadership trait literature. In Bass’ extension, many leader traits are described along...identification of traits has not proven very useful in predicting leader effectiveness in the past ( Stogdill , 197’f), it may be worthwhile to reopen this line...Abelson, M. A. (198^^). Contextual model of leadership in hospital units. Academy of Management Journal, 27, 57-78. Stogdill , R. M. (197

  7. NCBI nr-aa BLAST: CBRC-OCUN-01-0782 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0782 ref|YP_797515.1| Prolipoprotein diacylglyceryltransferase [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801264.1| Prolipoprotein diacylglyceryltransferase [Leptospira borgpeter...senii serovar Hardjo-bovis JB197] gb|ABJ78582.1| Prolipoprotein diacylglyceryltransferase [Leptospira borgpeter...in diacylglyceryltransferase [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_797515.1 3.3 35% ...

  8. Proceedings of the 20th International Conference on Defects in Semiconductors Held in Berkeley, CA, USA, 26-30 July 1999

    Science.gov (United States)

    1999-07-30

    Nitrogen-cooled Germanium detector, as de- scribed elsewhere [7]. The laser line and the QW luminescence are separated through bandpass filters. The...complexes induced by diffusion of group I acceptors into CdTe H. Wolf, T. Filz, J. Hamann, S. Lany, V. Ostheimer and Th. Wiehert 843 Intra-shell...Luminescence and influence of defect concentration on excitons in 197Hg/197Au-doped CdTe J. Hamann, A. Burchard, M. Deicher, T. Filz, V. Ostheimer, F

  9. AcEST: DK961409 [AcEST

    Lifescience Database Archive (English)

    Full Text Available lodextrin glycosyltransferase OS=... 45 0.003 tr|B2AYY9|B2AYY9_PODAN Predicted CDS ...enophora tri... 46 0.002 tr|Q9F5W3|Q9F5W3_BACCI Cyclodextrin glucanotransferase OS=Bacill... 45 0.003 tr|Q197W1|Q197W1_9BACI Beta-cyc

  10. PHYTOCHEMICAL SCREENING AND THROMBOLYTIC ACTIVITY ...

    African Journals Online (AJOL)

    2014-12-31

    Dec 31, 2014 ... S. Dibyajyoti et al. J Fundam Appl Sci. 2014, 6(2), 208-219. 215. Independent Samples Test. % of Clot lysis. Equal variances assumed. Equal variances not assumed. Levene's Test for. Equality of. Variances. F. 5.950. Sig. 0.025 t-test for Equality of Means. T. -197.372. -197.372. Df. 18. 14.444. Sig. (2-tailed).

  11. Gclust Server: 199619 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 199619 TPS_24428 Cluster Sequences - 197 estExt_fgenesh1_pg.C_chr_120047 1 1.00e-99... 0.0 11.11 0.0 0.0 0.0 0.0 Show 199619 Cluster ID 199619 Sequence ID TPS_24428 Link to cluster sequences Clu...ster Sequences Link to related sequences - Sequence length 197 Representative annotation estExt_fgenesh1_pg.

  12. Identification of diphtheria toxin R domain mutants with enhanced inhibitory activity against HB-EGF.

    Science.gov (United States)

    Suzuki, Keisuke; Mizushima, Hiroto; Abe, Hiroyuki; Iwamoto, Ryo; Nakamura, Haruki; Mekada, Eisuke

    2015-05-01

    Heparin-binding epidermal growth factor-like growth factor (HB-EGF), a ligand of EGF receptor, is involved in the growth and malignant progression of cancers. Cross-reacting material 197, CRM197, a non-toxic mutant of diphtheria toxin (DT), specifically binds to the EGF-like domain of HB-EGF and inhibits its mitogenic activity, thus CRM197 is currently under evaluation in clinical trials for cancer therapy. To develop more potent DT mutants than CRM197, we screened various mutant proteins of R domain of DT, the binding site for HB-EGF. A variety of R-domain mutant proteins fused with maltose-binding protein were produced and their inhibitory activity was evaluated in vitro. We found four R domain mutants that showed much higher inhibitory activity against HB-EGF than wild-type (WT) R domain. These R domain mutants suppressed HB-EGF-dependent cell proliferation more effectively than WT R domain. Surface plasmon resonance revealed their higher affinity to HB-EGF than WT R domain. CRM197(R460H) carrying the newly identified mutation showed increased cell proliferation inhibitory activity and affinity to HB-EGF. These results suggest that CRM197(R460H) or other recombinant proteins carrying newly identified mutation(s) in the R domain are potential therapeutics targeting HB-EGF. © The Authors 2014. Published by Oxford University Press on behalf of the Japanese Biochemical Society. All rights reserved.

  13. Bensulfuron-methyl resistant Sagittaria trifolia L.: Multiple resistance, cross-resistance and molecular basis of resistance to acetolactate synthase-inhibiting herbicides

    Directory of Open Access Journals (Sweden)

    Fu Danni

    2017-01-01

    Full Text Available Acetolactate synthase (ALS-inhibiting herbicides play an important role in controlling broad-leaved weeds. Populations of Sagittaria trifolia L. showed resistance to ALS-inhibiting sulfonylurea herbicides (e.g. bensulfuron-methyl in paddy fields in the northeast of China. In our study, whole-plant bioassays were performed on eight suspected resistant S. trifolia populations that showed high levels of resistance to bensulfuron-methyl, with resistance indices from 31.06 to 120.35. The results of ALS-activity assays were consistent with the observed whole-plant dose-response data. This confirmed that resistant populations displayed significantly higher ALS activity than the sensitive population due to prevention of normal enzyme-herbicide interaction. The mutations Pro-197-Ser, Pro-197-His, Pro-197-Thr and Pro-197-Leu were identified in the ALS gene of resistant populations. Pro-197-His and Pro-197-Thr mutations conferring resistance to bensulfuron-methyl are reported for the first time in S. trifolia. All resistant populations were resistant to sulfonylurea (SU herbicides, but not to imidazolinone (IMI herbicides. HLJ-5 and JL-3 populations were resistant to bispyribac-sodium of the pyrimidinyl-thiobenozoate (PTB class of ALS herbicides, JL-2 to penoxsulam of triazolopyrimidine (TP class and JL-1 to pyribenzoxim, also of PTB class. The eight S. trifolia populations were susceptible to other herbicide modes of action tested.

  14. Optimizing MIBG therapy of neuroendocrine tumors: preclinical evidence of dose maximization and synergy

    Energy Technology Data Exchange (ETDEWEB)

    Mairs, Rob J. [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)], E-mail: r.mairs@beatson.gla.ac.uk; Boyd, Marie [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)

    2008-08-15

    [{sup 131}I]meta-Iodobenzylguanidine ([{sup 131}I]MIBG) has been used for the therapy of tumors of neuroectodermal origin since the 1980s. Its role in the management of these malignancies remains controversial because of the large variation in response rates. Appreciation of the mode of conveyance of [{sup 131}I]MIBG via the noradrenaline transporter into malignant cells and of factors that influence the activity of the uptake mechanism has indicated various ways in which the effectiveness of this type of targeted radiotherapy may be improved. Experimental observations indicate that radiolabeling of MIBG to high specific activity reduced the amount of cold competitor, thereby increasing tumor dose and minimizing pressor effects. We observed supra-additive tumor cell kill and inhibition of tumor growth following combined topotecan and [{sup 131}I]MIBG treatment. The improved efficacy is related to topotecan's increased disruption of DNA repair. Radiation damage to targeted tumors may also be enhanced by the use of the {alpha}-particle emitter [{sup 211}At]astatine rather than {sup 131}I as radiolabel. Furthermore, recent experimental findings indicate that [{sup 123}I]MIBG may have therapeutic potential over and above its utility as an imaging agent. It has recently been demonstrated that potent cytotoxic bystander effects were induced by the intracellular concentration of [{sup 131}I]MIBG, [{sup 123}I]MIBG or meta-[{sup 211}At]astatobenzylguanidine. Identification of the nature of bystander factors could be exploited to maximize the specificity and potency of MIBG-targeted radiotherapy. By employing a range of strategies, there are good prospects for the improvement of the [{sup 131}I]MIBG therapy of neuroectodermal tumors.

  15. Immuno-vectorization of radioelements emitters of alpha particles: a new therapy in cancerology; Immunovectorisation de radioelements emetteurs de particules alpha: une nouvelle voie therapeutique en cancerologie

    Energy Technology Data Exchange (ETDEWEB)

    Bourgeois, M

    2007-05-15

    The radio-immunotherapy is an anti cancerous therapy which consists in vectorising with immuno-specific agents very radio toxic radioelements on tumors or in their environment to destroy them. The first part of this report presents the different characteristics of antibodies as well as their means of production under monoclonal shapes specifically steered against a tumoral antigen of interest. The second part of this report replaces the importance of the immunological vectors in the context of the nuclear medicine. It is notably described that the different methods which allow to radio-label the vector, as well as the different ways of optimization which were envisaged to improve the targeting of radioelements on a tumor. These different developments allow to define the potential place of the alpha radio-immunotherapy in treatments and so re-place the interest of the experimental part. If the radio-immunotherapy, using beta emitters isotopes as the {sup 131}iodine or the{sup 90}yttrium, is today current in anti cancerous therapy, it finds limits because of the disintegration characteristics of the isotopes it uses. Indeed, compared with alpha particles, the beta particles deposit less energy by unit of length in the crossed material.The experimental part of this report aims at studying the feasibility of the coupling between an immunological vector and an alpha emitter isotope.The different tests led on the bismuth 213, the bismuth 212, the lead 212 and the astatine 211 demonstrated that the fixation of these radionuclides was possible. This research theme is strengthened by the construction in Nantes of a cyclotron with high energy ( A.R.R.O.N.A.X.) and the optimization of the obtained promising results should allow a therapeutic use in oncology of the alpha radio-immunotherapy. (N.C.)

  16. Locoregional therapy with α-emitting trastuzumab against peritoneal metastasis of human epidermal growth factor receptor 2-positive gastric cancer in mice.

    Science.gov (United States)

    Li, Huizi Keiko; Morokoshi, Yukie; Nagatsu, Kotaro; Kamada, Tadashi; Hasegawa, Sumitaka

    2017-08-01

    Peritoneal metastasis of gastric cancer (PMGC) is incurable and thus has an extremely poor prognosis. We have found, however, that locoregionally administered trastuzumab armed with astatine-211 ((211) At-trastuzumab) is effective against human epidermal growth factor receptor 2 (HER2)-positive PMGC in a xenograft mouse model. We first observed that (211) At-trastuzumab can specifically bind and effectively kill NCI-N87 (N87) cells, which are HER2-positive human metastatic GC cells, both in vitro and in s.c. tumors. We established a PMGC mouse model using N87 xenografts stably expressing luciferase to test α-particle radioimmunotherapy with (211) At-trastuzumab against PMGC. Biodistribution analysis in this PMGC mouse model revealed that the i.p. administration of (211) At-trastuzumab (1 MBq) was a more efficient means of delivery of (211) At into metastatic tumors than i.v. injection; the maximum tumor uptake with i.p. administration was over 60% injected dose per gram of tissue (%ID/g) compared to approximately 18%ID/g with i.v. injection. Surprisingly, a single i.p. injection of (211) At-trastuzumab (1 MBq) was sufficient to completely eradicate intraperitoneally disseminated HER2-positive GC xenografts in two of six treated mice by inducing DNA double-strand breaks, and to drastically reduce the tumor burden in another three mice. No bodyweight loss, leukocytopenia, or significant biochemical changes in liver or kidney function were observed in the treatment group. Accordingly, locoregionally administered (211) At-trastuzumab significantly prolonged the survival time of HER2-positive PMGC mice compared with control treatments. Our results provide a proof-of-concept demonstration that locoregional therapy with (211) At-trastuzumab may offer a new treatment option for HER2-positive PMGC. © 2017 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.

  17. A genetic variant in the IL-17 promoter is functionally associated with acute graft-versus-host disease after unrelated bone marrow transplantation.

    Directory of Open Access Journals (Sweden)

    J Luis Espinoza

    Full Text Available Interleukin IL-17 is a proinflammatory cytokine that has been implicated in the pathogenesis of various autoimmune diseases. The single nucleotide polymorphism (SNP, rs2275913, in the promoter region of the IL-17 gene is associated with susceptibility to ulcerative colitis. When we examined the impact of rs2275913 in a cohort consisting of 438 pairs of patients and their unrelated donors transplanted through the Japan Marrow Donor Program, the donor IL-17 197A allele was found to be associated with a higher risk of acute graft-versus-host disease (GVHD; hazard ratio [HR], 1.46; 95% confidence interval [CI], 1.00 to 2.13; P = 0.05. Next, we investigated the functional relevance of the rs2275913 SNP. In vitro stimulated T cells from healthy individuals possessing the 197A allele produced significantly more IL-17 than those without the 197A allele. In a gene reporter assay, the 197A allele construct induced higher luciferase activity than the 197G allele, and the difference was higher in the presence of T cell receptor activation and was abrogated by cyclosporine treatment. Moreover, the 197A allele displayed a higher affinity for the nuclear factor activated T cells (NFAT, a critical transcription factor involved in IL-17 regulation. These findings substantiate the functional relevance of the rs2275913 polymorphism and indicate that the higher IL-17 secretion by individuals with the 197A allele likely accounts for their increased risk for acute GVHD and certain autoimmune diseases.

  18. Expression of self-complementary hairpin RNA under the control of the rolC promoter confers systemic disease resistance to plum pox virus without preventing local infection

    Directory of Open Access Journals (Sweden)

    Spena Angelo

    2003-06-01

    Full Text Available Abstract Background Homology-dependent selective degradation of RNA, or post-transcriptional gene silencing (PTGS, is involved in several biological phenomena, including adaptative defense mechanisms against plant viruses. Small interfering RNAs mediate the selective degradation of target RNA by guiding a multicomponent RNAse. Expression of self-complementary hairpin RNAs within two complementary regions separated by an intron elicits PTGS with high efficiency. Plum pox virus (PPV is the etiological agent of sharka disease in Drupaceae, although it can also be transmitted to herbaceous species (e.g. Nicotiana benthamiana. Once inside the plant, PPV is transmitted via plasmodesmata from cell to cell, and at longer distances, via phloem. The rolC promoter drives expression in phloem cells. RolC expression is absent in both epidermal and mesophyll cells. The aim of the present study was to confer systemic disease resistance without preventing local viral infection. Results In the ihprolC-PP197 gene (intron hair pin rolC PPV 197, a 197 bp sequence homologous to the PPV RNA genome (from base 134 to 330 was placed as two inverted repeats separated by the DNA sequence of the rolA intron. This hairpin construct is under the control of the rolC promoter.N. benthamiana plants transgenic for the ihprolC-PP197 gene contain siRNAs homologous to the 197 bp sequence. The transgenic progeny of ihprolC-PP197 plants are resistant to PPV systemic infection. Local infection is unaffected. Most (80% transgenic plants are virus free and symptomless. Some plants (20% contain virus in uninoculated apical leaves; however they show only mild symptoms of leaf mottling. PPV systemic resistance cosegregates with the ihprolC-PP197 transgene and was observed in progeny plants of all independent transgenic lines analyzed. SiRNAs of 23–25 nt homologous to the PPV sequence used in the ihprolC-PP197 construct were detected in transgenic plants before and after inoculation

  19. [The Relationship of Polymorphisms in Interleukin 17A Gene, Interleukin 17F Gene and the Pulmonary Inflammation Risk in Dust Exposed Workers in a Chinese Population].

    Science.gov (United States)

    Xu, Wen-Li; Zhang, Qin; Huang, Cheng-Jun; Lan, Ya-Jia; Wang, Yong-Wei; Xiong, Lin-Sen

    2017-01-01

    To investigate the polymorphisms in interleukin 17A IL-17A) and interleukin 17F (IL-17F) and their relationship with pulmonary inflammation risk of dust exposed workers. A case-control study among 193 subjects, including 67 subjects in case group and 126 in control group was conducted. PCR-RFLP was applied to genotype IL-17A (G-197A) and IL-17F (7488T/C). Logistic regression analysis was used to determine the effects of IL-17A (G-197A) and IL-17F (7488T/C) on the lung inflammation risk in dust exposed workers. The genotypes analysis showed that the proportions of IL-17A (G-197A) A/A, A/G and G/G were 42 (21.76%), 95 (49.22%), 56 (29.02%) in 193 cases, respectively, and the IL-17F (7488T/C) T/T, T/C and C/C genotypes were 128 (66.32%), 54 (28.98%), 11 (5.70%), respectively. The frequency distribution of each genotype was consistent with the Hardy-Weinberg equilibrium fixed law. The ratio of IL-17A (G-197A) A/A in the case group was lower than that of control group ( P0.05). Under the same dust concentration, the dust exposed workers carrying IL-17A (G-197A) A/G, G/G genotypes are more susceptible to pulmonary inflammation in the southwest of China.

  20. Association between Polymorphisms in Interleukin-17A and -17F Genes and Chronic Periodontal Disease

    Directory of Open Access Journals (Sweden)

    Jôice Dias Corrêa

    2012-01-01

    Full Text Available Objective. Interleukin-17 (IL-17 is a cytokine that induces neutrophil recruitment and the release of inflammatory mediators in several inflammatory conditions; nevertheless, the involvement of IL-17 gene polymorphisms in chronic periodontitis (CP has not been addressed yet. Our aim was to evaluate the association between periodontal status and the polymorphisms IL-17A G197A and IL-17F C7488T in subjects with CP along with their impact on levels of inflammatory mediators. Material and Methods. Genomic DNA was obtained from 30 CP patients and 30 healthy controls (HCs. IL-17A G197A and IL-17F C7488T polymorphisms were determined using PCR-RFLP. Serum and periodontal tissues were collected and processed for ELISA, myeloperoxidase (MPO, and/or microscopic analysis. Results. The frequencies of genotypes in the CP group were significantly different from those of HC. Odds ratio indicated that increased risks for CP were associated with the -197A allele, not with the -7488T allele. In addition, the -197A allele was correlated with worse clinical parameters, higher MPO activity, and increased expression of inflammatory mediators (IL-17A and IL-8 than the other genotypes. Conclusions. These results indicate that the IL-17A -197A allele is associated with increased risk for CP, likely because this genotype relates to the enhanced inflammation in periodontal tissues.

  1. Thermal-neutron cross sections and resonance integrals of {sup 138}Ba and {sup 141}Pr using Am-Be neutron source

    Energy Technology Data Exchange (ETDEWEB)

    Panikkath, Priyada; Mohanakrishnan, P. [Manipal University, Manipal Centre for Natural Sciences, Karnataka (India)

    2016-09-15

    The thermal-neutron capture cross sections and resonance integrals of {sup 138}Ba(n, γ){sup 139}Ba and {sup 141}Pr(n, γ){sup 142}Pr were measured by activation method using an isotopic Am-Be neutron source. The estimations were with respect to that of {sup 55}Mn(n, γ){sup 56}Mn and {sup 197}Au(n, γ){sup 198}Au reference monitors. The measured thermal-capture cross section of {sup 138}Ba with respect to {sup 55}Mn is 0.410±0.023 b and with respect to {sup 197}Au is 0.386±0.019 b. The measured thermal-capture cross section of {sup 141}Pr with respect to {sup 55}Mn is 11.36±1.29 b and with respect to {sup 197}Au is 10.43±1.14 b. The resonance integrals for {sup 138}Ba are 0.380±0.033 b ({sup 55}Mn) and 0.364±0.027 b ({sup 197}Au) and for {sup 141}Pr are 21.05±2.88 b ({sup 55}Mn) and 15.27±1.87 b ({sup 197}Au). The comparison between the present measurements and various reported values are discussed. The cross sections corresponding to the selected isotopes are measured using an Am-Be source facility for the first time. (orig.)

  2. Modal Decomposition of Synthetic Jet Flow Based on CFD Computation

    Directory of Open Access Journals (Sweden)

    Hyhlík Tomáš

    2015-01-01

    Full Text Available The article analyzes results of numerical simulation of synthetic jet flow using modal decomposition. The analyzes are based on the numerical simulation of axisymmetric unsteady laminar flow obtained using ANSYS Fluent CFD code. Three typical laminar regimes are compared from the point of view of modal decomposition. The first regime is without synthetic jet creation with Reynolds number Re = 76 and Stokes number S = 19.7. The second studied regime is defined by Re = 145 and S = 19.7. The third regime of synthetic jet work is regime with Re = 329 and S = 19.7. Modal decomposition of obtained flow fields is done using proper orthogonal decomposition (POD where energetically most important modes are identified. The structure of POD modes is discussed together with classical approach based on phase averaged velocities.

  3. The B-cell response to a primary and booster course of MenACWY-CRM₁₉₇ vaccine administered at 2, 4 and 12 months of age.

    Science.gov (United States)

    Blanchard-Rohner, Geraldine; Snape, Matthew D; Kelly, Dominic F; O'Connor, Daniel; John, Tessa; Clutterbuck, Elizabeth A; Ohene-Kena, Brigitte; Klinger, Chaam L; Odrljin, Tatjana; Pollard, Andrew J

    2013-05-07

    A quadrivalent meningococcal vaccine conjugated to CRM197 (MenACWY-CRM197) is immunogenic in young infants. We assessed the memory B-cell and antibody responses after a primary and booster course of MenACWY-CRM197 in children. At 5 months of age, following primary immunisation, serogroup-specific memory B-cells were detectable in fewer than 25% of children, although protective antibody titres (hSBA ≥ 4) were detectable in 69% of children against serogroup A and more than 95% against the other serogroups. At 12 months, before booster immunisation the percentages with hSBA ≥ 4 were 5% for serogroup A, and between 44 and 70% for the other serogroups. One month after booster immunisation with MenACWY-CRM197 over 50% of children had detectable memory B-cells, and 91% had hSBA ≥ 4 against serogroup A and more than 99% against the other serogroups. These data show that few antigen-specific anticapsular memory B-cells can be detected after two-doses priming with MenACWY-CRM197. For MenC and CRM197, the antigens with the highest number of B-cells at 5 months, there was a definite (p ≤0 .02) but weak correlation with antibody persistence at 12 months. Although previous studies suggest that measuring memory B-cell responses after priming immunisations in infancy can be used to predict antibody persistence and memory responses, this may not be suitable for all antigens in young children. Copyright © 2013 Elsevier Ltd. All rights reserved.

  4. Impact of momentum dependent equation of state and isospin-dependent cross-section on the neutron-proton Pt-differential elliptic flow

    Science.gov (United States)

    Vinayak, Karan S.; Kumar, Suneel

    2013-04-01

    We made a descriptive theoretical analysis for the transverse momentum dependence of elliptic flow (ν2) of neutrons and protons within the framework of isospin-dependent quantum molecular dynamics (IQMD) model. Simulations are carried out for the symmetric reactions of 124Sn+124Sn and 197Au+197Au. We demonstrate the effect of momentum dependent interactions (MDI) as well as of nucleonic cross-sections (isospin-dependent & independent) on the elliptical flow. The MDI and different forms of cross-section are found to affect the elliptical flow of both protons and neutrons considerably.

  5. TRADOC Union List of Periodicals.

    Science.gov (United States)

    1988-08-01

    TRW 1969-1983 (MF). Construction in Maryland/D.C./Virginia/North Carolina TRB 1982-1983;1985+ (’onstructioneer TRB 1982-1983;1985+ Constructor TRB...197P+ TRH Apr 1962+ TSB 1956-ApTr 1964 TSO 1983+ TTF Sep 196 7 -no. 6, 197- n: 19--. TTG v. 1, 1965+ Sentine ’Canada (continues " ana (ian Army ourna1...l 76+ Seriia Literatury 1 lazyka, Izvest:ia Akademii nauk SSSR TSL 0321-1711 39:1 11980) - 44:6 i1985) T40:2,5; 41:1,3-4; 43: Ses: Cinema Theatre 3

  6. Flood Tolerance in Plants: A State-of-the-Art Review

    Science.gov (United States)

    1979-08-01

    domestic crop plants, aquatic macrophyt(:s, and shrubs- and trees are capable of producing anatomical and n"’rphological modifications that enhance...Kawase (197(2a, 197Th-I, 19’(4, 1976, 1977) has found that ethylene accumulates" in stems of’ crabapple ( Malus robusta), privet (Ligustrum. obtusifoliuxn...gi.no:aiLm SlightLy ToLlerantt 1 Riverbank mugwort Arteinesia lindleyana Niettall’s dogwoodis Cornus nuttallii Walnut* JuliS pp. Appl3 ~# malus ’ S-pp

  7. Fragment Kinetic Energies and Modes of Fragment Formation

    Science.gov (United States)

    Odeh, T.; Bassini, R.; Begemann-Blaich, M.; Fritz, S.; Gaff-Ejakov, S. J.; Gourio, D.; Groß, C.; Immé, G.; Iori, I.; Kleinevoß, U.; Kunde, G. J.; Kunze, W. D.; Lynen, U.; Maddalena, V.; Mahi, M.; Möhlenkamp, T.; Moroni, A.; Müller, W. F.; Nociforo, C.; Ocker, B.; Petruzzelli, F.; Pochodzalla, J.; Raciti, G.; Riccobene, G.; Romano, F. P.; Saija, A.; Schnittker, M.; Schüttauf, A.; Schwarz, C.; Seidel, W.; Serfling, V.; Sfienti, C.; Trautmann, W.; Trzcinski, A.; Verde, G.; Wörner, A.; Xi, Hongfei; Zwieglinski, B.

    2000-05-01

    Kinetic energies of light fragments ( A<=10) from the decay of target spectators in 197Au+197Au collisions at 1000 MeV per nucleon have been measured with high-resolution telescopes at backward angles. Except for protons and apart from the observed evaporation components, the kinetic-energy spectra exhibit slope temperatures of about 17 MeV, independent of the particle species, but not corresponding to the thermal or chemical degrees of freedom at breakup. It is suggested that these slope temperatures may reflect the intrinsic Fermi motion and thus the bulk density of the spectator system at the instant of becoming unstable.

  8. Role of cyclins in neuronal differentiation of immortalized hippocampal cells.

    OpenAIRE

    Xiong, W; Pestell, R; Rosner, M R

    1997-01-01

    The proto-oncogene cyclin D1 and the neuron-specific cyclins p35 and p39 are expressed during brain maturation. To investigate the role of these cyclins in neuronal differentiation, we used a conditionally immortalized rat hippocampal cell line, H19-7, that expresses cyclin-dependent kinases 4 and 5 (cdk4 and -5). Cyclin D1, which activates cdk4 and binds but does not activate cdk5, was increased upon differentiation of the H19-7 cells. However, microinjection of either sense or antisense cyc...

  9. Stemcell Information: SKIP000843 [SKIP Stemcell Database[Archive

    Lifescience Database Archive (English)

    Full Text Available GBA+/N370S 10001.197.01 10001.197.01 パーキンソン病 G20 Parkinson Disease 168600 ... 68 60-69 Male Ashkenazi J...ewish ... Ashkenazi Jewish ... Yes No Transgene-free iPS cells from Monozygotic twin brother of Parkinson Disease ....023 iPSC-derived dopamine neurons reveal differences between monozygotic twins discordant for Parkinson...patient.Using CytoTune iPS Sendai reprogramming protocol (Life Technologies). パーキンソン

  10. NCBI nr-aa BLAST: CBRC-HSAP-07-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-07-0021 ref|YP_798483.1| hypothetical protein LBL_2137 [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801392.1| hypothetical protein LBJ_2143 [Leptospira borgpeterseni...i serovar Hardjo-bovis JB197] gb|ABJ79550.1| Conserved hypothetical protein [Leptospira borgpetersenii serov...ar Hardjo-bovis L550] gb|ABJ76634.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_798483.1 0.026 28% ...

  11. NCBI nr-aa BLAST: CBRC-OCUN-01-1280 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-1280 ref|YP_798310.1| hypothetical protein LBL_1947 [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801037.1| hypothetical protein LBJ_1728 [Leptospira borgpeterseni...i serovar Hardjo-bovis JB197] gb|ABJ79377.1| Conserved hypothetical protein [Leptospira borgpetersenii serov...ar Hardjo-bovis L550] gb|ABJ76279.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_798310.1 4.1 31% ...

  12. NCBI nr-aa BLAST: CBRC-TSYR-01-0989 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-0989 ref|YP_796828.1| hypothetical protein LBL_0283 [Leptospira borgpeter...senii serovar Hardjo-bovis L550] ref|YP_801953.1| hypothetical protein LBJ_2788 [Leptospira borgpeterseni...i serovar Hardjo-bovis JB197] gb|ABJ77895.1| Hypothetical protein LBL_0283 [Leptospira borgpetersenii serova...r Hardjo-bovis L550] gb|ABJ77195.1| Hypothetical protein LBJ_2788 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] YP_796828.1 4.4 38% ...

  13. Didactic Contracts in Realistic Mathematics Education Teaching Practice in Indonesia: A lesson on addition

    DEFF Research Database (Denmark)

    Putra, Zetra Hainul

    This paper aims to investigate characterize features of didactic contracts in realistic mathematics education teaching practice in Indonesia in the case of a lesson on addition. We just focus on some episodes of 26 first grade students and a female teacher from SDN 197 Palembang learning combinat......This paper aims to investigate characterize features of didactic contracts in realistic mathematics education teaching practice in Indonesia in the case of a lesson on addition. We just focus on some episodes of 26 first grade students and a female teacher from SDN 197 Palembang learning...

  14. Passive neutron dosemeter with activation detector

    Energy Technology Data Exchange (ETDEWEB)

    Valero L, C.; Banuelos F, A.; Guzman G, K. A.; Borja H, C. G.; Hernandez D, V. M.; Vega C, H. R., E-mail: fermineutron@yahoo.com [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Calle Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas (Mexico)

    2011-10-15

    A passive neutron dosemeter with {sup 197}Au activation detector has been developed. The area dosemeter was made as a 20.5 {phi} x 20.5 cm{sup 2} polyethylene moderator, with a polyethylene pug where a {sup 197}Au foil can be located either parallel or perpendicular to moderator axis. Using Monte Carlo methods, with the MCNP5 code. With the fluence response and the fluence-to-equivalent dose conversion coefficients from ICRP-74, responses to H*(10) were also calculated, these were compared against responses of commercially available neutron area monitors and dosemeters. (Author)

  15. INDRA-GSI: Collective flow from Fermi to relativistic energies

    Energy Technology Data Exchange (ETDEWEB)

    Lukasik, J.; Trautmann, W.; Begemann-Blaich, M.L.; Bittiger, R.; Gourio, D.; Le Fevre, A.; Lynen, U.; Mueller, W.F.J.; Orth, H.; Sfienti, C.; Schwarz, C.; Turzo, K. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany); Auger, G.; Bouriquet, B.; Chbihi, A.; Frankland, J.D.; Hudan, S.; Lopez, O. [GANIL, CEA et IN2P3-CNRS, 14 - Caen (France); Borderie, B.; Galichet, E.; Lavaud, F.; Plagnol, E. [Paris-11 Univ., Institut de Physique Nucleaire, IN2P3-CNRS, 91 - Orsay (France); Bellaize, N.; Bocage, F.; Bougault, R.; Durand, D.; Hurst, B.; Steckmeyer, J.C.; Tamain, B.; Vient, E. [Caen Univ., LPC (IN2P3-CNRS/ENSI), 14 - Caen (France); Charvet, J.L.; Dayras, R.; Legrain, R.; Nalpas, L.; Volant, C. [CEA Saclay, Dept. d' Astrophysique, de Physique des Particules, de Physique Nucleaire et de l' Instrumentation Associee (DAPNIA/SPhN), 91- Gif sur Yvette (France); Guinet, D.; Lautesse, P. [Institut de Physique Nucleaire, IN2P3-CNRS et Universite, 69 - Villeurbanne (France); Rosato, E.; Vigilante, M. [INFN, Univ. Federico II, Dipartimento di Scienze Fisiche e Sezione, Napoli (Italy); Saija, A. [Universita and INFN I, Dipartimento di Fisica dell' , Catania (Italy); Trzcinski, A.; Zwieglinski, B. [A. Soltan Institute for Nuclear Studies, Warsaw (Poland); Lukasik, J. [H. Niewodniczanski Institute of Nuclear Physics, Krakow (Poland); Galichet, E. [Conservatoire National des Arts et Metiers, 75 - Paris (France)

    2003-07-01

    Directed flow for the {sup 197}Au + {sup 197}Au reactions at incident energies between 40 and 150 A*MeV has been measured using the 4{pi} multi-detector INDRA at the GSI facility. In particular, the bombarding energy at which the elliptic flow switches from in-plane to out-of-plane enhancement has been determined to be around 100 A*MeV in good agreement with the result obtained by the FOPI Collaboration. The new data allows also to extend the experimental excitation function of v{sub 2} to lower energies. (authors)

  16. Chemical Protection Testing of Sorbent-Based Air Purification Components (APCs)

    Science.gov (United States)

    2016-06-24

    36-8), acetic acid (AA, CAS® Number 64-19-7), and ethylene glycol (CAS® Number 107- 21-1). TOP 08-2-197 24 June 2016 A-1 APPENDIX A. TEST...2-197 24 June 2016 E-1 APPENDIX E. ABBREVIATIONS. ∆P differential pressure AA acetic acid AAPTF Advanced Air Purification Test Fixture AC...isobutyl-3-methoxypyrazine (IMP, CAS® Number 24683-00-9), dimethyl methylphosphonate (DMMP, CAS® Number 756-79-6), methyl salicylate (MeS, CAS® Number 119

  17. Operational Energy/Operational Effectiveness Investigation for Scalable Marine Expeditionary Brigade Forces in Contingency Response Scenarios

    Science.gov (United States)

    2014-12-01

    1. CH-53K King Stallion Platform: The team selected the CH-53K because it is a large heavy lift helicopter used for troop and equipment...Ammunition 20-Millimeter.” Last modified January 12. http://www.aircav.com/ cobra /ammo20.html. ———. 2008. “The M197 20mm Automatic Gun.” Last...modified January 12. http://www.aircav.com/ cobra /m197.html Ale 1979. 2012. Wikimedia Commons. Last modified May 08. http://commons.wikimedia.org/wiki

  18. AcEST: DK955136 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tative uncharacterized protein OS=Picea... 197 4e-49 tr|Q5MCR8|Q5MCR8_9ASTR Aluminum-induced protein OS=Codo...=Picea... 197 5e-49 tr|A8IXL5|A8IXL5_BRACM Aluminum-induced protein OS=Brassica camp... 196 6e-49 tr|O64438|... protein OS=Ara... 194 2e-48 tr|O64461|O64461_BRANA Aluminum-induced OS=Brassica ...rotein OS=Physcomitrella paten... 189 1e-46 tr|B3TLT4|B3TLT4_ELAGV Aluminum-induc

  19. Quantitative Single-Particle Digital Autoradiography with α-Particle Emitters for Targeted Radionuclide Therapy using the iQID Camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W.; Frost, Sophia; Frayo, Shani; Kenoyer, Aimee L.; Santos, E. B.; Jones, Jon C.; Green, Damian J.; Hamlin, Donald K.; Wilbur, D. Scott; Fisher, Darrell R.; Orozco, Johnnie J.; Press, Oliver W.; Pagel, John M.; Sandmaier, B. M.

    2015-07-01

    Abstract Alpha emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm) causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with alpha emitters may inactivate targeted cells with minimal radiation damage to surrounding tissues. For accurate dosimetry in alpha-RIT, tools are needed to visualize and quantify the radioactivity distribution and absorbed dose to targeted and non-targeted cells, especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, iQID (ionizing-radiation Quantum Imaging Detector), for use in alpha-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection technology that images and identifies charged-particle and gamma-ray/X-ray emissions spatially and temporally on an event-by-event basis. It employs recent advances in CCD/CMOS cameras and computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, we evaluated this system’s characteristics for alpha particle imaging including measurements of spatial resolution and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 (211At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ~20 μm full width at half maximum (FWHM) and the alpha particle background was measured at a rate of (2.6 ± 0.5) × 10–4 cpm/cm2 (40 mm diameter detector area). Simultaneous imaging of multiple tissue sections was performed using a large-area iQID configuration (ø 11.5 cm

  20. Quantitative single-particle digital autoradiography with α-particle emitters for targeted radionuclide therapy using the iQID camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W., E-mail: brian.miller@pnnl.gov [Pacific Northwest National Laboratory, Richland, Washington 99354 and College of Optical Sciences, The University of Arizona, Tucson, Arizona 85719 (United States); Frost, Sofia H. L.; Frayo, Shani L.; Kenoyer, Aimee L.; Santos, Erlinda; Jones, Jon C.; Orozco, Johnnie J. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 (United States); Green, Damian J.; Press, Oliver W.; Pagel, John M.; Sandmaier, Brenda M. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 and Department of Medicine, University of Washington, Seattle, Washington 98195 (United States); Hamlin, Donald K.; Wilbur, D. Scott [Department of Radiation Oncology, University of Washington, Seattle, Washington 98195 (United States); Fisher, Darrell R. [Dade Moeller Health Group, Richland, Washington 99354 (United States)

    2015-07-15

    Purpose: Alpha-emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm), causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with α emitters may thus inactivate targeted cells with minimal radiation damage to surrounding tissues. Tools are needed to visualize and quantify the radioactivity distribution and absorbed doses to targeted and nontargeted cells for accurate dosimetry of all treatment regimens utilizing α particles, including RIT and others (e.g., Ra-223), especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, the ionizing-radiation quantum imaging detector (iQID) camera, for use in α-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection system that images and identifies charged-particle and gamma-ray/x-ray emissions spatially and temporally on an event-by-event basis. It employs CCD-CMOS cameras and high-performance computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, the authors evaluated its characteristics for α-particle imaging, including measurements of intrinsic detector spatial resolutions and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 ({sup 211}At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ∼20 μm full width at half maximum and the α-particle background was measured at a rate as low as (2.6 ± 0.5) × 10{sup −4} cpm/cm{sup 2} (40 mm diameter detector area

  1. α-Imaging Confirmed Efficient Targeting of CD₄₅-Positive Cells After ²¹¹At-Radioimmunotherapy for Hematopoietic Cell Transplantation

    Energy Technology Data Exchange (ETDEWEB)

    Frost, Sophia; Miller, Brian W.; Back, Tom; Santos, E. B.; Hamlin, Donald K.; Knoblaugh, E.; Frayo, Shani; Kenoyer, Aimee L.; Storb, Rainer; Press, O. W.; Wilbur, D. Scott; Pagel, John M.; Sandmaier, B. M.

    2015-09-03

    Alpha-radioimmunotherapy (α-RIT) targeting CD45 may substitute for total body irradiation in hematopoietic cell transplantation (HCT) preparative regimens for lymphoma. Our goal was to optimize the anti-CD45 monoclonal antibody (MAb; CA12.10C12) protein dose for astatine-²¹¹(²¹¹At)-RIT, extending the analysis to include intra-organ ²¹¹At activity distribution and α-imaging-based small-scale dosimetry, along with imunohistochemical staining. Methods: Eight normal dogs were injected with either 0.75 (n=5) or 1.00 mg/kg (n=3) of ²¹¹At-B10-CA12.10C12 (11.5–27.6 MBq/kg). Two were euthanized and necropsied 19–22 hours postinjection (p.i.), and six received autologous HCT three days after ²¹¹At-RIT, following lymph node and bone marrow biopsies at 2–4 and/or 19 hours p.i. Blood was sampled to study toxicity and clearance; CD45 targeting was evaluated by flow cytometry. ²¹¹At localization and small scale dosimetry were assessed using two α-imaging : α-camera and iQID. Results: Uptake of ²¹¹At was highest in spleen (0.31–0.61 %IA/g), lymph nodes (0.02–0.16 %IA/g), liver (0.11–0.12 %IA/g), and marrow (0.06–0.08 %IA/g). Lymphocytes in blood and marrow were efficiently targeted using either MAb dose. Lymph nodes remained unsaturated, but displayed targeted ²¹¹At localization in T lymphocyte-rich areas. Absorbed doses to blood, marrow, and lymph nodes were estimated at 3.9, 3.0, and 4.2 Gy/210 MBq, respectively. All transplanted dogs experienced transient hepatic toxicity. Liver enzyme levels were temporarily elevated in 5 of 6 dogs; 1 treated with 1.00 mg MAb/kg developed ascites and was euthanized 136 days after HCT. Conclusion: ²¹¹At-anti-CD45 RIT with 0.75 mg MAb/kg efficiently targeted blood and marrow without severe toxicity. Dosimetry calculations and observed radiation-induced effects indicated that sufficient ²¹¹At-B10-CA12.10C12 localization was achieved for efficient conditioning for HCT.

  2. The role of alpha therapy for local and systemic treatment of cancer

    Energy Technology Data Exchange (ETDEWEB)

    Allen, B.J. [St George Hospital, Kogarah, NSW (Australia)

    1998-03-01

    Major problems in the management of cancer relate to the inability to control some primary lesions, e.g. glioblastoma multiforme (GBM), and the inability to deal with metastatic cancer arising from malignant cancers such as melanoma, breast and other cancers. Binary alpha therapy using neutron capture in boron-10 offers the potential for improved prognosis for high grade brain tumours such as GBM and melanoma metastases to the brain. Metastatic cancer proceeds through a number of quite separate stages in the development of lethal disease, i e. cells in transit, preangiogenic lesions, subclinical and clinical lesions. Early stages offer the potential for control if targeted alpha therapy is applied. However, the dose must be localised to the cancer cell and this requirement rules out beta-emitting radionuclides, which are more suited for clinical lesions. Alpha-emitting radionuclides are the most appropriate toxins, as their efficacy depends on the linear energy transfer (LET) and range of the alpha particles. After matching the cancer stage, radiolabel and carrier, we find that {sup 149}Tb is the radionuclide of choice for systemic therapy in all aspects except production. The production of {sup 149}Tb in {mu}Ci (kBq) quantities has been achieved using the heavy ion reaction at the ANU tandem accelerator at Canberra and in multi-mCi (MBq) quantities using the spallation reaction in combination with on-line isotope separation technology of ISOLDE at CERN. Terbium is ideally suited for chelation to monoclonal antibodies to produce stable radio-immunoconjugates (RIC). Astatine-211 is a halide and has potential for the elimination of early stage melanoma metastases as At-MTB. However, the availability of the alpha generators {sup 228}Th-{sup 212}Bi and {sup 225}Ac-{sup 213}Bi facilitates the use of Bi-RIC in clinical trials for acute myeloid leukaemia and cystic glioma. Alpha therapy has the potential to control refractory cancers when treated at the minimum residual

  3. Systematics of Alpha-Radioactivity

    Energy Technology Data Exchange (ETDEWEB)

    Perlman, I.; Ghiorso, A.; Seaborg, G.T.

    1949-09-12

    Correlations of alpha-decay energies in terms of mass number and atomic number have been made for all of the alpha-emitting species now numbering over 100. For each element isotopes show increase in alpha-energy with decrease in mass number except in the region of 126 neutrons where there is an explainable reversal. This reversal has the effect of creating a region of relatively low alpha-energy and long half-life at low mass numbers for such elements as astatine, emanation, francium, and possibly higher elements as had been noted already for bismuth and polonium. Methods and examples of using alpha-decay data to define the energy surface in the heavy element region are discussed. The regularities in alpha-decay are used for predictions of nuclear properties including prediction of the beta-stable nuclides among the heavy elements. The half-life vs. energy correlations show that the even-even nuclides conform well with existing alpha-decay theory, but all nuclear types with odd nucleons show prohibited decay. The reason for this prohibition is not found in spin changes in the alpha-emission but in the assembly of the components of the alpha particle, and this theory is discussed further in terms of observations made on nuclides having two or more alpha-groups. Using most of the even-even nuclei to define 'normal nuclear radius' calculations are now able to show the shrinkage in the regions of lead and of 126 neutrons to amount to about 10%. The much greater change in 'effective radius' for bismuth isotopes can be dissociated into the effects of odd nucleons superimposed on the actual decrease in nuclear radius. The simple expression r = 1.48 A{sup 1/3} {center_dot} 10{sup -13} cm seems to fit the data for the even-even nuclei outside of the region of 126 neutrons better than more complex functions.

  4. Sobre los límites de la protección penal de datos personales

    OpenAIRE

    Anarte Borrallo, Enrique

    2002-01-01

    El artículo 197.2 CP1995 no proporciona una tutela ilimitada de los datos personales. Hay otros preceptos penales implicados. Por otra parte, la garantías extrapenales siguen desempeñando un papel decisivo. En todo caso, a efectos penales, el citado derecho sigue manteniendo vínculos sustanciales con la intimidad.

  5. Dual-Use Telemedicine Support System for Pathology.

    Science.gov (United States)

    1998-12-01

    51 CDRH Center for Devices and Radiological Health 52 CEA Carcino-Embroyonic Antigen 53 CEN European Standards Group 54 CEN/TC 251 Working on spec...Telemedicine and Hospital Information Related Systems Acronyms; 12/10/98 197 MDL MD Lookup 198 MDR MD Retrieval 199 MEDIX MEDical Data InterX (X stands for

  6. The Role of Clothing in Perpetuating Ageism.

    Science.gov (United States)

    Workman, Jane E.; Johnson, Kim K. P.

    1989-01-01

    A study examined 197 college students' impressions of memory skills and personality of older adults and the relation of these impressions to clothing cleanliness and condition. It found that clothing cleanliness and coordination affected attitudes and also interacted with the gender of the older person to affect those impressions. (JOW)

  7. African Journal of Traditional, Complementary and Alternative ...

    African Journals Online (AJOL)

    Effect of the Aqueous Extract of Justicia insularis T. Anders (Acanthaceae) on Ovarian Folliculogenesis and Fertility of Female Rats · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. PB Telefo, SR Tagne, OES Koona, DM Yemele, FM Tchouanguep, 197-203.

  8. An evaluation of calculation procedures affecting the constituent factors of equivalent circulating density for drilling hydraulics

    Energy Technology Data Exchange (ETDEWEB)

    Bailey, William J.

    1996-12-31

    This Dr. ing. thesis covers a study of drilling hydraulics offshore. The purpose of drilling hydraulics is to provide information about downhole pressure, suitable surface pump rates, the quality of hole cleaning and optimum tripping speeds during drilling operations. Main fields covered are drilling hydraulics, fluid characterisation, pressure losses, and equivalent circulating density. 197 refs., 23 figs., 22 tabs.

  9. COMPLICATIONS CHIRURGICALES DES AVORTEMENTS ...

    African Journals Online (AJOL)

    1 janv. 2004 ... The aim of this study was to describe the complications of clandestine abortions and their surgical treatment. It is a retrospective .... In Paul. M, Lichtenberg ES, Borgata l, Grimes DA,. Stubblefield PG. A clinical guide to Medical and. Surgical Abortion. New York: Churchill Livingtone,. 1999, pp. 197-216. 4.

  10. Laparoscopy and hysteroscopy in a Tertiary Hospital: A 4 year review

    African Journals Online (AJOL)

    Results: The total number of patients who had diagnostic laparoscopy within the 4‑year study period was 221, but only 197 files were retrieved, giving a retrieval rate of 89.1%. The total number of patients who had diagnostic hysteroscopy was 28, but only 23 case files were retrieved, giving a retrieval rate of 82.1%.

  11. (LH) on in vitro maturation of Egyptian buffalo oocytes

    African Journals Online (AJOL)

    Microsoft Corporation

    2012-03-08

    Mar 8, 2012 ... immature bovine oocytes. Gamete Res. 24:197-204. Deshmukh SP, Pawshe CH, Ingawale MV, Deshmukh SG (2010). In vitro maturation of buffalo immature oocyte after Vitrification with combination of Ethylene Glycol and Dimethyl Sulfoxide. Proceedings. 9th World Buffalo Congress, pp. 911-921. Duncan ...

  12. Drug: D02600 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D02600 Drug Demoxepam (USAN/INN) ... C15H11ClN2O2 D02600.gif ... Neuropsychiatric agent ... DG01835 ... Benzodiazepin...e sedative-hypnotics ... Benzodiazepine derivative ... CAS: 963-39-3 PubChem: 17396770 ChEMBL: CHEMBL1597677 LigandBox: D02600 NIKKAJI: J7.197H ...

  13. Nondestructive Evaluation Technology Working Group Report (IDA/OSD R&M (Institute for Defense Analyses/Office of the Secretary of Defense Reliability and Maintainability Study).

    Science.gov (United States)

    1983-08-01

    PRESENTATIONS. Firm &. 011w Wins 1.8mm’ Sal... Punk , --me H-JaConuaon S Footed Ribs. Eunm Dr" Fftdmv smd Naslk Atad. Ain. OWS 162 and OWS 197 (Shout 2 of...initiation of a fatig- crack at the damaged area. By polishing the area around the damage and visually monitoring the length of the surface crack

  14. Examining the Effects of "SRA FLEX Literacy"® on Measures of Lexile® and Oral Reading Fluency with At-Risk Middle School Readers

    Science.gov (United States)

    Flaum-Horvath, Shannon; Marchand-Martella, Nancy E.; Martella, Ronald C.; Kauppi, Cassondra

    2017-01-01

    This study examined the effects of the SRA FLEX Literacy (FLEX) program provided to 44 middle school students considered at risk for reading failure as compared to their peers who were not at risk in reading (N = 197) who received instruction in the Holt Elements of Literature series. Two outcome measures were used to judge the effects of the…

  15. Gclust Server: 171769 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 171769 NCR_NCU07615 Cluster Sequences - 197 predicted protein (translation) (198 aa...); no annotation 1 1.00e-99 0.0 0.0 0.0 0.0 0.0 12.5 Show 171769 Cluster ID 171769 Sequence ID NCR_NCU07615

  16. Structure of recombinant Ves v 2 at 2.0 Angstrom resolution

    DEFF Research Database (Denmark)

    Skov, Lars K; Seppälä, Ulla; Coen, Jeremy J F

    2006-01-01

    of recombinant Ves v 2 was determined at 2.0 A resolution and reveals a central (beta/alpha)(7) core that is further stabilized by two disulfide bonds (Cys19-Cys308 and Cys185-Cys197). Based on sequence alignments and structural comparison with the honeybee allergen Api m 2, it is proposed that a conserved...

  17. Barriers to school sport participation: A survey among secondary ...

    African Journals Online (AJOL)

    The primary aim of this study was to determine factors affecting sport participation among 197 (103 females and 94 males) students aged 15–18 years (mean age: 16.5 years; s = 0.8 years) who were drawn from three secondary schools in Pretoria, South Africa. A self-administered questionnaire was used to collect data.

  18. 46 CFR Appendix A to Subpart C to... - Sample Substance Safety Data Sheet, Benzene

    Science.gov (United States)

    2010-10-01

    ... to Subpart C to Part 197 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE... result in various blood disorders ranging from anemia to leukemia, an irreversible, fatal disease. Many... their service life, or the end of the shift, whichever occurs first. If you experience difficulty...

  19. Geochemistry and petrogenesis of early Cretaceous sub-alkaline ...

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    Iceland plume; Earth Planet. Sci. Lett. 153 197–208. Frey F A, McNaughton N J, Nelson D R, deLaeter J R and. Duncan R A 1996 Petrogenesis of the Bunbury basalt,. Western Australia: interaction between the Kerguelen plume and Gondwana lithosphere? Earth Planet. Sci. Lett. 176 73–89. Ghosh S, Chakrabarty S, Paul ...

  20. Genetic diversity in Nigerian brinjal eggplant (Solanum melongena L.)

    African Journals Online (AJOL)

    SAM

    2014-05-21

    May 21, 2014 ... Furini A, Wunder J (2004). Analysis of eggplant (Solanum melongena) related germplasm: morphological and AFLP data contribute to phylogenetic interpretations and germplasm utilization. Theor. Appl. Genet. 108:197-208. Gbile ZO, Adesina SK (1988). Nigerian Solanum species of economic importance.

  1. miRandola 2017: a curated knowledge base of non-invasive biomarkers

    DEFF Research Database (Denmark)

    Russo, Francesco

    2017-01-01

    databases. Data are manually curated from 314 articles that describe miRNAs, long non-coding RNAs and circular RNAs. Fourteen organisms are now included in the database, and associations of ncRNAs with 25 drugs, 47 sample types and 197 diseases. miRandola also classifies extracellular RNAs based...

  2. miRandola 2017: a curated knowledge base of non-invasive biomarkers

    DEFF Research Database (Denmark)

    Russo, Francesco; Di Bella, Sebastiano; Vannini, Federica

    2018-01-01

    databases. Data are manually curated from 314 articles that describe miRNAs, long non-coding RNAs and circular RNAs. Fourteen organisms are now included in the database, and associations of ncRNAs with 25 drugs, 47 sample types and 197 diseases. miRandola also classifies extracellular RNAs based...

  3. Inflammatory bowel disease Cape Town, 1975-1980

    African Journals Online (AJOL)

    1983-02-12

    Feb 12, 1983 ... SA MEDIESE TYDSKRIF DEEL 63 12 FEBRUARIE 1983. 3. Tobias R, Wright JP, Konler RE et al. Primary sclerosing cholangitis asso- ciated with inflammatory bowel disease in Cape Town, 197;"'1981. S. Afr Med] 1983; 63: 229-235. 4. Edwards Fe, Truelove Se. The course and prognosis ofulcerative colitis ...

  4. Reclamation of sodic soils in northern Tanzania, using locally ...

    African Journals Online (AJOL)

    SERVER

    2007-08-20

    Aug 20, 2007 ... 1993; SPORE, 1995), groundwater which redistributes accumulated salts during evaporation .... This is clearly reflected in the higher values of percentage changes in measured soil physical .... soluble salts in deeply weathered landscapes of Eastern Australia. Aust. J. Soil Res. 17: 197-215. Hanay A, Fatih ...

  5. Personal Learning Environment on a Procrustean Bed – Using PLEM in a Secondary-School Lesson

    NARCIS (Netherlands)

    Verpoorten, Dominique; Chatti, Amine; Westera, Wim; Specht, Marcus

    2010-01-01

    Verpoorten, D., Chatti, M., Westera, W., & Specht, M. (2010). Personal Learning Environment on a Procrustean Bed – Using PLEM in a Secondary-School Lesson. In C. A. Shoniregun, & G. A. Akmayeva (Eds.), Proceedings of the London International Conference on Education (LICE-2010) (pp. 197-203).

  6. RESEARCH NOTE OBSERVATIONS ON THE DEEP.FREEZING OF ...

    African Journals Online (AJOL)

    M.Sc. Tesis, Universiteit van Stellenbosch, Stellenbosch. PRETORIUS, P.S. & VAN DER WESTHUYSEN, J.M., 197 | . Induction of breeding activity in anoestrous Angora goat does. Agroanimalio 3,27 . ROSSOUW, A.F., 1974.'n Voorlopige mededeling oor die bevriesing van Boerboksemen. Tydskr. Veek.4, 165. SHELTON ...

  7. . . ms > my“; 2 ~ ! t n i at iii Roberts DM, MD

    African Journals Online (AJOL)

    1993;92:197-201. Huhtala V, Lehtonen L, Heinonen R, Ko- rvenranta H. Infant massage compared with crib vibrator in the treatment of col- icky infants. Pediatrics 2000;105:534. Hughes S, Bolton J. is chiropractic an effective treatment in infantile colic? Arch Dis Child 2002;86:382-4. Barr RG, McMuiian SJ, Spiess H, Leduc.

  8. Pacific Partnership 2007: The First Dedicated United States Ship Humanitarian and Civic Assistance Mission

    Science.gov (United States)

    2010-10-25

    and education for public health officials. Training for HN medical personnel included lifesaving skills, nutrition , and prenatal care. Biomedical...38.27 Lower back pain 998 245 295 248 124 19 67 33.50 Muscle pain 403 61 77 197 38 18 12 13.53 Sprain, strain, tendonitis 78 23 12 25 11 3 4

  9. problems of livestock production in the black states of southern ...

    African Journals Online (AJOL)

    Nutrition. Malnutrition is undoubtedly the most important cause of high mortality and low reproduction rates. (Bishop & Stampa, 197 5). Du Casse (1974) re- ported that .... 8), except some- times to meet educational obligations for their children. Therefore, it is quite clear that the be- haviour of peasant livestock owners is quite.

  10. Use of a pilot drug information centre | Tumwikirize | African Health ...

    African Journals Online (AJOL)

    Majority were on drug-drug interaction (41.2%), followed by therapy (23.2%). Out of 197 specific drug requests, 65.5% were on antiretroviral. Conclusion: We found that healthcare professionals were enthusiastically using the drug information centre. It is, therefore, necessary and feasible to establish a DIC in Uganda that ...

  11. Uvulectomy - the making of a ritual

    African Journals Online (AJOL)

    Owerri: Conch Magazine Umited. 1977; 52-64. 5. Rubinstein A. Absence of uvula in south Sinai Bedouins. JAMA 1979; 242: 323. 6. Brescia NJ. Anatomy of the lip and palate. In: Grabb WC, Rosenstein SW, Broch. KR, eds. Cleft Up and Palate: Surgical, Dental and Speech Aspects. Boston: Uttle,. Brown & Co, 197t; 373-392.

  12. Campylobacter contamination and the relative risk of illness from organic broiler meat in comparison with conventional broiler meat

    DEFF Research Database (Denmark)

    Rosenquist, Hanne; Boysen, Louise; Krogh, Anne Louise

    2013-01-01

    Danish organic broiler meat, represented by carcasses sampled at the end of processing after chilling, was more frequently contaminated with thermotolerant Campylobacter spp. than conventional broiler carcasses; the yearly mean prevalence being 54.2% (CI: 40.9-67.5) for organic and 19.7% (CI: 14....

  13. Rahvused ja rahvuslus / Ernest Gellner ; tõlk. A. Andresson

    Index Scriptorium Estoniae

    Gellner, Ernest

    1994-01-01

    Järg 1994/Nov nr. 11 lk. 2429-2462; Dec nr. 12 lk. 2653-2686; 1995/Jan nr. 1. lk. 197-222, Feb nr. 2 lk. 419-446. Toimetaja eessõna: Jaan Isotamm, lk. 2209-2218; 1995/Mar nr. 3 lk. 643-670; Järels. E. Loone. Rahvus. Rahvuslus. Rahvas. Riik. Ühiskond. Kultuur

  14. Bulletin of Animal Health and Production in Africa - Vol 64, No 2 (2016)

    African Journals Online (AJOL)

    Effects of enzyme additive on haematological and serum biochemical parameters of calves fed fresh grass and hay based diets · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT ... FULL TEXT DOWNLOAD FULL TEXT. E.O. Ewuola, D.M. Oyedele, D.E. Akinyemi, 197-204 ...

  15. Characterization of a mannose-binding lectin gene from Typhonium ...

    African Journals Online (AJOL)

    AY347940) was isolated from Typhonium divaricatum, a traditional Chinese medicinal herb. Sequence analysis revealed that the full-length cDNA of TDA was 870 bp, and had a 594 bp open reading frame (ORF) encoding a putative 197-aa agglutinin precursor with a C-terminal domain. Multiple alignments of TDA amino ...

  16. Association of the GRM4 gene variants with juvenile myoclonic ...

    Indian Academy of Sciences (India)

    J. Genet. 93, 193–197. Table 1. Details of the SNPs, primers, PCR condition and the restriction enzymes used for genotyping. Annealing temperature (. ◦. C)/. SNP name/ extension time (s)/ Size. Restriction. Digested fragments. ID*. Location Allele Primer pairs for PCR (5 –3 ) no. of cycles. (bp) enzyme. (bp). SNP1. 5 UTR.

  17. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... views 3:34 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 62,495 views 5: ... Melissa Saban 77,197 views 3:50 Childhood Cancer: Palliative Care - Duration: 3:29. American Cancer Society ...

  18. AUTHOR INDEX

    Indian Academy of Sciences (India)

    Fission anisotropy of 197Tl produced in fusion reactions in the framework of the modified statistical model. 1181. Farjami Shayesteh S. The effect of surface plasmon resonance on optical response in dielectric (core)–metal. (shell) nanoparticles. 1245. Francesco Neri see Giuseppe Viesti. 497. Gao Huijun see Hayat T. 125.

  19. The Virial Discrepancy in Clusters of Galaxies in the Context of Modified Newtonian DynamicsResolving the virial discrepancy in clusters of galaxies with modified Newtonian dynamics

    NARCIS (Netherlands)

    Sanders, R. H.

    1998-01-01

    Published in: Astrophys. J. 512 (1999) L23 citations recorded in [Science Citation Index] Abstract: A sample of 197 X-ray emitting clusters of galaxies is considered in the context of Milgrom's modified Newtonian dynamics (MOND). It is shown that the gas mass, extrapolated via an assumed $beta$

  20. Assainissement de l'environnement par la valorisation des ...

    African Journals Online (AJOL)

    Each batch was fed ad libitum with commercial feed and four feed containing different levels of Azolla, Moringa, rice bran, chicken Cobb 500 and fish Oreochromis niloticus viscera. A significant difference (P < 0.05) was observed between Average Daily Gain (ADG). After 90 days of experimentation, the ADG were 197 g ...

  1. Thermodynamic Aspects of Gasification Derived Syngas Desulfurization, Removal of Hydrogen Halides and Regeneration of Spent Sorbents Based on La2O3/La2O2CO3 and Cerium Oxides.

    Czech Academy of Sciences Publication Activity Database

    Svoboda, Karel; Leitner, J.; Havlica, Jaromír; Pohořelý, Michael; Brynda, Jiří; Šyc, Michal; Chyou, Y.-P.; Chen, P.-Ch.

    2017-01-01

    Roč. 197, JUN 1 (2017), s. 277-289 ISSN 0016-2361 R&D Projects: GA ČR GC14-09692J Institutional support: RVO:67985858 Keywords : cerium oxides * dehalogenation * thermodynamics Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.601, year: 2016

  2. Modeling of Contaminant Migration through Porous Media after Underground Coal Gasification in Shallow Coal Seam

    Czech Academy of Sciences Publication Activity Database

    Soukup, Karel; Hejtmánek, Vladimír; Čapek, P.; Stanczyk, K.; Šolcová, Olga

    2015-01-01

    Roč. 140, DEC (2015), s. 188-197 ISSN 0378-3820 Grant - others:RFCS(XE) RFCR-CT-2011-00002 Institutional support: RVO:67985858 Keywords : underground coal gasification * transport phenomena modeling * transport parameters Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 3.847, year: 2015

  3. DE RECHTSVRAAG DER CHRISTENVERVOLGINGEN IN HET ...

    African Journals Online (AJOL)

    Test

    Tertullianus, de felle iMnscomnhm te Carthago, na zijn studietijd, dien hij te Rome had doorgebracht, Christen geworden, schreef in 197 zijn ApotogeticMm — naar sommige handschriften Lii*er apoiogeticm — ter verdediging van de Christenen. Daarvóór had hij Ad nations geschreven, in het ApotogeticMm meermalen ...

  4. Eesti viimane kolhoos pelgab tulevikku / Anne Oja ; kommenteerinud Vallo Visnapuu, Argo Mättas, Mart Vaiksaar ... [jt.

    Index Scriptorium Estoniae

    Oja, Anne, 1970-

    2011-01-01

    Vändra katsesovhoosi jagunemisel loodud OÜ Selja nõukogu ja juhatus on otsustanud firma maha müüa, kuigi enamik ettevõtte 197-st eraisikust osanikust on selle vastu. Võimalikud ostjad on Trigon Farming AS või Jõgeva Põllumajandustootjate Liit (JPL)

  5. Dicty_cDB: Contig-U11514-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Sd197, com... 268 8e-70 (P0ABB8) RecName: Full=Magnesium-transporting ATPase, P-type 1; ... 268 1e-69 CU928145_4660(...hungatei JF-1,... 232 6e-59 ( P22036 ) RecName: Full=Magnesium-transporting ATPase, P-type 1; ... 232 8e-59 AE017245_566(

  6. Cuyahoga River, Ohio Restoration Study. Third Interim Preliminary Feasibility Report on Erosion and Sedimentation. Volume II. Appendices A through H.

    Science.gov (United States)

    1981-04-01

    objecttves of this PFI: are to detervine tho prolific source* of sediment trou ~a~bout Sthe study area (fro laud and streambank erosion) end to...Port Authority IL’l Frieside Avi- noir Clevelsn"l, OV 44114 .4 alear Mr. Slivelv: In 5,Pj’ter~b-r 197). thr. Puffale District completed tht First Interit

  7. Disease: H01046 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available minth infections. Adv Parasitol 73:197-230 (2010) PMID:15662995 (drug) Adams VJ, Lombard CJ, Dhansay MA, Markus MB, Fincham JE Effica...cy of albendazole against the whipworm trichuris trichiura--a randomised, controlled trial. S Afr Med J 94:972-6 (2004) ...

  8. The synergy in green persuasion: Green celebrity endorsers in green advertising: A study of brand-endorser congruence effects in green advertising

    NARCIS (Netherlands)

    Blasche, J.; Ketelaar, P.E.

    2015-01-01

    This study examines celebrity endorser-brand congruence effects in green advertising on the ads' effectiveness. In an experimental survey, Dutch participants (197) saw ads with a congruent or incongruent celebrity endorser. Extending the match-up hypothesis to a novel match-up factor, greenness, the

  9. High-Resolution Melting Curve Analysis for High-Throughput Genotyping of NOD2/CARD15 Mutations and Distribution of These Mutations in Slovenian Inflammatory Bowel Diseases Patients

    Directory of Open Access Journals (Sweden)

    Mitja Mitrovič

    2011-01-01

    in CD patients, 25/197 (12.69% in UC patients and in 26/256 (10.15% in healthy controls. We have successfully implemented NOD2/CARD15 HRMA assays, which may contribute to the development of genetic profiles for risk prediction of developing CD and for differential diagnosis of CD vs. UC.

  10. AcEST: DK948527 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ed protein L102 OS=Acanthamoe... 31 4.5 sp|P51751|RCEM_RHOPH Reaction center protein M chain (Fragment) ... ...Query: 169 TSSSKQASICYRNTH 125 S Q + Y+N H Sbjct: 183 IFSQTQPKVTYKNLH 197 >sp|P51751|RCEM_RHOPH Reaction cen

  11. Public Procurement of Innovation; Endogenous Institutions in User-Producer Interaction

    DEFF Research Database (Denmark)

    Hjaltadóttir, Rannveig Edda

    2013-01-01

    Introduction 2010 government expenditure on works, goods and services in EU 19.7% of GDP - 2.406,98€ billion. Can be used to stimulate innovation Focus on public procurement of innovation in EU maintain competitive advantage and welfare Governments are important first users for high technology...

  12. African Journal of Neurological Sciences - 2009 Vol. 28 No 1

    African Journals Online (AJOL)

    potential effects of factors relating to PD on the various measure of interest relating to pain. Results. Parkinson ..... brain pathology related to sporadic Parkinson's disease. Neurobiol Aging. 2003;24:197-211. 4. CHAUDHURI KR, PRIETO-JURCYNSKA C, NAIDU Y, MITRA T, FRADES-PAYO B, TLUK S,. RUESSMANN A ...

  13. Illustration of sampling-based approaches to the calculation of expected dose in performance assessments for the proposed high level radioactive waste repository at Yucca Mountain, Nevada.

    Energy Technology Data Exchange (ETDEWEB)

    Helton, Jon Craig (Arizona State University, Tempe, AZ); Sallaberry, Cedric J. PhD. (.; .)

    2007-04-01

    A deep geologic repository for high level radioactive waste is under development by the U.S. Department of Energy at Yucca Mountain (YM), Nevada. As mandated in the Energy Policy Act of 1992, the U.S. Environmental Protection Agency (EPA) has promulgated public health and safety standards (i.e., 40 CFR Part 197) for the YM repository, and the U.S. Nuclear Regulatory Commission has promulgated licensing standards (i.e., 10 CFR Parts 2, 19, 20, etc.) consistent with 40 CFR Part 197 that the DOE must establish are met in order for the YM repository to be licensed for operation. Important requirements in 40 CFR Part 197 and 10 CFR Parts 2, 19, 20, etc. relate to the determination of expected (i.e., mean) dose to a reasonably maximally exposed individual (RMEI) and the incorporation of uncertainty into this determination. This presentation describes and illustrates how general and typically nonquantitive statements in 40 CFR Part 197 and 10 CFR Parts 2, 19, 20, etc. can be given a formal mathematical structure that facilitates both the calculation of expected dose to the RMEI and the appropriate separation in this calculation of aleatory uncertainty (i.e., randomness in the properties of future occurrences such as igneous and seismic events) and epistemic uncertainty (i.e., lack of knowledge about quantities that are poorly known but assumed to have constant values in the calculation of expected dose to the RMEI).

  14. Women's status within the household as a determinant of maternal ...

    African Journals Online (AJOL)

    Results: Receipt of skilled delivery care was by 37.9% while, natal care was by 98.4%. Education, residence and wealth index all significantly influenced receipt of maternal health care. Women who were involved in decision making on their own health (aOR=1.97; 95%CI=1.88-2.06) and were employed throughout the year ...

  15. Experiment list: SRX1090866 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available gramming || cell type=intermediate stage of somatic cell reprogramming || chip anti...1,96.8,4.5,197 GSM1816303: pre-iPS rep.H3K27me3.ChIP-Seq; Mus musculus; ChIP-Seq source_name=intermediate stage of somatic cell repro

  16. utilization of sweetpotato based confection technology: a panacea

    African Journals Online (AJOL)

    oma

    ABSTRACT. The study aimed at investigating the effect of women entrepreneurship skills on the nutritional and health status of preschool children in three nursery and primary schools in. Ohahji Egbema LGA. A total of 197 preschool children aged 2-5 years was selected from three nursery and primary schools in Ohaji ...

  17. Assessment of knowledge and practices for disposal of unfinished ...

    African Journals Online (AJOL)

    Of 386 respondents reported to store medications in their households, 66.6% eventually disposed of the drugs in domestic trash in events of expiry or when drugs became unwanted. Burying (9.1%), throwing/flushing down toilets (19.7%) and burning (4.6%) were less encountered. Public awareness that improper disposal ...

  18. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 87; Issue 1. Issue front cover thumbnail. Volume 87, Issue 1. April 2008, pages 1-97. pp 1-1. Editorial · Amitabh Joshi · More Details Fulltext PDF. pp 3-20 Research Article. Genetic landscape of the people of India: a canvas for disease gene exploration · Indian Genome Variation ...

  19. Medical Malpractice Reform: A Fix for a Problem Long out of Fashion.

    Science.gov (United States)

    Kirkner, Richard Mark

    2017-10-01

    State tort reforms have all but relegated the malpractice crisis to the history books. But there's good news for those of you into all things retro: The House of Representatives just voted to fix the malpractice crisis by a 222-197 margin.

  20. Secular trend of the leading causes of death in China from 2003 to ...

    African Journals Online (AJOL)

    and cardiopathy. In 2008, cardiopathy replaced cerebro- vascular disease as the second main cause of death, at. 19.7%, and in 2006, endocrine, nutritional, and metabolic diseases ranked sixth, at 3.3%, replacing digestive diseas- es. The proportion of deaths related to cardiopathy and nervous system diseases increased ...