WorldWideScience

Sample records for astatine 197

  1. Organic chemistry of astatine

    International Nuclear Information System (INIS)

    The paper surveys the investigations on the chemical behaviour of astatine in organic systems and deals with the preparation and identification of its organic compounds. A discussion is given on some of the physico-chemical properties of these compounds determined by extrapolation techniques as well as by direct measurement. The biomedical importance of 211At-labelled compounds is briefly referred to. (authors)

  2. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  3. Astatine-211: production and availability.

    Science.gov (United States)

    Zalutsky, Michael R; Pruszynski, Marek

    2011-07-01

    The 7.2-h half life radiohalogen (211)At offers many potential advantages for targeted α-particle therapy; however, its use for this purpose is constrained by its limited availability. Astatine-211 can be produced in reasonable yield from natural bismuth targets via the (209)Bi(α,2n)(211)At nuclear reaction utilizing straightforward methods. There is some debate as to the best incident α-particle energy for maximizing 211At production while minimizing production of (210)At, which is problematic because of its 138.4-day half life α-particle emitting daughter, (210)Po. The intrinsic cost for producing (211)At is reasonably modest and comparable to that of commercially available (123)I. The major impediment to (211)At availability is attributed to the need for a medium energy α-particle beam for its production. On the other hand, there are about 30 cyclotrons in the world that have the beam characteristics required for (211)At production. PMID:22201707

  4. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211At species, 211At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  5. Dosimetrical considerations in astatine-211 radioimmunotherapy

    International Nuclear Information System (INIS)

    Several dosimetrical quantities have been suggested for use in alpha-particle dosimetry. To evaluate the expected biological effect when using these quantities, a Monte Carlo program was set to register the single-event distribution of both specific energy and alpha-particle track length to a cell nucleus (r=5.6 μm). Distributions were acquired for both 'bound' (simulating the effect of 211At-labelled antibodies bound to antigens on cell surfaces (r=7.0 μm)) as well as 'non-bound' (simulating 211At-labelled antibodies that have not bound to a cell) astatine-211. From these distributions, various theoretical cell survival curves were established for 3 different dosimetrical quantities, i.e. specific energy, number of alpha-particle hits and total track length. The survival curves for all quantities are presented for the corresponding mean absorbed dose in order to facilitate comparisons of the expected effects of using the 3 different quantities for both distributions of 211At decays. The theoretical survival curves presented here could, combined with experiments using 'bound' and 'non-bound' 211At in a single-cell suspension, reveal which dosimetrical quantity is most suitable for 211 At-radioimmunotherapy. (author)

  6. Discovery of the astatine, radon, francium, and radium isotopes

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  7. Electrodisintegration of 197Au

    International Nuclear Information System (INIS)

    Cross sections for the (e, xn) reaction on 197Au have been measured for 1= 4 were calculated by means of an intranuclear cascade model. Good agreement is found for x = 7 is discussed. No evidence is found for giant resonances in regions above the giant dipole resonance. (Auth.)

  8. Extraction of astatine isotopes for development of radiopharmaceuticals using a 211Rn-211At generator

    International Nuclear Information System (INIS)

    In order to utilize a 211At isotope, a promising α-emitter for radionuclide therapy, the chemical properties of astatine isotopes are studied. We have examined wet chemistry methods through the distribution ratios of astatine in liquid-liquid extraction. The astatine isotopes have been found to be well extracted into DIPE and MIBK. We observed that the distribution ratio of astatine isotopes increases with concentrations of HCl greater than 3 M, while it decreases with the HCl concentration less than 2 M. The results will be useful for development of the 211Rn-211At generator. (author)

  9. Astatine-211-Labeled Targeted Radiotherapeutics: An Update

    International Nuclear Information System (INIS)

    The heavy halogen 211At was first proposed for use in α-particle targeted radiotherapy more than 30 years ago and continues to be one of the most promising radionuclides for this purpose. Although its 7.2-h half life is not ideal for intravenously administered whole antibodies, it is compatible with the pharmacokinetics of antibody fragments, peptides, aptamers and organic molecules. Its diverse chemistry allows its incorporation into a wide array of targeting vehicles, relying on its chemical similarity to iodine to provide a useful point of departure. On the other hand, the relatively low carbon-astatine bond strength is challenging. In common with the other α-emitters being discussed at this symposium, lack of reliable availability is one of the biggest hurdles in the use of 211At for targeted radiotherapy. However, in the case of 211At, it is not a question of production cost or availability of target material, because 211At can be produced in reasonable yield from natural bismuth targets. Rather, the difficulty is the lack of cyclotrons equipped with the medium energy α-particle beams required for its production. If the infrastructure for producing 211At is to be improved to the stage where 211At-labeled radiopharmaceuticals can have a meaningful impact, several developments must occur. First, the ability to produce clinically relevant levels of 211At that can be shipped to remote locations in chemically tractable form must be demonstrated. Approaches under consideration include compensating for radiolysis-mediated effects and the consideration of alternative chemistries. Second, strategies for compensating for heterogeneities in dose deposition must be developed, hopefully in a way that is compatible with approval for human use. And third, it is essential that more clinical trials be performed with 211At-labeled therapeutics, particularly in settings of minimum residual disease where the radiobiological advantages of α-particles can be best exploited. Our

  10. Scrutinizing "Invisible" astatine: A challenge for modern density functionals.

    Science.gov (United States)

    Sergentu, Dumitru-Claudiu; David, Grégoire; Montavon, Gilles; Maurice, Rémi; Galland, Nicolas

    2016-06-01

    The main-group 6p elements did not receive much attention in the development of recent density functionals. In many cases it is still difficult to choose among the modern ones a relevant functional for various applications. Here, we illustrate the case of astatine species (At, Z = 85) and we report the first, and quite complete, benchmark study on several properties concerning such species. Insights on geometries, transition energies and thermodynamic properties of a set of 19 astatine species, for which reference experimental or theoretical data has been reported, are obtained with relativistic (two-component) density functional theory calculations. An extensive set of widely used functionals is employed. The hybrid meta-generalized gradient approximation (meta-GGA) PW6B95 functional is overall the best choice. It is worth noting that the range-separated HSE06 functional as well as the old and very popular B3LYP and PBE0 hybrid-GGAs appear to perform quite well too. Moreover, we found that astatine chemistry in solution can accurately be predicted using implicit solvent models, provided that specific parameters are used to build At cavities. © 2016 Wiley Periodicals, Inc. PMID:27059181

  11. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  12. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates.

    Science.gov (United States)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Svedhem, Sofia; Lindegren, Sture

    2016-03-16

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single cancer cells. A promising radioactive nuclide for this type of therapy is astatine-211. Astatine-211 attached to tumor-specific antibodies as carrier molecules is a system currently under investigation for use in targeted alpha therapy. In the common radiolabeling procedure, astatine is coupled to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies. PMID:26791409

  13. Astatine-211: production, injection into monoclonal antibodies radiological effect, possible application to cancer treatment

    International Nuclear Information System (INIS)

    Methods developed in the Laboratory of Nuclear Problems, JINR, for producing astatine-211 and injecting it into monoclonal antibodies are described. The use of its diethylene triamine penta-acetic acid complex is shown to be the most effective method of injecting astatine into a biomolecules. The biological effect of the α-particles emitted from the astatine-211 is investigated using Chinese hamster fibroblasts and Ehrlich carcinoma cells. It is established that the mitotic activity depression, number of degenerating cells, number of cells with chromosome aberrations, and cellular surviving fraction depend on the concentration of the radionuclide in the medium 'in vitro'. The RBE of α-particles in comparison with 60Co γ-rays is 3. Injection of astatine-211 absorbed on tellurium particles into mice with ascitic tumors resulted in prolongation of their life or elimination of the tumors. (author). 39 refs, 7 figs

  14. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    OpenAIRE

    Rothe, S.; A. N. Andreyev; Antalic, S; Borschevsky, A.; Capponi, L.; Cocolios, T.E.; Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the io...

  15. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    Science.gov (United States)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-07-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and physical properties for use in targeted therapies for cancer. Due to the very short range of the emitted α-particles, this therapy is particularly suited to treating occult, disseminated cancers. Astatine is not intrinsically tumour-specific; therefore, it requires an appropriate tumour-specific targeting vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method that combines dry distillation of astatine-211 and a synthesis module for producing radiopharmaceuticals into a process platform. This platform will standardize production of astatinated radiopharmaceuticals, and hence, it will facilitate large clinical studies focused on this promising, but chemically challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies.

  16. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-01-01

    vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method......To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  17. Synthesis and decay of 197Os

    International Nuclear Information System (INIS)

    By irradiation of platinum with 14 MeV neutrons, 197Os is produced through the reaction (n,2p). The γ rays following the β- decay of 197Os are investigated with HPGe detectors. The ten new γ rays are observed, and the half-life of 197Os is 2.8 ± 0.6 min. A partial decay scheme of 197Os is proposed based on γ(X)-γ coincidence measurements. (authors)

  18. Study of Astatine (III) reactions with O, S and N ligands in solution

    International Nuclear Information System (INIS)

    Full text of publication follows. Astatine (At, Z=85: [Xe]4f145d106s26p5) belongs to the halogen group and is located below iodine in the periodic table. One of its isotopes (211At) appears promising as a therapeutic agent in nuclear medicine (Ref.1) owing to the energy of the alpha particles emitted during the disintegration of its nucleus and its short physical half-life (7.2 h). Since there are no stable isotopes of astatine, the chemistry of this element remains poorly understood. Generally, At is supposed to behave as a halogen (Ref.2) but it has been shown recently in our group that astatine presents a metallic behaviour in aqueous solution: it notably exists as At+ and AtO+ species under the oxidation states +I and +III (Ref.3). At the present time, the number of studies dealing with the complexation properties of the cationic forms of astatine remains limited (Ref.4), owing to its low availability. In this work, we have investigated the reactions of AtO+ species with different hetero-atomic (N, S, O) model ligands. A combined approach based on experimental and theoretical studies has been used (Ref.5). On account of the difficulties of experimental investigations of astatine species, the reactivity of AtO+ was explored using a competition method founded on astatine distributions between two distinct phases. Furthermore, for each AtO+/ ligand complex, the nature of the species formed and the associated thermodynamic constants were determined by computational modeling (DFT calculations). In this framework, an original computational methodology was developed to take into account the specificities of astatine, notably the associated relativistic effects. The computed equilibrium constants have been confronted with the experimental results. This comparison demonstrates an outstanding coherence between experience and theory. Furthermore, the analysis of the results shows a key role of solvent effects on astatine chemistry. Lastly, a specific reactivity for the

  19. 32 CFR 197.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Policy. 197.4 Section 197.4 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS HISTORICAL RESEARCH IN THE FILES OF THE OFFICE OF THE SECRETARY OF DEFENSE (OSD) § 197.4 Policy. It is DoD...

  20. 46 CFR 197.410 - Dive procedures.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Dive procedures. 197.410 Section 197.410 Shipping COAST... GENERAL PROVISIONS Commercial Diving Operations Operations § 197.410 Dive procedures. (a) The diving supervisor shall insure that— (1) Before commencing diving operations, dive team members are briefed on—...

  1. 46 CFR 197.420 - Operations manual.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Operations manual. 197.420 Section 197.420 Shipping... GENERAL PROVISIONS Commercial Diving Operations Operations § 197.420 Operations manual. (a) The diving supervisor shall— (1) Provide an operations manual to the person-in-charge prior to commencement of...

  2. 32 CFR 197.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 197.5 Section 197.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS HISTORICAL RESEARCH IN THE FILES OF THE OFFICE OF THE SECRETARY OF DEFENSE (OSD) § 197.5 Responsibilities....

  3. 32 CFR 197.3 - Definition.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Definition. 197.3 Section 197.3 National Defense... RESEARCH IN THE FILES OF THE OFFICE OF THE SECRETARY OF DEFENSE (OSD) § 197.3 Definition. Historical researcher or researcher. A person desiring to conduct research in OSD files for historical information...

  4. 46 CFR 197.326 - Oxygen safety.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Oxygen safety. 197.326 Section 197.326 Shipping COAST... GENERAL PROVISIONS Commercial Diving Operations Equipment § 197.326 Oxygen safety. (a) Equipment used with oxygen or oxygen mixtures greater than 40 percent by volume must be designed for such use. (b)...

  5. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments (209At, 210At, 211At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  6. Astatine-211 Pathway from Radiochemistry to Clinical Investigation

    International Nuclear Information System (INIS)

    Particularly in clinical settings where tumour burden is low and cancers are located in close proximity to essential normal tissue structures, α-particle emitting radionuclides can offer significant advantages for targeted radionuclide therapy. One of the first alpha emitters to be evaluated for this purpose is the 7.2-h half-life radiohalogen Astatine-211 (211At). From a commercialization-potential perspective 211At, is less appealing than the longer half-life alpha particle emitters Radium-223, Actinium-225 and Thorium-227, which have become the focus of many laboratories. However, if methods for providing a better supply of 211At could be developed, this alpha emitter would be the radionuclide of choice for many potential therapeutic applications. With regard to the production of 211At, this can be readily be accomplished by bombarding natural bismuth targets with 28−29.5 MeV alpha particles via the 209Bi(α,2n)211At reaction. The goal is to utilize an alpha particle beam energy that provides the required balance for maximizing 211At production while minimizing creation of 210At, which is problematic because of its 138.4-day half life alpha-particle emitting daughter, 210Po. For most intended clinical applications, alpha particle beam energy of about 29 MeV offers the best compromise between maximizing yield and providing 211At with sufficient radionuclidic purity for clinical use. Clinically relevant levels of 211At have been produced at several institutions using both internal and external cyclotron targets

  7. Collective dipole rotational bands in 197Pb

    International Nuclear Information System (INIS)

    The nucleus 197Pb was populated via the 186W(17O, 6n)197Pb reaction at beam energies of 98 and 110 MeV. Two regular ΔI=1 bands of magnetic dipole transitions have been found. Possible interpretations in terms of collective oblate configurations involving high-K proton orbitals coupled to three i13/2 neutrons are discussed. The similarities between several of the bands discovered in 197-200Pb nuclei are emphasized. (orig.)

  8. 46 CFR 197.452 - Oxygen cleaning.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Oxygen cleaning. 197.452 Section 197.452 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE OCCUPATIONAL SAFETY AND HEALTH STANDARDS....452 Oxygen cleaning. The diving supervisor shall ensure that equipment used with oxygen or...

  9. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  10. 46 CFR 197.430 - SCUBA diving.

    Science.gov (United States)

    2010-10-01

    ... GENERAL PROVISIONS Commercial Diving Operations Specific Diving Mode Procedures § 197.430 SCUBA diving..., another diver is stationed at the underwater point of entry and is line-tending the diver; and (f) A...

  11. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  12. 46 CFR 197.332 - PVHO-Decompression chambers.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false PVHO-Decompression chambers. 197.332 Section 197.332... STANDARDS GENERAL PROVISIONS Commercial Diving Operations Equipment § 197.332 PVHO—Decompression chambers. Each decompression chamber must— (a) Meet the requirements of § 197.328; (b) Have internal...

  13. NUHOMS registered - MP197 transport cask

    International Nuclear Information System (INIS)

    The NUHOMS registered -MP197 cask is an optimized transport design which can be loaded in the spent fuel pool (wet loading) or loaded the canister from the NUHOMS concrete modules at the ISFSI site. With impact limiters attached, the package can be transported within the states or world-wide. The NUHOMS registered -MP197 packaging can be used to transport either BWR or PWR canisters. The NUHOMS registered -MP197 cask is designed to the ASME B and PV Code and meets the requirements of Section III, Division 3 for Transport Packaging. The cask with impact limiters has undergone drop testing to verify the calculated g loadings during the 9m drops. The test showed good correlation with analytical results and demonstrate that the impact limiters stay in place and protect the package and fuel during the hypothetical accidents

  14. Labelling prospects of astatine-211 with immunoglobulins (IgG): some general considerations

    International Nuclear Information System (INIS)

    The tumour therapeutic potential of the short lived alpha emitting radiohalogen 211At has been already been well recognised in the field of radioimmuno therapy. There is no evidence as such to show that astatine itself is a tumour seeking isotope. Therefore it has to be tagged to tumour seeking compound such as a drug or a protein preferably an antibody (IgG). In this communication, the labelling parameters which are required to be investigated for obtaining a stable product which could be useful as radioimmuno therapeutic agent, are described. (author). 6 refs

  15. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron anity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photodetachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral linewidth of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in o-line tests by the clear observation of the photodetachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148 [1].

  16. Extraction of 211At-astatine from hydrochloric acid solutions by means of TOPO, TBP, and triphenylphosphine

    International Nuclear Information System (INIS)

    The extraction behaviour of astatine was studied under defined conditions from hydrochloride acid solutions (cHCl>0.1 M or 1 and 2M). Therefore other effects like adsorption, reduction or hydrolysis can be excluded. The present work describes the extraction with tri- n- octylphosphinoxide (TOPO), tri- n-butylphosphate (TBP) and tri-phenylphosphine in chloroform. (orig.)

  17. No-carrier-added astatination of N-succinimidyl-3-(tri-n-butylstannyl) benzoate (ATE) via electrophilic destannylation

    International Nuclear Information System (INIS)

    The no-carrier-added synthesis of N-succinimidyl 3-[211At]astato-benzoate from N-succinimidyl 3-(tri-n-butylstannyl)benzoate (ATE) is described. The nature of the solvent in which the 211At was isolated from the target was an important factor influencing both the radiochemical yields and the nature of the incorporated astatine activity. (orig.)

  18. Incest - Strl. §§ 197 - 199

    OpenAIRE

    Rushiti, Besart

    2014-01-01

    I denne avhandlingen drøftes formålet og begrunnelsen for straffebudene i strl. §§ 197 - 199. Samtidig drøftes spørsmålet i et politisk perspektiv om straffeloven har som oppgave å håndheve moralske standarder eller grenser for seksuelle forhold mellom voksne innbyggere.

  19. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    211At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At- to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At- anions, but first of all because of the kinetic inertness of low spin rhodium(III) d6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh3+. The experiments related to optimization of the reaction conditions were performed with the 131I, basing on a chemical similarity of I- to At-. The experiments with 211At were then carried out under the conditions found optimal for I-. The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211At-Rh(16-S4-diol) complex

  20. Energy dependence of collective flow of neutrons and charged particles in 197Au+197Au collisions

    International Nuclear Information System (INIS)

    Our contribution focusses on one particular aspect of collective flow of nuclear matter: the so-called ''squeeze-out'', i.e. the preferential emission of mid-rapidity particles perpendicular to the reaction plane. The data were taken for the system 197Au + 197Au at 400, 600 and 800 MeV/u. We cover two topics, the comparison of neutrons and protons, and the bombarding energy dependence of the neutrons' squeeze-out. (orig.)

  1. 46 CFR 197.310 - Air compressor system.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Air compressor system. 197.310 Section 197.310 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE OCCUPATIONAL SAFETY AND HEALTH STANDARDS GENERAL PROVISIONS Commercial Diving Operations Equipment § 197.310 Air compressor system. A...

  2. 46 CFR 197.342 - Buoyancy-changing devices.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Buoyancy-changing devices. 197.342 Section 197.342 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE OCCUPATIONAL SAFETY AND HEALTH STANDARDS GENERAL PROVISIONS Commercial Diving Operations Equipment § 197.342 Buoyancy-changing devices. (a) A dry suit or other...

  3. 46 CFR 197.312 - Breathing supply hoses.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Breathing supply hoses. 197.312 Section 197.312 Shipping... GENERAL PROVISIONS Commercial Diving Operations Equipment § 197.312 Breathing supply hoses. (a) Each breathing supply hose must— (1) Have a maximum working pressure that is equal to or exceeds— (i) The...

  4. 46 CFR 197.454 - First aid and treatment equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false First aid and treatment equipment. 197.454 Section 197.454 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE OCCUPATIONAL SAFETY AND... Equipment § 197.454 First aid and treatment equipment. The diving supervisor shall ensure that medical...

  5. 46 CFR 197.314 - First aid and treatment equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false First aid and treatment equipment. 197.314 Section 197... HEALTH STANDARDS GENERAL PROVISIONS Commercial Diving Operations Equipment § 197.314 First aid and... consists of— (i) Basic first aid supplies; and (ii) Any additional supplies necessary to treat minor...

  6. 46 CFR 197.338 - Compressed gas cylinders.

    Science.gov (United States)

    2010-10-01

    ... chapter; or (2) 49 CFR 173.34 and 49 CFR part 178, subpart C. ... 46 Shipping 7 2010-10-01 2010-10-01 false Compressed gas cylinders. 197.338 Section 197.338... STANDARDS GENERAL PROVISIONS Commercial Diving Operations Equipment § 197.338 Compressed gas cylinders....

  7. Cellular and molecular effects of cross reacting material 197 (CRM197) on HT-29 colon cancer cell line

    OpenAIRE

    Rivetti, Stefano

    2012-01-01

    Cross Reacting Material 197(CRM197) is a Diphteria toxin non toxic mutant that had shown anti-tumor activity in mice and humans. CRM197 is utilized as a specific inhibitor of heparin-binding epidermal growth factor (HB-EGF), that competes for the epidermal growth factor receptor (EGFR), overexpressed in colorectal cancer and implicated in its progression. We evaluated the effects of CRM197 on HT-29 human colon cancer cell line behaviour and, for CRM197 recognized ability to inhibit HB-EGF,...

  8. 30 CFR 19.7 - Protection against explosion hazard.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Protection against explosion hazard. 19.7..., EVALUATION, AND APPROVAL OF MINING PRODUCTS ELECTRIC CAP LAMPS § 19.7 Protection against explosion hazard. Unless properly designed, electric cap lamps may present two sources of probable explosion...

  9. 46 CFR 197.565 - Notifying personnel of benzene hazards.

    Science.gov (United States)

    2010-10-01

    ... appendices A and B of this subpart or a MSDS on benzene meeting the requirements of 29 CFR 1910.1200(g) is... 46 Shipping 7 2010-10-01 2010-10-01 false Notifying personnel of benzene hazards. 197.565 Section... AND HEALTH STANDARDS GENERAL PROVISIONS Benzene § 197.565 Notifying personnel of benzene hazards....

  10. 46 CFR 197.328 - PVHO-General.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false PVHO-General. 197.328 Section 197.328 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE OCCUPATIONAL SAFETY AND HEALTH STANDARDS... compartment that is— (i) Designed for human occupancy; and (ii) Capable of having the compartment...

  11. 42 CFR 84.197 - Respirator containers; minimum requirements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Respirator containers; minimum requirements. 84.197... Cartridge Respirators § 84.197 Respirator containers; minimum requirements. Respirators shall be equipped with a substantial, durable container bearing markings which show the applicant's name, the type...

  12. 46 CFR 197.456 - Breathing supply hoses.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Breathing supply hoses. 197.456 Section 197.456 Shipping....456 Breathing supply hoses. (a) The diving supervisor shall insure that— (1) Each breathing supply....5 times its maximum working pressure; (2) Each breathing supply hose assembly, prior to being...

  13. 46 CFR 197.450 - Breathing gas tests.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Breathing gas tests. 197.450 Section 197.450 Shipping....450 Breathing gas tests. The diving supervisor shall insure that— (a) The output of each air... or modification. (b) Purchased supplies of breathing mixtures supplied to a diver are checked...

  14. Unexpected Behavior of the Heaviest Halogen Astatine in the Nucleophilic Substitution of Aryliodonium Salts.

    Science.gov (United States)

    Guérard, François; Lee, Yong-Sok; Baidoo, Kwamena; Gestin, Jean-François; Brechbiel, Martin W

    2016-08-22

    Aryliodonium salts have become precursors of choice for the synthesis of (18) F-labeled tracers for nuclear imaging. However, little is known on the reactivity of these compounds with heavy halides, that is, radioiodide and astatide, at the radiotracer scale. In the first comparative study of radiohalogenation of aryliodonium salts with (125) I(-) and (211) At(-) , initial experiments on a model compound highlight the higher reactivity of astatide compared to iodide, which could not be anticipated from the trends previously observed within the halogen series. Kinetic studies indicate a significant difference in activation energy (Ea =23.5 and 17.1 kcal mol(-1) with (125) I(-) and (211) At(-) , respectively). Quantum chemical calculations suggest that astatination occurs via the monomeric form of an iodonium complex whereas iodination occurs via a heterodimeric iodonium intermediate. The good to excellent regioselectivity of halogenation and high yields achieved with diversely substituted aryliodonium salts indicate that this class of compounds is a promising alternative to the stannane chemistry currently used for heavy radiohalogen labeling of tracers in nuclear medicine. PMID:27305065

  15. Collective dipole rotational bands in sup 197 Pb

    Energy Technology Data Exchange (ETDEWEB)

    Clark, R.M.; Wadsworth, R.; Regan, P.H. (York Univ. (United Kingdom). Dept. of Physics); Paul, E.S.; Beausang, C.W.; Ali, I.; Cullen, D.M.; Dagnall, P.J.; Fallon, P.; Joyce, M.J.; Sharpey-Schafer, J.F. (Liverpool Univ. (United Kingdom). Oliver Lodge Lab.); Astier, A.; Meyer, M.; Redon, N. (Inst. de Physique Nucleaire de Lyon, Univ. Claude Bernard, 69 - Villeurbanne (France)); Nazarewicz, W.; Wyss, R. (Joint Inst. for Heavy Ion Research, Oak Ridge, TN (United States))

    1992-05-01

    The nucleus {sup 197}Pb was populated via the {sup 186}W({sup 17}O, 6n){sup 197}Pb reaction at beam energies of 98 and 110 MeV. Two regular {Delta}I=1 bands of magnetic dipole transitions have been found. Possible interpretations in terms of collective oblate configurations involving high-K proton orbitals coupled to three i{sub 13/2} neutrons are discussed. The similarities between several of the bands discovered in {sup 197-200}Pb nuclei are emphasized. (orig.).

  16. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  17. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  18. 46 CFR 108.197 - Construction of accommodation spaces.

    Science.gov (United States)

    2010-10-01

    ... UNITS DESIGN AND EQUIPMENT Construction and Arrangement Accommodation Spaces § 108.197 Construction of accommodation spaces. (a) Each sleeping, mess, recreational, or hospital space that is adjacent to or... readily enter any sleeping, mess, recreational, or hospital space....

  19. 46 CFR 197.432 - Surface-supplied air diving.

    Science.gov (United States)

    2010-10-01

    ... STANDARDS GENERAL PROVISIONS Commercial Diving Operations Specific Diving Mode Procedures § 197.432 Surface..., another diver is stationed at the underwater point of entry and is line-tending the diver; (e) For...

  20. Identification of neutron-rich isotope 197Os

    International Nuclear Information System (INIS)

    A new neutron-rich isotope 197Os was produced in the 198Pt(n, 2p) reaction by irradiating natural Pt targets with 14 MeV neutrons. The γ(X) singles spectrum and coincidence spectrum measurements were performed using two HPGe γ-ray detectors. Ten unknown γ-rays at 41.2, 50.7, 196.8, 199.6, 223.9, 233.1, 250.2, 342.1, 403.6, and 460.4 keV attributed to the decay of 197Os were observed in the experiments. The half-life of 197Os was found to be (2.8 ± 0.6) min. A partial decay scheme of 197Os was proposed on the basis of decay and coincidence relations. The half-life was compared with the values expected by different theoretical models. (authors)

  1. Quest for toroidal freeze-out configuration in the central 197Au + 197Au collisions at 23 AMeV

    Directory of Open Access Journals (Sweden)

    Najman R.

    2015-01-01

    Full Text Available We present the results of the experiment performed by the CHIMERA collaboration with the 4π CHIMERA array, for the system 197Au+197Au at 23 AMeV. The experimental data are compared with ETNA and QMD model predictions. Efficiency factor is used as an indication of the formation of an exotic freeze-out configuration. Comparison between experimental data and model predictions may indicate the formation of flat/toroidal nuclear systems.

  2. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  3. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  4. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  5. Freeze-out configuration properties in the 197Au + 197Au reaction at 23 AMeV

    CERN Document Server

    Najman, R; Sochocka, A; Amorini, F; Auditore, L; Cap, T; Cardella, G; De Filippo, E; Geraci, E; Grzeszczuk, A; Kowalski, S; Kozik, T; Lanzalone, G; Lombardo, I; Majka, Z; Nicolis, N G; Pagano, A; Piasecki, E; Pirrone, S; Politi, G; Rizzo, F; Russotto, P; Siwek-Wilczynska, K; Skwira-Chalot, I; Trifiro, A; Trimarchi, M; Wilczynski, J; Zipper, W

    2015-01-01

    Data from the experiment on the 197Au + 197Au reaction at 23 AMeV are analyzed with an aim to find signatures of exotic nuclear configurations such as toroid-shaped objects. The experimental data are compared with predictions of the ETNA code dedicated to look for such configurations and with the QMD model. A novel criterion of selecting events possibly resulting from the formation of exotic freeze-out configurations, "the efficiency factor", is tested. Comparison between experimental data and model predictions may indicate for the formation of flat/toroidal nuclear systems.

  6. 27 CFR 26.197 - Furnishing formula to consignee.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Furnishing formula to... Custody to Internal Revenue Bond § 26.197 Furnishing formula to consignee. Prior to the first shipment... formula covering such spirits to the appropriate TTB officer, and to the proprietor of each...

  7. 49 CFR 173.197 - Regulated medical waste.

    Science.gov (United States)

    2010-10-01

    ... must be disinfected by any means effective for neutralizing the infectious substance the packaging... SHIPMENTS AND PACKAGINGS Non-bulk Packaging for Hazardous Materials Other Than Class 1 and Class 7 § 173.197... requirements of Part 178 of this subchapter at the Packing Group II performance level. A non-bulk...

  8. 40 CFR 197.31 - What is a representative volume?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false What is a representative volume? 197... a representative volume? (a) It is the volume of ground water that would be withdrawn annually from... Yucca Mountain disposal system that will be in the representative volume. The DOE must then use...

  9. 7 CFR 800.197 - Approval as a scale testing and certification organization.

    Science.gov (United States)

    2010-01-01

    ... organization. 800.197 Section 800.197 Agriculture Regulations of the Department of Agriculture (Continued... § 800.197 Approval as a scale testing and certification organization. (a) Who may apply. Any State... to test weighing equipment and has a working knowledge of the regulations and instructions...

  10. 40 CFR 197.26 - What are the circumstances of the human intrusion?

    Science.gov (United States)

    2010-07-01

    ... human intrusion? 197.26 Section 197.26 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... YUCCA MOUNTAIN, NEVADA Public Health and Environmental Standards for Disposal Human-Intrusion Standard § 197.26 What are the circumstances of the human intrusion? For the purposes of the analysis of...

  11. 46 CFR Appendix A to Part 197 - Air No-Decompression Limits

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Air No-Decompression Limits A Appendix A to Part 197... STANDARDS GENERAL PROVISIONS Pt. 197, App. A Appendix A to Part 197—Air No-Decompression Limits The following table gives the depth versus bottom time limits for single, no-decompression, air dives...

  12. Theranostic mercury: 197(m)Hg with high specific activity for imaging and therapy

    International Nuclear Information System (INIS)

    The no carrier added (NCA) radionuclide 197(m)Hg is accessible through proton induced nuclear reactions on gold. The decay properties of both simultaneous produced nuclear isomers 197mHg and 197Hg like convenient half life, low energy gamma radiations for imaging, Auger and conversion electrons for therapy are combined with unique chemical and physical properties of mercury and its compounds. Gold as a monoisotopic element has a natural abundance of 100% 197Au superseding expensive enrichment for the target material. Additionally, the high thermal conductivity of gold enables high beam current irradiations. For separation of target material a liquid–liquid extraction method was applied. - Highlights: • No carrier added 197(m)Hg. • 197(m)Hg promising for therapeutic application. • 197(m)Hg for imaging

  13. Stability and in vivo behavior of Rh[16aneS4-diol]211At complex: A potential precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Introduction: The heavy halogen 211At is of great interest for targeted radiotherapy because it decays by the emission of short-range, high-energy α-particles. However, many astatine compounds that have been synthesized are unstable in vivo, providing motivation for seeking other 211At labeling strategies. One relatively unexplored approach is to utilize prosthetic groups based on astatinated rhodium (III) complex stabilized with a tetrathioether macrocyclic ligand – Rh[16aneS4-diol]211At. The purpose of the current study was to evaluate the in vitro and in vivo stability of this complex in comparison to its iodine analog – Rh[16aneS4-diol]131I. Methods: Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I complexes were synthesized and purified by HPLC. The stability of both complexes was evaluated in vitro by incubation in phosphate-buffered saline (PBS) and human serum at different temperatures. The in vivo behavior of the two radiohalogenated complexes was assessed by a paired-label biodistribution study in normal Balb/c mice. Results: Both complexes were synthesized in high yield and purity. Almost no degradation was observed for Rh[16aneS4-diol]131I in PBS over a 72 h incubation. The astatinated analog exhibited good stability in PBS over 14 h. A slow decline in the percentage of intact complex was observed for both tracers in human serum. In the biodistribution study, retention of 211At in most tissues was higher than that of 131I at all time points, especially in spleen and lungs. Renal clearance of Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I predominated, with 84.1 ± 2.3% and 94.6 ± 0.9% of injected dose excreted via the urine at 4 h. Conclusions: The Rh[16aneS4-diol]211At complex might be useful for constructing prosthetic groups for the astatination of biomolecules and further studies are planned to evaluate this possibility

  14. MOA-2007-BLG-197: Exploring the brown dwarf desert

    CERN Document Server

    Ranc, C; Albrow, M D; Kubas, D; Bond, I A; Batista, V; Beaulieu, J -P; Bennett, D P; Dominik, M; Dong, Subo; Fouqué, P; Gould, A; Greenhill, J; Jørgensen, U G; Kains, N; Menzies, J; Sumi, T; Bachelet, E; Coutures, C; Dieters, S; Prester, D Dominis; Donatowicz, J; Gaudi, B S; Han, C; Hundertmark, M; Horne, K; Kane, S R; Lee, C -U; Marquette, J -B; Park, B -G; Pollard, K R; Sahu, K C; Street, R; Tsapras, Y; Wambsganss, J; Williams, A; Zub, M; Abe, F; Fukui, A; Itow, Y; Masuda, K; Matsubara, Y; Muraki, Y; Ohnishi, K; Rattenbury, N; Saito, To; Sullivan, D J; Sweatman, W L; Tristram, P J; Yock, P C M; Yonehara, A

    2015-01-01

    We present the analysis of MOA-2007-BLG-197Lb, the first brown dwarf companion to a Sun-like star detected through gravitational microlensing. The event was alerted and followed-up photometrically by a network of telescopes from the PLANET, MOA, and uFUN collaborations, and observed at high angular resolution using the NaCo instrument at the VLT. From the modelling of the microlensing light curve, we derived the binary lens separation in Einstein radius units (s~1.13) and a mass ratio of (4.732+/-0.020)x10^{-2}. Annual parallax, lens orbital motion and finite source effects were included in the models. To recover the lens system's physical parameters, we combined the resulting light curve best-fit parameters with (J,H,Ks) magnitudes obtained with VLT NaCo and calibrated using IRSF and 2MASS data. We derived a lens total mass of 0.86+/-0.04 Msun and a lens distance of 4.2+/-0.3 kpc. We find that the companion of MOA-2007-BLG-197L is a brown dwarf of 41+/-2 Mjup observed at a projected separation of 4.3+/-0.1 A...

  15. Studies of {sup 194,195,197}Po

    Energy Technology Data Exchange (ETDEWEB)

    Carpenter, M.P.; Ahmad, I.; Crowell, B. [and others

    1995-08-01

    The energy systematics of low-lying polonium states show sudden changes near N = 114. The observed drops in the low-lying levels of {sup 196,198}Po relative to the heavier isotopes indicate significant changes in the underlying structure of these nuclei. It is thought that this change is due to the onset of vibrational collectivity brought about by the quadrupole interaction between neutron and proton-pairs. In order to extend the Po systematics even further, we measured, for the first time, states in {sup 194,195,197}Po using the {sup 28}Si + {sup 170}Yb reaction at a beam energy of 142 MeV. The beam was supplied by ATLAS, and the data were taken with 10 Compton-suppressed Ge detectors placed at the target position of the Fragment Mass Analyzer. Preliminary level schemes were constructed for {sup 194,195,197}Po based on {gamma}-{gamma} and {gamma}-FMA coincidences. The results for {sup 194}Po show that the 2{sup +} - 0{sup +} transition energy decreased in energy by 140 keV relative to {sup 196}Po suggesting that this nucleus moved beyond the vibrational limit to more collective motion. An extrapolation of the systematics predicts that the 2{sup +} energy could drop another 140 keV between {sup 194}Po and {sup 192}Po which would indicate the onset of rotational motion. Currently, we have an approved experiment to investigate the decay of yrast isomers in {sup 194}Po which will allow us to (1) confirm our earlier level scheme of {sup 194}Po, and (2) assess the experimental conditions needed for a future study of {sup 192}Po.

  16. Photon and Pi 0 production in 197Au + 197Au collisions at √ SNN = 130 GeV

    International Nuclear Information System (INIS)

    Inclusive transverse momentum spectra of photons and π0s at mid-rapidity are studied as a function of collision centrality for 197Au+ 197Au collisions at √sNN = 130 GeV. Photon pair conversions have been reconstructed from charged tracks measured by the main Time Project Chamber of the STAR experiment at the RHIC heavy ion facility. The transverse momentum resolution of photons with this method is estimated to be Δpt/pt = 2% at 0.125 GeV/c and 5% at 2.5 GeV/c. Photon spectra were measured up to a transverse momentum of 2.4 GeV/c between ± 0.5 units of rapidity. The dominant photon production mechanism, the π0 → γγ decay, was measured between 0.25-2.5 GeV/c and ± 1 units of rapidity. Spectra are reported for the top 11%, 11-34% and 34-85% centrality classes. It was observed that in mid-central and central collisions the relative contribution of the π0 → γγ decay to the inclusive photon spectrum decreases above a transverse momentum of 1.65 GeV/c. In central collisions the magnitude of the decrease from pt = 1.65 GeV/c to 2.4 GeV/c is 20%. It is unlikely that contributions from other π0 decay channels and other particle decays fully explain this decrease. The centrality dependence on the shapes of the π0 spectra was analyzed with Boltmann and Bose-Einstein functions. In the transverse momentum windows of the spectra, the extracted temperatures are near 0.295 GeV. These temperatures are substantially higher than those extracted from π± spectra in a lower range of transverse momentum. This is an indication that the shapes of the pion spectra deviate from purely exponential shapes

  17. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D., Scott

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  18. 13 CFR 120.197 - Notifying SBA's Office of Inspector General of suspected fraud.

    Science.gov (United States)

    2010-01-01

    ... Inspector General of suspected fraud. 120.197 Section 120.197 Business Credit and Assistance SMALL BUSINESS... of Inspector General of suspected fraud. Lenders, CDCs, Borrowers, and others must notify the SBA Office of Inspector General of any information which indicates that fraud may have occurred in...

  19. 15 CFR 19.7 - When will Commerce entities compromise a Commerce debt?

    Science.gov (United States)

    2010-01-01

    ... Commerce entity may compromise the Commerce debt in accordance with the provisions of 31 CFR part 902 and... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false When will Commerce entities compromise a Commerce debt? 19.7 Section 19.7 Commerce and Foreign Trade Office of the Secretary of...

  20. Near-Barrier Neutron Transfer in Reactions 3,6He+197Au

    Science.gov (United States)

    Samarin, V. V.; Naumenko, M. A.; Penionzhkevich, Yu. E.; Skobelev, N. K.; Kroha, V.; Mrazek, J.

    2015-06-01

    Experimental excitation functions for near-barrier neutron transfer in 3,6He+197Au reactions have been measured and analyzed. Time-dependent Schrödinger equation and coupled channel equations for external neutrons of 3,6He and 197Au nuclei have been solved numerically taking into account spin-orbit interaction and Pauli exclusion principle.

  1. Study of fusion barrier distribution from quasielastic scattering for 6,7Li + 197Au systems

    International Nuclear Information System (INIS)

    Earlier we have reported breakup and fusion excitation function measurements in 6,7Li + 197Au systems. In this paper we present the fusion barrier distribution from QEL at backward angles for the same systems, namely, 6,7Li + 197Au

  2. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    International Nuclear Information System (INIS)

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET α-emitter astatine-211 (211At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 (123I), 340-fold for technetium-99m pertechnetate (99mTcO4-) and 60-fold for 211At. Cellular 211At accumulation was found to be dependent on extracellular Na+ ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and 99mTcO4- uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated 211At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and 211At were rapidly (apparent t1/2 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times (123I), 25 times (99mTcO4-) and 10 times (211At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of 123I and 211At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for 123I, 5.2 h for 211At) and preliminary dosimetric calculations indicate high tumour absorbed doses (3.5 Gy/MBqtumour for 131I and 50.3 Gy/MBqtumour for 211At). In

  3. Measurement of yields for the {sup 197}Au(γ,xn){sup 197-x}Au reactions induced by 2.5 GeV Bremsstrahlung

    Energy Technology Data Exchange (ETDEWEB)

    Hien, Nguyen Thi; Kim, Guinyun; Kim, Kwangsoo; Shahid, Muhammad; Zaman, Muhammah; Nadeem, Muhammad [Kyungpook National University, Daegu (Korea, Republic of); Khue, Pham Duc; Thanh, Kim Tien; Do, Nguyen Van [Vietnam Academy of Science and Technology, Hanoi (Viet Nam)

    2015-05-15

    Studies of high-energy nuclear reactions are of great important. It may help in deeper understanding of the reaction mechanisms and in extending of various fields of applications such as astrophysics, radiation physics, intense neutron source production and nuclear waste transmutation. The aim of the present work is to investigate the multineutron photonuclear on {sup 197}Au bombarded by 2.5 GeV Bremsstrahlung. Most of the photodisintegration products of gold with half-lives sufficient for the activity measurement. In this work, the necessary corrections were made in order to improve the accuracy of the experimental results The obtained experimental results are in good agreement with the calculated values. The yields for the {sup 197}Au(γ,xn){sup 197}-xAu reactions depend not only on the excitation energies but also on the number of neutrons ejected.

  4. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    Energy Technology Data Exchange (ETDEWEB)

    Petrich, T.; Helmeke, H.-J.; Meyer, G.J.; Knapp, W.H.; Poetter, E. [Department of Nuclear Medicine, Medizinische Hochschule Hannover (Germany)

    2002-07-01

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET {alpha}-emitter astatine-211 ({sup 211}At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 ({sup 123}I), 340-fold for technetium-99m pertechnetate ({sup 99m}TcO{sub 4}{sup -}) and 60-fold for {sup 211}At. Cellular {sup 211}At accumulation was found to be dependent on extracellular Na{sup +} ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and {sup 99m}TcO{sub 4}{sup -} uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated {sup 211}At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and {sup 211}At were rapidly (apparent t{sub 1/2} 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times ({sup 123}I), 25 times ({sup 99m}TcO{sub 4}{sup -}) and 10 times ({sup 211}At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of {sup 123}I and {sup 211}At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for {sup 123}I, 5.2 h for {sup 211}At) and

  5. Fast neutron activation analysis of gold by inelastic scattering, 197Au(n,n'γ)197Aum, by means of plasma focus device

    International Nuclear Information System (INIS)

    The application of a Fast Neutron Activation Analysis (FNAA) technique on a samples of pure gold, irradiated by a plasma focus of 7 kJ, has been investigated. The reaction was the inelastic scattering of neutrons, 197Au(n,n'γ)197Aum. To avoid problems connected with peculiar features of the neutron emission from this kind of source, a preliminary standardization of the method has been carried out. The results obtained have a practical interest in view of possible applications to the technology of extraction of minerals. (author)

  6. Photoactivation experiment on 197Au and its implications for the dipole strength in heavy nuclei

    CERN Document Server

    Nair, C; Junghans, A R; Bemmerer, D; Beyer, R; Grosse, E; Klug, J; Kosev, K; Rusev, G; Schilling, K D; Schwengner, R; Wagner, A; 10.1103/PhysRevC.78.055802

    2008-01-01

    The 197Au(gamma,n) reaction is used as an activation standard for photodisintegration studies on astrophysically relevant nuclei. At the bremsstrahlung facility of the superconducting electron accelerator ELBE (Electron Linear accelerator of high Brilliance and low Emittance) of Forschungszentrum Dresden-Rossendorf, photoactivation measurements on 197Au have been performed with bremsstrahlung endpoint energies from 8.0 to 15.5 MeV. The measured activation yield is compared with previous experiments as well as with calculations using Hauser-Feshbach statistical models. It is shown that the experimental data are best described by a two-Lorentzian parametrization with taking the axial deformation of 197Au into account. The experimental 197Au(gamma,n) reaction yield measured at ELBE via the photoactivation method is found to be consistent with previous experimental data using photon scattering or neutron detection methods.

  7. Antigen Processing of the Heptavalent Pneumococcal Conjugate Vaccine Carrier Protein CRM197 Differs Depending on the Serotype of the Attached Polysaccharide

    OpenAIRE

    Leonard, Ethan G.; Canaday, David H.; Harding, Clifford V.; Schreiber, John R.

    2003-01-01

    The pneumococcal (Pn) conjugate vaccine includes seven different polysaccharides (PS) conjugated to CRM197. Utilizing antigen-processing cells and a CRM197-specific mouse T-cell hybridoma, we found that the serotype of conjugated PnPS dramatically affected antigen processing of CRM197. Unconjugated CRM197 and serotype conjugates 14 and 18C were processed more efficiently.

  8. Production of R 19.7 tex Rotor Yarn%R 19.7 tex转杯纱生产实践

    Institute of Scientific and Technical Information of China (English)

    赵艳; 韩利君

    2013-01-01

    To develop R 19.7 tex rotor yarn,according to viscose fiber characteristics,necessary technology measures were adopted in each process.Processing parameter was tested and optimized including raw material blending ratio,doubling number,draw sliver weight per unit,rotor speed and combing roller speed.Finally R 19.7 tex rotor yarn can be spun successfully,the quality can reach use demands.It is considered that the key rings of spinning fine viscose yarn are adopting larger ratio fine fiber,using three-times doubling,selecting lighter draw sliver weight per unit,optimizing rotor speed and combing roller speed,controlling temperature and humidity well.%为了开发R 19.7 tex转杯纱,针对粘胶纤维特点,在各工序采取必要工艺技术措施,并对原料混配比例、并合道数、熟条定量、转杯速度、分梳辊速度等工艺参数进行了试验优选,顺利纺制出R 19.7 tex转杯纱,较好地满足了使用要求.认为:选用较大比例细特纤维、采用三道并合、较轻熟条定量,优选转杯速度和分梳辊速度,控制好温湿度是纺好细号粘胶转杯纱的几个关键环节.

  9. Atlas of the Spectrum of a Platinum/Neon Hollow-Cathode Lamp in the Region 1130-4330 &#197

    Science.gov (United States)

    SRD 112 Atlas of the Spectrum of a Platinum/Neon Hollow-Cathode Lamp in the Region 1130-4330 &#197 (Web, free access)   Atlas of the Spectrum of a Platinum/Neon Hollow-Cathode Lamp in the Region 1130-4330 &#197 contains wavelengths and intensities for about 5600 lines in the region 4330 &#197. An atlas plot of the spectrum is given, with the spectral lines marked and their intensities, wavelengths, and classifications listed.

  10. Fission fragment angular distribution in 24Mg induced reactions on 192Os and 197Au

    International Nuclear Information System (INIS)

    Angular distributions of fission fragments have been measured in 24Mg + 192Os and 24Mg + 197Au reactions at Elab = 128 MeV which is close to entrance channel Coulomb barrier. Experimental angular anisotropies were in reasonably good agreement with those calculated using the statistical theory. Analysis of the angular distribution data of the present study and of our earlier measurement in 19F + 197Au reaction has shown that contribution from non-compound nucleus fission in these systems is not significant. (author)

  11. Shears band with a large dynamic moment of inertia in 197Bi

    International Nuclear Information System (INIS)

    High-spin states in 197Bi were studied with the AFRODITE γ-ray array at iThemba LABS using the 181Ta(22Ne, 6n) reaction at a beam energy of 125 MeV. A new shears band was found and linked to the low-lying states in 197Bi. Its dynamic moment of inertia, I(2), is considerably larger than the I(2) of the shears bands in the neighbouring Pb isotopes. This is probably a result of the involvement of an additional high-K h9/2 proton orbital. (orig.)

  12. 14 CFR 121.197 - Airplanes: Turbine engine powered: Landing limitations: Alternate airports.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplanes: Turbine engine powered: Landing... Performance Operating Limitations § 121.197 Airplanes: Turbine engine powered: Landing limitations: Alternate... turbine engine powered airplane unless (based on the assumptions in § 121.195 (b)) that airplane at...

  13. Evolution of the X-ray Properties of the Transient Magnetar XTE J1810-197

    CERN Document Server

    Alford, Jason

    2016-01-01

    We report on X-ray observations of the 5.54 s transient magnetar XTE J1810-197 using the XMM-Newton and Chandra observatories, analyzing new data from 2008 through 2014, and re-analyzing data from 2003 through 2007 with the benefit of these six years of new data. From the discovery of XTE J1810-197 during its 2003 outburst to the most recent 2014 observations, its 0.3-10 keV X-ray flux has declined by a factor of about 50 from 4.1E-11 to 8.1E-13 erg/cm^2/s. Its X-ray spectrum has now reached a steady state. Pulsations continue to be detected from a 0.3 keV thermal hot-spot that remains on the neutron star surface. The luminosity of this hot-spot exceeds XTE J1810-197's spin down luminosity, indicating continuing magnetar activity. We find that XTE J1810-197's X-ray spectrum is best described by a multiple component blackbody model in which the coldest 0.14 keV component likely originates from the entire neutron star surface, and the thermal hot-spot is, at different epochs, well described by an either one or ...

  14. 14 CFR Sec. 19-7 - Passenger origin-destination survey.

    Science.gov (United States)

    2010-01-01

    ... reporting purposes. The sample shall consist of at least 1 percent of the total lifted ticket flight coupons... Director, Office of Airline Information under the procedures in Sec. 1-2 of 14 CFR part 241. The data to be.... The authority for these instructions is found in 14 CFR part 241, section 19-7, and in the CAB...

  15. 197Au Moessbauer study of gold ores, mattes, roaster products, and gold minerals

    International Nuclear Information System (INIS)

    The chemical state of gold in gold ores, mattes and roaster products has been studied by 197Au Moessbauer spectroscopy. Gold minerals were studied in order to provide reference data for the ore spectra. 57Fe Moessbauer spectroscopy was used to monitor the iron-compounds always present in gold ores and to follow their transformations caused by smelting and roasting. (orig.)

  16. 32 CFR Appendix A to Part 197 - Explanation of Freedom of Information Act (5 U.S.C. 552) Exemptions

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Explanation of Freedom of Information Act (5 U.S.C. 552) Exemptions A Appendix A to Part 197 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS HISTORICAL RESEARCH IN THE FILES OF THE OFFICE OF THE SECRETARY OF DEFENSE (OSD) Pt. 197,...

  17. 49 CFR 40.197 - What happens when an employer receives a report of a dilute specimen?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false What happens when an employer receives a report of a dilute specimen? 40.197 Section 40.197 Transportation Office of the Secretary of Transportation PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Problems in Drug Tests §...

  18. High level accumulation of soluble diphtheria toxin mutant (CRM197) with co-expression of chaperones in recombinant Escherichia coli.

    Science.gov (United States)

    Mahamad, Pornpimol; Boonchird, Chuenchit; Panbangred, Watanalai

    2016-07-01

    CRM197 is the diphtheria toxin mutant used in many conjugate vaccines. A fusion CRM197 (fCRM197) containing all the tags conferred by the pET32a vector was produced as a soluble protein in Escherichia coli co-expressing several chaperone proteins in conjunction with low temperature cultivation. Trigger factor (Tf) enhanced formation of soluble fCRM197 (150.69 ± 8.95 μg/mL) to a greater degree than other chaperones when fCRM197 expression was induced at 25 °C for 12 h. However, prolonged cultivation resulted in a progressive reduction of fCRM197 accumulation. In contrast, at 15 °C cells, with or without Tf, fCRM197 accumulated to the highest level at 48 h (153.70 ± 13.14 μg/mL and 150.07 ± 8.13 μg/mL, respectively). Transmission electron microscopy (TEM) demonstrated that the formation of inclusion protein as well as cell lysis was reduced in cultures grown at 15 °C. Cell viability was substantially reduced in cells expressing Tf, compared to cultures without Tf, when fCRM197 was induced at 25 °C. The viability of Tf-expressing cells was enhanced when cultured at 15 °C. Both purified fCRM197 and CRM197 efficiently digested lambda DNA (λDNA) at 37 °C (92.78 and 97.45 %, respectively). Digestion efficiency of fCRM197 and CRM197 was reduced at 25 °C (80.80 and 62.73 %, respectively) and at 15 °C (7.34 and 24.79 %, respectively). These results demonstrating nuclease activity, enhanced cell lysis, and reduced cell viability are consistent with the finding of lower fCRM197 yield when cultivation and induction times were prolonged at 25 °C. The present work provides a procedure for the high-level production of soluble fCRM197 using E. coli as a heterologous host. PMID:27020286

  19. Durable donor engraftment after radioimmunotherapy using α-emitter astatine-211-labeled anti-CD45 antibody for conditioning in allogeneic hematopoietic cell transplantation.

    Science.gov (United States)

    Chen, Yun; Kornblit, Brian; Hamlin, Donald K; Sale, George E; Santos, Erlinda B; Wilbur, D Scott; Storer, Barry E; Storb, Rainer; Sandmaier, Brenda M

    2012-02-01

    To reduce toxicity associated with external γ-beam radiation, we investigated radioimmunotherapy with an anti-CD45 mAb labeled with the α-emitter, astatine-211 ((211)At), as a conditioning regimen in dog leukocyte antigen-identical hematopoietic cell transplantation (HCT). Dose-finding studies in 6 dogs treated with 100 to 618 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) without HCT rescue demonstrated dose-dependent myelosuppression with subsequent autologous recovery, and transient liver toxicity in dogs treated with (211)At doses less than or equal to 405 μCi/kg. Higher doses of (211)At induced clinical liver failure. Subsequently, 8 dogs were conditioned with 155 to 625 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) before HCT with dog leukocyte antigen-identical bone marrow followed by a short course of cyclosporine and mycophenolate mofetil immunosuppression. Neutropenia (1-146 cells/μL), lymphopenia (0-270 cells/μL), and thrombocytopenia (1500-6560 platelets/μL) with prompt recovery was observed. Seven dogs had long-term donor mononuclear cell chimerism (19%-58%), whereas 1 dog treated with the lowest (211)At dose (155 μCi/kg) had low donor mononuclear cell chimerism (5%). At the end of follow-up (18-53 weeks), only transient liver toxicity and no renal toxicity had been observed. In conclusion, conditioning with (211)At-labeled anti-CD45 mAb is safe and efficacious and provides a platform for future clinical trials of nonmyeloablative transplantation with radioimmunotherapy-based conditioning. PMID:22134165

  20. Intermediate mass fragment emission by 197Au projectiles at relativistic energy in nuclear emulsion

    International Nuclear Information System (INIS)

    The charge distribution of multifragment decays of 197Au projectiles at 10.6A GeV in nuclear emulsion is fitted with a power law. The correlations between the charges emitted are given as a function of the total charge confined in fragments Zbound for Z≥2, which is a measure of the violence of the collision. The observables of the present experiment are compared to the 197Au beam at 600A MeV in the domain of limiting fragmentation and they are also reproduced by the predictions of the statistical and the percolation models. Small changes in the values of some of these observables are revealed in the two energies

  1. Production of an injectable sup(197m)Hg solution with a compact cyclotron

    International Nuclear Information System (INIS)

    Injectable solutions of sup(197m)Hg were prepared by a (p,n) reaction on a gold target in a medical compact cyclotron. The recovery of sup(197m)Hg from the gold target as well as the problems of manipulating carrier-free radioactive mercury are described. The reaction threshold is 6 MeV and the gold target of 400 μm thickness is formed from four 'pure' gold foils with a surface of 24 cm2 and a thickness of 100 μm. The gold foils are laminated, covered with a 12 μm thick Al foil and fixed onto a copper target holder. The irradiation is performed for 1 to 2 hours with a 15 μA proton beam current. During this time target itselft is cooled with a helium stream and the copper target support is cooled from behind with a stream of compressed air. (T.I.)

  2. Study of fusion in 6,7Li+197Au near barrier energies

    International Nuclear Information System (INIS)

    Excitation functions are measured for complete fusion and transfer reactions of 6Li and 7Li with 197Au at energies around the Coulomb barrier. Coupled channel calculations including the couplings to both target and projectile excited states have been performed and are found to explain the data at energies below the barrier. At above barrier energies the complete fusion cross sections are found to be suppressed compared to the coupled channel calculations for both the systems. A systematic comparison of fusion cross-section for halo nuclei 6,8He and weakly bound stable nuclei 6,7Li on 197Au target is also presented. Large neutron transfer cross-sections are observed for 6,7Li as compared to tightly bound projectiles 12C,16O. (authors)

  3. 197Au Moessbauer studies of gold components and γ-ray irradiation effect

    International Nuclear Information System (INIS)

    The 197Au Moessbauer spectra of Au(I) (tmH2) and [Au(III)(tpp)][Au(III)Cl4] were measured. The isomer shifts and quadrupole splittings indicate that the gold compounds are in typical aurous and auric state, respectively. While no γ-ray irradiation effect was found in Au(tmH2), a novel Au(I) species was observed in γ-irradiated [Au(tpp)][AuCl4] by means of Moessbauer spectroscopy. (author)

  4. Re-evaluation and Re-commendation of Neutron Induced Data of 197Au

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The evaluation of neutron-induced data of 197Au with energy range from 10-5 eV to 20 MeV wascarried out. Based on the available measured data, the code APMN is used to get the neutron opticalpotential with energy region from 5 keV to 20 MeV based on the available measured data, such as totalcross section, non-elastic scattering cross sections and elastic angular distributions. The parameters for

  5. Association of G197 polymorphism of IL-17A gene with myocardial remodeling and aerobic performance in athletes.

    Science.gov (United States)

    Lifanov, A D; Khadyeva, M N; Demenev, S V; Knyazev, A N; Babushkin, Yu A; Astashina, E E

    2014-09-01

    We studied the relationship between G197A polymorphism of IL-17A gene and changes in morphometric echocardiography parameters and physiological parameters in skiers (19 examinees). Genotyping was performed by restriction fragment length polymorphism analysis and echocardiography using a Nemio MX ultrasound scanner (Toshiba). Association of 197A allele of IL-17A gene with low myocardial growth and high aerobic performance of athletes was demonstrated. PMID:25257435

  6. Cytotoxic activity of Tivantinib (ARQ 197) is not due solely to MET inhibition

    OpenAIRE

    Katayama, Ryohei; Aoyama, Aki; Yamori, Takao; Qi, Jie; Oh-hara, Tomoko; Song, Youngchul; Engelman, Jeffrey A.; Fujita, Naoya

    2013-01-01

    The receptor tyrosine kinase c-MET is the high-affinity receptor for the hepatocyte growth factor (HGF). The HGF/c-MET axis is often dysregulated in tumors. c-MET activation can be caused by MET gene amplification, activating mutations, and auto- or paracrine mechanisms. Thus, c-MET inhibitors are under development as anti-cancer drugs. Tivantinib (ARQ 197) was reported as a small molecule c-MET inhibitor and early clinical studies suggest anti-tumor activity. To assess if the anti-tumor acti...

  7. Dependence of spleen sequestration on erythrocytes following administration of various concentrations of BMHP-197Hg

    International Nuclear Information System (INIS)

    In the course of routine splenic scintiscanning, the effects of BMHP-Hg197 concentrations on the kinetics of damaged erythrocytes and on image quality have been investigated. The following findings were obtained: 1. Significant displacement of the Price-Jones curve in dependence of BMHP concentrations. 2. No significant enzymatic changes 3. An enhanced labelling index at high concentrations and a higher spleen sequestration rate 4. A significant improvement of scintiscan quality at higher concentrations 5. Erythrocyte washing before incubation with BMHP was unnecessary as it does not improve the results to an extent that would warrant the tedious procedure. (orig.)

  8. (π,πN) reactions on 25Mg and 197Au

    International Nuclear Information System (INIS)

    Activation cross sections have been measured for the reactions 25Mg(π+-,π+-N)24Na and 197Au(π+-,π+-N)196Au between 100 and 300 MeV. The cross section ratios R/sub p/ = sigma (π+)/sigma (π-) and R/sub n/ = sigma (π-)/sigma (π+) are smaller than the corresponding free-particle ratios in all cases. Comparisons with the predictions of intranuclear cascade calculations and the nucleon charge-exchange model indicate that the former gives good agreement for a heavy nucleus but not for light nuclei, while the inverse is true for the latter model

  9. Photon and Neutral Pi 0 production in (197)Au + (197)Au collisions at sqrt S(NN) = 130 GeV

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Ian J.

    2002-09-16

    Inclusive transverse momentum spectra of photons and {pi}{sup 0}s at mid-rapidity are studied as a function of collision centrality for {sup 197}Au+ {sup 197}Au collisions at {radical}s{sub NN} = 130 GeV. Photon pair conversions have been reconstructed from charged tracks measured by the main Time Project Chamber of the STAR experiment at the RHIC heavy ion facility. The transverse momentum resolution of photons with this method is estimated to be {Delta}p{sub t}/p{sub t} = 2% at 0.125 GeV/c and 5% at 2.5 GeV/c. Photon spectra were measured up to a transverse momentum of 2.4 GeV/c between {+-} 0.5 units of rapidity. The dominant photon production mechanism, the {pi}{sup 0} {yields} {gamma}{gamma} decay, was measured between 0.25-2.5 GeV/c and {+-} 1 units of rapidity. Spectra are reported for the top 11%, 11-34% and 34-85% centrality classes. It was observed that in mid-central and central collisions the relative contribution of the {pi}{sup 0} {yields} {gamma}{gamma} decay to the inclusive photon spectrum decreases above a transverse momentum of 1.65 GeV/c. In central collisions the magnitude of the decrease from p{sub t} = 1.65 GeV/c to 2.4 GeV/c is 20%. It is unlikely that contributions from other {pi}{sup 0} decay channels and other particle decays fully explain this decrease. The centrality dependence on the shapes of the {pi}{sup 0} spectra was analyzed with Boltmann and Bose-Einstein functions. In the transverse momentum windows of the spectra, the extracted temperatures are near 0.295 GeV. These temperatures are substantially higher than those extracted from {pi}{sup {+-}} spectra in a lower range of transverse momentum. This is an indication that the shapes of the pion spectra deviate from purely exponential shapes.

  10. CLINICAL OBSERVING AND ANALYSES OF ROOT-CARIES(197 CASES)%根面龋临床观察与分析(附197例)

    Institute of Scientific and Technical Information of China (English)

    刘虹; 谢晓莉; 米大丽

    2001-01-01

    Root-caries is the disease which is often occured in old people.We investigated 197 patients(40~85 years old) in stomatological clinic,and found that there were 114 patients who had root-caries,an the incidence of root-caries is 57.87 percent.There was a significantly different in incidence between middle-aged people and old ones(P<0.01),and no significantly diferent in incidence between men and women(P>0.05).This conclusion is different from some domestic reports.Root-Caries Index (RCI) is 0.26.The incidecnce of root-caries and value of RCI are directly proportionate with age,but value of RCI in group of 40~49 years old is higher than it in the group of 50~59 years old.Gingival atrophy is relate to root-caries closely.Root-caries is mostly occurred in mandibular molar teeth,and is seldom seen in mandibular front teeth.%根面龋是老年人常见的口腔疾病,我们对口腔门诊40~85岁197例患者进行调查,发现患根面龋人数114例,根龋发病率57.87%,中、老年人发病率有高度显著性差异(P<0.01),男女发病率差异无显著性(P>0.05),与国内有些报道相异。根龋指数RCI为0.26。受检患者根龋发病率、RCI值与年龄呈正相关,但40~49岁年龄组RCI数据高于50~59岁组。调查发现,牙龈退缩与根面龋密切相关。根龋发生最多的牙位是下磨牙,最少的是下前牙。

  11. The variable spin-down rate of the transient magnetar XTE J1810-197

    Science.gov (United States)

    Pintore, Fabio; Bernardini, Federico; Mereghetti, Sandro; Esposito, Paolo; Turolla, Roberto; Rea, Nanda; Coti Zelati, Francesco; Israel, Gian Luca; Tiengo, Andrea; Zane, Silvia

    2016-05-01

    We have analysed XMM-Newton and Chandra observations of the transient magnetar XTE J1810-197 spanning more than 11 yr, from the initial phases of the 2003 outburst to the current quiescent level. We investigated the evolution of the pulsar spin period and we found evidence for two distinct regimes: during the outburst decay, dot{ν } was highly variable in the range -(2-4.5) × 10-13 Hz s-1, while during quiescence the spin-down rate was more stable at an average value of -1 × 10-13 Hz s-1. Only during ˜3000 d (from MJD 54165 to MJD 56908) in the quiescent stage it was possible to find a phase-connected timing solution, with dot{ν }=-4.9× 10^{-14} Hz s-1, and a positive second frequency derivative, ddot{ν }=1.8× 10^{-22} Hz s-2. These results are in agreement with the behaviour expected if the outburst of XTE J1810-197 was due to a strong magnetospheric twist.

  12. The variable spin-down rate of the transient magnetar XTE J1810--197

    CERN Document Server

    Pintore, F; Mereghetti, S; Esposito, P; Turolla, R; Rea, N; Zelati, F Coti; Israel, G L; Tiengo, A; Zane, S

    2016-01-01

    We have analyzed XMM-Newton and Chandra observations of the transient magnetar XTE J1810-197, spanning more than 11 years, from the initial phases of the 2003 outburst to the current quiescent level. We investigated the evolution of the pulsar spin period and we found evidence for two distinct regimes: during the outburst decay, the spin derivative (nu_dot) was highly variable in the range -(2-4.5)x10^-13 Hz/s, while during quiescence the spin-down rate was more stable at an average value of -1x10^{-13} Hz/s. Only during ~3000 days (from MJD 54165 to MJD 56908) in the quiescent stage, it was possible to find a phase-connected timing solution, with nu_dot = -4.9x10^{-14} Hz/s, and a positive second frequency derivative, nu_dotdot = 1.8x10^{-22} Hz/s. These results are in agreement with the behavior expected if the outburst of XTE J1810-197 was due to a strong magnetospheric twist.

  13. Evaluation of Dual Energy X Ray Absorbsiometry and Osteoporosis Risk Factors in 197 Patients - Original Investigation

    Directory of Open Access Journals (Sweden)

    Şirin Raife Çoban

    2007-12-01

    Full Text Available Aim: To examine the risk factors for osteoporosis, dual energy X ray absorbsiometry (DXA measures, dorsolomber radiographics and laboratory analysis of 197 patients which followed in Goztepe Education and Research Hospital Physical Medicine and Rehabilitation Policlinics. Patients and Methods: 197 patients, ages between 37-78, which followed in Physical Medicine and Rehabilitation Policlinics, cross-sectionally evaluated. Patients interrogated about risk factors like life style, calcium-caffeine-alcohol consumption in nutrition, cigarette smoking, age ot menarch, number of births, time of menopause, physical activity levels and their dorsolomber AP-lateral radiograpichs, laboratory analysis and bone mineral density measures with DXA has done. Osteoporosis-osteopenia classification has done by the T score criterias of World Health Organisation. Pearson correlation analysis and ANOVA has used as statistical method. Results: Mean age was 59,24±8,33. Mean body mass index was 26,42±3,99. A significant correlation did not found between life style, nutrition, age of menarch, number of births, early fracture, compression fracture, sunbathe and T scores. A statistically significant correlation has found between age and femur neck T scores; body mass index and lomber-femoral T scores; time of menopause and femur neck T scores (p<0,005. Conclussion: A significant correlation did not found between the minimal risk factors and DXA measures. Age, body mass index and time of menopause has found related to bone mineral density measures. (From the World of Osteoporosis 2007;13:80-2

  14. Carrier priming effect of CRM197 is related to an enhanced B and T cell activation in meningococcal serogroup A conjugate vaccination. Immunological comparison between CRM197 and diphtheria toxoid.

    Science.gov (United States)

    Pecetta, S; Tontini, M; Faenzi, E; Cioncada, R; Proietti, D; Seubert, A; Nuti, S; Berti, F; Romano, M R

    2016-04-29

    Glycoconjugate vaccines are composed of capsular polysaccharides (CPSs) of a pathogenic bacteria covalently linked to carrier proteins. Pre-exposure to the carrier is known to influence the efficacy of the glycoconjugate, by inducing enhanced or suppressed anti-CPS response. Following our previous work on the immunogenicity of diphtheria toxin mutant CRM197 and formaldehyde-treated diphtheria toxoid (DT) as carriers for meningococcal A (MenA) conjugates in mouse model, we further investigated the role of the carrier on the immunological response to glycoconjugate vaccines. We previously showed that high dosage DT priming could result in carrier-induced epitopic suppression (CIES), an event that did not occur for CRM197 priming, and we observed that anti-DT IgGs could cross-react with DT based conjugates in vitro. Here, we confirmed the cross-reactivity of anti-carrier IgGs with DT conjugates in vivo. Furthermore, we analyzed the splenocytes of animals primed with the carrier and subsequently immunized with the MenA conjugate. Pre-exposure to the carrier protein, both CRM197 and DT, resulted in increased carrier-specific plasma and memory B cell response. However, only for CRM197 priming an enhanced carbohydrate-specific plasma cell response was observed. Analysis of circulating IgGs confirmed these observations. Memory to the CPS resulted to be non-influenced by carrier priming. Analysis of T helper response showed an enhancement effect for CRM197 priming, while DT priming resulted in constrained T cell activation. Stimulation with CRM197, which does not require formaldehyde detoxification, of splenocytes from animal immunized with DT suggested that the formaldehyde treatment used to produce DT might be the cause of limited presentation of the antigen to the T cells. We concluded that the dominant carrier-specific B cell response in case of limited T cell recruitment might explain the previously observed CIES phenomenon in case of DT priming. PMID:27015733

  15. Near-barrier neutron transfer in reactions 3,6He + 45Sc and 3,6He + 197Au

    Science.gov (United States)

    Samarin, V. V.; Naumenko, M. A.; Penionzhkevich, Yu E.; Skobelev, N. K.; Kroha, V.; Mrazek, J.

    2016-06-01

    Experimental cross sections for formation of 196,198Au isotopes in reactions 3,6He + 197Au and cross sections for formation of 44,46Sc isotopes in reactions 3,6He + 45Sc have been analyzed. To calculate neutron transfer probabilities and cross sections the time- dependent Schrödinger equation for external neutrons of 3He, 6He, 45Sc and 197Au nuclei has been solved numerically. It is shown that the contribution of fusion and subsequent evaporation is significant in the case of reactions 3,6He + 45Sc, whereas in the case of reactions 3,6He + 197Au, it is negligible. Fusion-evaporation was taken into account using NRV evaporation code. Results of calculations demonstrate overall satisfactory agreement with experimental data.

  16. The neutron emission induced by the radioactive nuclear beam 17N on targets 9Be and 197Au

    International Nuclear Information System (INIS)

    The neutron energy spectra emitted in the reactions of 33.4MeV/u 17N on 9Be and 197Au targets have been measured at different angles with the time of flight method. The angular distributions were composed of two components: one focused into a narrow angle range around the beam direction and another extended over a large angle region. Integrating the angular distribution, the obtained total cross sections of neutron emission were (15.2 +- 1.7) x 10-28m2 and (120 +- 20) x 10-28m2 barns respectively for 9Be and 197Au targets

  17. 197Au İçin Reaksiyon Tesir Kesiti Hesaplamaları

    OpenAIRE

    ÖZDOĞAN, Hasan; KAPLAN, Abdullah

    2013-01-01

    Özet: Bu çalışmada, 197Au izotopunun nötron üretim tesir kesitleri denge ve denge-öncesi nükleer reaksiyon modelleri kullanılarak hesaplanmıştır. Denge durumu hesaplamaları için; Weisskopf-Ewing model, denge-öncesi hesaplamalar için ise; Hibrit, Geometri Bağımlı Hibrit ve İki Bileşenli Eksiton model kullanılmıştır. Weisskopf-Ewing, Hibrit ve Geometri Bağımlı Hibrit modelleri için ALICE/ASH; İki Bileşenli Eksiton modeli için TALYS 1.2 bilgisayar programları kullanılmıştır. Hesaplanan tesir kes...

  18. A single tracer method for background subtraction in 197HgCl2 renal uptake measurements

    International Nuclear Information System (INIS)

    The 197HgCl2 renal uptake was measured in 70 patients in order to study the degree of the background activity and to determine the best correction method. The deduction of background activity was made: a) From a concentric perirenal region of interest with no additional correction. b) Using a double tracer technique with colloid sup(99m)Tc, subtracting consecutively the liver and spleen activity and the residual background. Comparison of the results revealed: a) The correction of background activity significantly altered the uptake estimations, and thus must include both the liver and spleen activity, and the residual background. b) The choice of a median region of interest for the residual background evaluation led to a systematic error. c) The assessment of background activity, based upon a perirenal region of interest provided a sufficiently precise and reliable correction of the total background, while avoiding the inconveniences associated with the double tracer method. (orig.)

  19. Fusion-Fission of $^{16}O+^{197}Au$ at Sub-Barrier Energies

    CERN Document Server

    Back, B B; Janssens, R V F; Henderson, D J; Shumard, B R; Lister, C J; Peterson, D; Rehm, K E; Tanihata, I; Tang, X; Wang, X; Zhu, S

    2006-01-01

    The recent discovery of heavy-ion fusion hindrance at far sub-barrier energies has focused much attention on both experimental and theoretical studies of this phenomenon. Most of the experimental evidence comes from medium-heavy systems such as Ni+Ni to Zr+Zr, for which the compound system decays primarily by charged-particle evaporation. In order to study heavier systems, it is, however, necessary to measure also the fraction of the decay that goes into fission fragments. In the present work we have, therefore, measured the fission cross section of 16O+197Au down to unprecedented far sub-barrier energies using a large position sensitive PPAC placed at backward angles. The preliminary cross sections will be discussed and compared to earlier studies at near-barrier energies. No conclusive evidence for sub-barrier hindrance was found, probably because the measurements were not extended to sufficiently low energies.

  20. Yeast Interacting Proteins Database: YHR197W, YLR423C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ng of ITS2 sequences from 35S pre-rRNA; Rix1 complex associates with Mdn1p in pre-60S ribosomal particles...lex (Rix1p, Ipi1p, Ipi3p) that is required for processing of ITS2 sequences from 35S pre-rRNA; Rix1 complex associates wit...YHR197W RIX1 Essential component of the Rix1 complex (Rix1p, Ipi1p, Ipi3p) that is required for processi... gene name RIX1 Bait description Essential component of the Rix1 comp...ization; regulatory subunit of an autophagy-specific complex that includes Atg1p and Atg13p; stimulates Atg1p kinase activit

  1. Breakup mechanisms for 7Li + 197Au, 204Pb systems at sub-barrier energies

    Directory of Open Access Journals (Sweden)

    Luong D.H.

    2013-12-01

    Full Text Available Coincidence measurements of breakup fragments were carried out for the 7Li + 197Au and 204Pb systems at sub-barrier energies. The mechanisms triggering breakup, and time-scales of each process, were identified through the reaction Q-values and the relative energy of the breakup fragments. Binary breakup of 7Li were found to be predominantly triggered by nucleon transfer, with p-pickup leading to 8Be → α + α decay being the preferred breakup mode. From the time-scales of each process, the coincidence yields were separated into prompt and delayed components, allowing the identification of breakup process important in the suppression of complete fusion of 7Li at above-barrier energies.

  2. Mercury methylation and reduction potentials in marine water: An improved methodology using 197Hg radiotracer

    International Nuclear Information System (INIS)

    A highly sensitive laboratory methodology for simultaneous determination of methylation and reduction of spiked inorganic mercury (Hg2+) in marine water labelled with high specific activity radiotracer (197Hg prepared from enriched 196Hg stable isotope) was developed. A conventional extraction protocol for methylmercury (CH3Hg+) was modified in order to significantly reduce the partitioning of interfering labelled Hg2+ into the final extract, thus allowing the detection of as little as 0.1% of the Hg2+ spike transformed to labelled CH3Hg+. The efficiency of the modified CH3Hg+ extraction procedure was assessed by radiolabelled CH3Hg+ spikes corresponding to concentrations of methylmercury between 0.05 and 4 ng L−1. The recoveries were 73.0±6.0% and 77.5±3.9% for marine and MilliQ water, respectively. The reduction potential was assessed by purging and trapping the radiolabelled elemental Hg in a permanganate solution. The method allows detection of the reduction of as little as 0.001% of labelled Hg2+ spiked to natural waters. To our knowledge, the optimised methodology is among the most sensitive available to study the Hg methylation and reduction potential, therefore allowing experiments to be done at spikes close to natural levels (1–10 ng L−1). - Highlights: ► Inorganic mercury methylation and reduction in marine water were studied. ► High specific activity 197Hg was used to label Hg2+ spikes at natural levels. ► Methylmercury extraction had 73% efficiency for 0.05–4 ng L−1 levels. ► High sensibility to assess methylation potentials, below 0.1% of the spike. ► High sensibility also for reduction potentials, as low as 0.001% of the spike.

  3. Simultaneous tracing of 131-I-hippuran and 197-Hg-chlormerodrin uptake curve in obstructive uropathy

    International Nuclear Information System (INIS)

    With a double isotope technique, simultaneous tracing of 131I-hippuran renogram and 197Hg-chlormerodrin uptake curve are routinely carried out. This procedure not only saved the time required for each tracing, but served to quantitatively evaluate renograms in patients with urinary tract abnormalities. The dose of 197Hg used was more than 5 times larger than that of 131I, since the rate of 131I counts in the 197Hg window was experimentally confirmed to be less than 10 per cent at these doses. The changes of urine flow from the pelvis to the bladder caused by acute ureteral obstruction, voiding in the presence of vesicoureteral reflux, and bladder filling, altered the hippuran renogram pattern. These alterations were characterized by a delay in excretory phase, a sudden elevation of slow down curve, and a prolongation or renal transit time. However, the chlormerodrin uptake curves were not affected by these changes in urine flow. Bladder emptying by catheterization in patients with large amounts of residual urine produced a renogram pattern with shortened transit time, and revealed that the T 1/2 value of the slow component of blood disappearance curve was also decreased. However, changes of the chlormerodrin uptake curve and its blood disappearance curve after bladder emptying were negligible. Problems of computer assessment of 131I-hippuran renograms in patients with urinary tract abnormalities were investigated, and the advantages of simultaneous tracing of 197Hg-chlormerodrin uptake curve were emphasized. (auth.)

  4. FUSION OF SI-28 NUCLEI AT 12.4, 19.7, AND 30.0 MEV NUCLEON

    NARCIS (Netherlands)

    MEIJER, RJ; BOX, PF; DECOWSKI, P; GIERLIK, E; KAMERMANS, R; VANNIEWENHUIZEN, GJ; GRIFFIOEN, KA; WILSCHUT, HW; GIORNI, A; MORAND, C; DEMEYER, A; GUINET, D

    1991-01-01

    Detailed angular distributions of protons and alpha particles detected in coincidence with evaporation residues have been measured for the reaction Si-28+Si-28 at 12.4, 19.7, and 30.0 MeV/nucleon. We have separated these angular distributions into pre-equilibrium and evaporation components. The inva

  5. m197wo.m77t and m197wo.h77t: MGD77T data and header files for single-beam bathymetry data for field activity M-1-97-WO in Southwest Washington Inner Shelf from 07/07/1997 to 07/15/1997

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS and GPS navigation data were collected as part of the U.S. Geological Survey cruise M-1-97-WO. The cruise was conducted...

  6. Mercury methylation and reduction potentials in marine water: An improved methodology using {sup 197}Hg radiotracer

    Energy Technology Data Exchange (ETDEWEB)

    Koron, Neza [National Institute of Biology, Marine Biology Station, Fornace 41, 6330 Piran (Slovenia); Bratkic, Arne [Department of Environmental Sciences, ' Jozef Stefan' Institute, Jamova 39, 1000 Ljubljana (Slovenia); Ribeiro Guevara, Sergio, E-mail: ribeiro@cab.cnea.gov.ar [Laboratorio de Analisis por Activacion Neutronica, Centro Atomico Bariloche, Av. Bustillo km 9.5, 8400 Bariloche (Argentina); Vahcic, Mitja; Horvat, Milena [Department of Environmental Sciences, ' Jozef Stefan' Institute, Jamova 39, 1000 Ljubljana (Slovenia)

    2012-01-15

    A highly sensitive laboratory methodology for simultaneous determination of methylation and reduction of spiked inorganic mercury (Hg{sup 2+}) in marine water labelled with high specific activity radiotracer ({sup 197}Hg prepared from enriched {sup 196}Hg stable isotope) was developed. A conventional extraction protocol for methylmercury (CH{sub 3}Hg{sup +}) was modified in order to significantly reduce the partitioning of interfering labelled Hg{sup 2+} into the final extract, thus allowing the detection of as little as 0.1% of the Hg{sup 2+} spike transformed to labelled CH{sub 3}Hg{sup +}. The efficiency of the modified CH{sub 3}Hg{sup +} extraction procedure was assessed by radiolabelled CH{sub 3}Hg{sup +} spikes corresponding to concentrations of methylmercury between 0.05 and 4 ng L{sup -1}. The recoveries were 73.0{+-}6.0% and 77.5{+-}3.9% for marine and MilliQ water, respectively. The reduction potential was assessed by purging and trapping the radiolabelled elemental Hg in a permanganate solution. The method allows detection of the reduction of as little as 0.001% of labelled Hg{sup 2+} spiked to natural waters. To our knowledge, the optimised methodology is among the most sensitive available to study the Hg methylation and reduction potential, therefore allowing experiments to be done at spikes close to natural levels (1-10 ng L{sup -1}). - Highlights: Black-Right-Pointing-Pointer Inorganic mercury methylation and reduction in marine water were studied. Black-Right-Pointing-Pointer High specific activity {sup 197}Hg was used to label Hg{sup 2+} spikes at natural levels. Black-Right-Pointing-Pointer Methylmercury extraction had 73% efficiency for 0.05-4 ng L{sup -1} levels. Black-Right-Pointing-Pointer High sensibility to assess methylation potentials, below 0.1% of the spike. Black-Right-Pointing-Pointer High sensibility also for reduction potentials, as low as 0.001% of the spike.

  7. Treatment of cultured glioma cells with the EGFR-TKI gefitinib (''Iressa'', ZD1839) increases the uptake of astatinated EGF despite the absence of gefitinib-mediated growth inhibition

    International Nuclear Information System (INIS)

    The EGFR-TKI (epidermal growth factor receptor tyrosine kinase inhibitor) gefitinib (''Iressa'', ZD1839), a reversible growth inhibitor of EGFR-expressing tumour cells, has been shown to enhance the antitumour effect of ionising radiation, and also to increase the uptake of radioiodinated EGF. Thus, combination of gefitinib treatment and radionuclide targeting is an interesting option for therapy of brain tumours that are difficult to treat with conventional methods. The aim of this study was to evaluate how pre-treatment with gefitinib affects binding of astatinated EGF (211At-EGF) to cultured glioma U343 cells, which express high levels of EGFR. The growth of U343 cells in the presence of gefitinib was investigated, and it was found that gefitinib does not significantly inhibit the growth of these cells. Nevertheless, the uptake of 211At-EGF in U343 cells was markedly increased (up to 3.5 times) in cells pre-treated with gefitinib (1 μM). This indicates that a combination of gefitinib treatment and radionuclide targeting to EGFR might be a useful therapeutic modality, even for patients who do not respond to treatment with gefitinib alone. (orig.)

  8. Production of radio-isotopes 197Hg and 198Au from 198Hg

    International Nuclear Information System (INIS)

    Studies on excitation functions of neutron induced reactions are of considerable importance for testing nuclear models as well as for practical applications. Mercury can be a suitable material for spallation neutron source in an accelerator driven system (ADS) if corrosion, due to chemical wetting, gradient mass transfer, and high density heat generation are taken care of. In order to design the target system, estimation of induced activity in the target is important among other factors. In an ADS this radioactivity is induced by neutrons along with that by the primary projectile. An ADS is operated at a few GeV beam energy, but often logistic studies are carried out at much lower energies. Quantitative knowledge of the induced activity at such operating parameters is important for proper planning of the experiments. The aim of the present work is to determine the excitation functions of 198Hg (n, 2n) 197Hg and 198Hg (n, p) 198Au reactions for 1-50 MeV energy using statistical and pre-equilibrium nuclear reaction model codes. This will help us to determine the total yield and induced activities due to these radio nuclides. The computed excitation functions are compared with and the reported measured data and cross sections from ENDF database

  9. Quantitative renal scintigraphy: anatomo-clinical and biological correlation (concerning 51 mercury 197 renal scintigraphs)

    International Nuclear Information System (INIS)

    To find out whether the renal mercury uptake measurement in urology is a satisfactory way to judge the separate functional value of the kidneys the records of 51 patients were examined. The exploration took place as follows: - injection of 300 μCi 197HgCl2, - measurement of the radioactivity fixed on each kidney, three days later, by means of a gamma camera. Of these 51 uptake measurements only one result appears inconsistent by excess. All the others agree perfectly with comparative observations. On the whole a close correlation is found between the renal mercury uptake measurement and the various clinical, urographic and anatomical data obtained on this group of patients. The method seems to be ideal because reliable, harmless and repeatable. Where dosimetry is concerned an injected dose of 300μCi delivers 9mrad to each kidney, 6mrad to the ovaries. By way of comparison it is interesting to note that an intraveinous urograph with 5 exposures delivers 500mrad to the ovaries. It is considered safe to repeat the examination 3 to 4 times on one patient

  10. $^{197}$Au($n,\\gamma$) cross section in the unresolved resonance region

    CERN Document Server

    Lederer, C.; Domingo-Pardo, C; Gunsing, F; Kappeler, F; Massimi, C.; Mengoni, A.; Wallner, A.; Abbondanno, U.; Aerts, G.; Alvarez, H.; Alvarez-Velarde, F.; Andriamonje, S.; Andrzejewski, J.; Assimakopoulos, P.; Audouin, L.; Badurek, G.; Barbagallo, M.; Baumann, P.; Becvar, F.; Belloni, F.; Berthoumieux, E.; Calviani, M.; Calvino, F.; Cano-Ott, D.; Capote, R.; Carrapico, C.; Carrillo de Albornoz, A.; Cennini, P.; Chepel, V.; Chiaveri, E.; Cortes, G.; Couture, A.; Cox, J.; Dahlfors, M.; David, S.; Dillmann, I.; Dolfini, R.; Dridi, W.; Duran, I.; Eleftheriadis, C.; Embid-Segura, M.; Ferrant, L.; Ferrari, A.; Ferreira-Marques, R.; Fitzpatrick, L.; Frais-Koelbl, H.; Fujii, K.; Furman, W.; Goncalves, I.; Gonzalez-Romero, E.; Goverdovski, A.; Gramegna, F.; Griesmayer, E.; Guerrero, C.; Haas, B.; Haight, R.; Heil, M.; Herrera-Martinez, A.; Igashira, M.; Isaev, S.; Jericha, E.; Kadi, Y.; Karadimos, D.; Karamanis, D.; Kerveno, M.; Ketlerov, V.; Koehler, P.; Konovalov, V.; Kossionides, E.; Krticka, M.; Lampoudis, C.; Leeb, H.; Lindote, A.; Lopes, I.; Losito, R.; Lozano, M.; Lukic, S.; Marganiec, J.; Marques, L.; Marrone, S.; Martinez, T.; Mastinu, P.; Mendoza, E.; Milazzo, P.M.; Moreau, C.; Mosconi, M.; Neves, F.; Oberhummer, H.; O'Brien, S.; Oshima, M.; Pancin, J.; Papachristodoulou, C.; Papadopoulos, C.; Paradela, C.; Patronis, N.; Pavlik, A.; Pavlopoulos, P.; Perrot, L.; Pigni, M.T.; Plag, R.; Plompen, A.; Plukis, A.; Poch, A.; Praena, J.; Pretel, C.; Quesada, J.; Rauscher, T.; Reifarth, R.; Rosetti, M.; Rubbia, C.; Rudolf, G.; Rullhusen, P.; Salgado, J.; Santos, C.; Sarchiapone, L.; Sarmento, R.; Savvidis, I.; Stephan, C.; Tagliente, G.; Tain, J.L.; Tarrio, D.; Tassan-Got, L.; Tavora, L.; Terlizzi, R.; Vannini, G.; Vaz, P.; Ventura, A.; Villamarin, D.; Vlachoudis, V.; Vlastou, R.; Voss, F.; Walter, S.; Wendler, H.; Wiescher, M.; Wisshak, K.

    2011-01-01

    The cross section of the reaction (197)Au(n,gamma) was measured with the time-of-flight technique at the n_TOF (neutron time-of-flight) facility in the unresolved resonance region between 5 and 400 keV using a pair of C(6)D(6) (where D denotes (2)H) liquid scintillators for the detection of prompt capture gamma rays. The results with a total uncertainty of 3.9%-6.7% for a resolution of 20 bins per energy decade show fair agreement with the Evaluated Nuclear Data File Version B-VII.0 (ENDF B-VII.0), which contains the standard evaluation. The Maxwellian-averaged cross section (MACS) at 30 keV is in excellent agreement with the one according to the ENDF/B-VII.0 evaluation and 4.7% higher than the MACS measured independently by activation technique. Structures in the cross section, which had also been reported earlier, have been interpreted as being due to clusters of resonances.

  11. Radio disappearance of the magnetar XTE J1810-197 and continued X-ray timing

    CERN Document Server

    Camilo, F; Halpern, J P; Alford, J A J; Cognard, I; Reynolds, J E; Johnston, S; Sarkissian, J; van Straten, W

    2016-01-01

    We report on timing, flux density, and polarimetric observations of the transient magnetar and 5.54 s radio pulsar XTE J1810-197 using the GBT, Nancay, and Parkes radio telescopes beginning in early 2006, until its sudden disappearance as a radio source in late 2008. Repeated observations through 2016 have not detected radio pulsations again. The torque on the neutron star, as inferred from its rotation frequency derivative f-dot, decreased in an unsteady manner by a factor of 3 in the first year of radio monitoring. In contrast, during its final year as a detectable radio source, the torque decreased steadily by only 9%. The period-averaged flux density, after decreasing by a factor of 20 during the first 10 months of radio monitoring, remained steady in the next 22 months, at an average of 0.7+/-0.3 mJy at 1.4 GHz, while still showing day-to-day fluctuations by factors of a few. There is evidence that during this last phase of radio activity the magnetar had a steep radio spectrum, in contrast to earlier be...

  12. A 197Au and 57Fe Moessbauer study of the roasting of refractory gold ores

    International Nuclear Information System (INIS)

    The transformation of chemically bound gold into metallic gold during industrial scale roasting of an arsenical gold ore concentrate from the Fairview Mine, Eastern Transvaal, has been studied quantitatively by 197Au Moessbauer spectroscopy. The iron compounds in the concentrate, mainly FeAsS and FeS2, and their transformations during roasting have been studied by 57Fe Moessbauer spectroscopy. The bound gold is found to convert into the metal in parallel to the decomposition of FeAsS and the increase in cyanide leachability. This shows that the refractory character of the ore is caused by the chemical bonding of the gold rather than by the physical inclusion of small, discrete metallic particles in the matrix of FeAsS or FeS2. The ratio of the f-factors of gold bound in the FeAsS component of a refractory ore and of metallic gold was determined to be f(Au:FeAsS)/f(Au)=1.48 ± 0.09. (orig.)

  13. 197 Candidates and 104 Validated Planets in K2's First Five Fields

    CERN Document Server

    Crossfield, Ian J M; Petigura, Erik A; Sinukoff, Evan; Schlieder, Joshua E; Howard, Andrew W; Beichman, Charles A; Isaacson, Howard; Dressing, Courtney D; Christiansen, Jessie L; Fulton, Benjamin J; Lépine, Sébastien; Weiss, Lauren; Hirsch, Lea; Livingston, John; Baranec, Christoph; Law, Nicholas M; Riddle, Reed; Ziegler, Carl; Howell, Steve B; Horch, Elliott; Everett, Mark; Teske, Johanna; Martinez, Arturo O; Obermeier, Christian; Benneke, Björn; Scott, Nic; Deacon, Niall; Aller, Kimberly M; Hansen, Brad M S; Mancini, Luigi; Ciceri, Simona; Brahm, Rafael; Jordán, Andrés; Knutson, Heather A; Henning, Thomas; Bonnefoy, Michaël; Liu, Michael C; Crepp, Justin R; Lothringer, Joshua; Hinz, Phil; Bailey, Vanessa; Skemer, Andrew; Defrere, Denis

    2016-01-01

    We present 197 planet candidates discovered using data from the first year of the NASA K2 mission (Campaigns 0-4), along with the results of an intensive program of photometric analyses, stellar spectroscopy, high-resolution imaging, and statistical validation. We distill these candidates into sets of 104 validated planets (57 in multi-planet systems), 30 false positives, and 63 remaining candidates. Our validated systems span a range of properties, with median values of R_P = 2.3 R_E, P=8.6 d, Tef = 5300 K, and Kp=12.7 mag. Stellar spectroscopy provides precise stellar and planetary parameters for most of these systems. We show that K2 has increased by 30% the number of small planets known to orbit moderately bright stars (1-4 R_E, Kp=9-13 mag). Of particular interest are 37 planets smaller than 2 R_E, 15 orbiting stars brighter than Kp=11.5, five receiving Earth-like irradiation levels, and several multi-planet systems -- including four planets orbiting the M dwarf K2-72 near mean-motion resonances. By quan...

  14. Safety experience with heptavalent pneumococcal CRM197-conjugate vaccine (Prevenar) since vaccine introduction.

    Science.gov (United States)

    Center, Kimberly J; Strauss, Ann

    2009-05-26

    Documentation of the safety of any vaccine is of paramount importance given the nature and scale of vaccination as a public health intervention. Prevenar was first approved for use in 2000, and includes seven pneumococcal serotypes conjugated to CRM(197), a carrier protein that has been used safely in multiple conjugate vaccines for more than 20 years. The safety profile of Prevenar was established prior to licensure in 5 clinical trials involving more than 18,000 infants and children. The largest postmarketing study of the safety of Prevenar given concomitantly with other recommended vaccines was conducted in the United States, and included more than 162,000 subjects. This analysis did not suggest any new safety consideration that would alter the risk-benefit balance of the vaccine, and demonstrated the favorable safety profile of Prevenar. To date, global surveillance of spontaneously reported adverse events to the manufacturer after more than 198 million doses distributed has confirmed these findings. The WHO has recommended the priority inclusion of this vaccine in national childhood immunization programs based on both its documented efficacy and safety. We will discuss the importance of monitoring vaccine safety and the methodologies by which this may be done, using Prevenar as an illustrative example. PMID:19200818

  15. Moessbauer effect of 197Au, 99Ru, 193Ir, 195Pt, and 151Eu diluted in hydrogenated palladium

    International Nuclear Information System (INIS)

    The study of hidrogenation in transition metals by Moessbauer spectroscopy of 197Au, 99Ru, 195Pt, 193Ir and 151Eu diluted in palladium is presented. The measured parameters in the Moessbauer effect are sensitive to hydrogenation and allow to obtain information about phases of hydrogened systems, modifications of electronic structure and effects related to hydrogen mobility. The (Pd1-x Agx)0.99 Au0.01 was also investigated by 197Au Moessbauer effect. The relantioship between α and β phase Debye - Waller factors by Moessbauer effect was estimated. Source and absorber Moessbauer experiments to verifying isomer shift variation in function of hydrogen concentration were done. A proposal for description of the isomer shift of transition (or rare) impurities in transition matrices from state density of each system is presented. The contribution of H+ ions bound to IS is discussed qualitatively. (M.C.K.)

  16. Measurement of the 197Au(n,γ) cross section at n-TOF: towards a new standard

    International Nuclear Information System (INIS)

    Two different detectors and techniques are employed at n-TOF facility, at CERN, to improve the accuracy of the neutron capture cross section of 197Au(n,γ): a total absorption calorimeter and a set of C6D6. The accurate knowledge of this cross section is of great importance for all the (n,γ) reactions study. The neutron capture cross section and nuclear resonance parameters of the 197Au have been measured in the energy range of 1 eV to 1 KeV. The present work shows in average a good agreement with evaluated data libraries, although sizeable differences have been observed for some resonances. Two new resonances have also been discovered. The accuracy of the resonance partial widths has been improved and the main nuclear quantities such as the neutron strength function have been extracted. (authors)

  17. Measurement of the {sup 197}Au(n,{gamma}) cross section at n-TOF: towards a new standard

    Energy Technology Data Exchange (ETDEWEB)

    Massimi, C.; Abbondanno, U.; Aerts, G.; Alvarez, H.; A lvarez-Velarde, F.; Andriamonje, S.; Andrzejewski, J.; Assimakopoulos, P.; Audouin, L.; Badurek, G.; Baumann, P.; Becvar, F.; Berthoumieux, E.; Calvino, F.; Calviani, M.; Cano-Ott, D.; Capote, R.; Carrapic, C.; Cennini, P.; Chepel, V.; Chiaveri, E.; Colonna, N.; Cortes, G.; Couture, A.; Cox, J.; Dahlfors, M.; David, S.; Dillmann, I.; Domingo-Pardo, C.; Dridi, W.; Duran, I.; Eleftheriadis, C.; Embid-Segura, M.; Ferrant, L.; Ferrari, A.; Ferreira-Marques, R.; Fujii, K.; Furman, W.; Goncalves, I.; Gonzalez-Romero, E.; Gramegna, F.; Guerrero, C.; Gunsing, F.; Haas, B.; Haight, R.; Heil, M.; Herrera-Martinez, A.; Igashira, M.; Jericha, E.; Kappeler, F.; Kadi, Y.; Karadimos, D.; Karamanis, D.; Kerveno, M.; Koehler, P.; Kossionides, E.; Krticka, M.; Lampoudis, C.; Leeb, H.; Lindote, A.; Lopes, I.; Lozano, M.; Lukic, S.; Marganie, J.; Marrone, S.; Martinez, T.; Mastinu, P.; Mengoni, A.; Milazzo, P.M.; Moreau, C.; Mosconi, M.; Neves, F.; Oberhummer, H.; O' Brien, S.; Pancin, J.; Papachristodoulou, C.; Papadopoulos, C.; Paradela, C.; Patronis, N.; Pavlik, A.; Pavlopoulos, P.; Perrot, L.; Pigni, M.T.; Plag, R.; Plompen, A.; Plukis, A.; Poch, A.; Praena, J.; Pretel, C.; Quesada, J.; Rauscher, T.; Reifarth, R.; Rubbia, C.; Rudolf, G.; Rullhusen, P.; Salgado, J.; Santos, C.; Sarchiapone, L.; Savvidis, I.; Stephan, C.; Tagliente, G.; Tain, J.L.; Tassan-Got, L.; Tavora, L.; Terlizzi, R.; Vannini, G.; Vaz, P.; Ventura, A.; Villamarin, D.; Vincente, M.C.; Vlachoudis, V.; Vlastou, R.; Voss, F.; Walter, S.; Wiescher, M.; Wisshak, K

    2008-07-01

    Two different detectors and techniques are employed at n-TOF facility, at CERN, to improve the accuracy of the neutron capture cross section of {sup 197}Au(n,{gamma}): a total absorption calorimeter and a set of C{sub 6}D{sub 6}. The accurate knowledge of this cross section is of great importance for all the (n,{gamma}) reactions study. The neutron capture cross section and nuclear resonance parameters of the {sup 197}Au have been measured in the energy range of 1 eV to 1 KeV. The present work shows in average a good agreement with evaluated data libraries, although sizeable differences have been observed for some resonances. Two new resonances have also been discovered. The accuracy of the resonance partial widths has been improved and the main nuclear quantities such as the neutron strength function have been extracted. (authors)

  18. Fission anisotropy of 197Tl produced in fusion reactions in the framework of the modified statistical model

    Indian Academy of Sciences (India)

    Hadi Eslamizadeh

    2015-12-01

    The anisotropy of fission fragment angular distribution, evaporation residue crosssection and the fission cross-section were calculated for 197Tl formed in 16O+181Ta reactions in the framework of the modified statistical model and the results were compared with the experimental data. The effects of temperature and projection of spin about the symmetry axis have been considered for calculating potential energy surfaces and fission widths. It was shown that in the framework of the modified statistical model, by choosing appropriate values for the temperature coefficient of the effective potential, , and scaling factor of the fission-barrier height, s, one can satisfactorily reproduce the above-mentioned experimental data. It was also shown that the appropriate values of these parameters for 197Tl are = 0.0185 ± 0.0050 MeV-2 and s = 1.0006 ± 0.0020.

  19. Fission anisotropy of 197Tl produced in fusion reactions in the framework of the modified statistical model

    International Nuclear Information System (INIS)

    The anisotropy of fission fragment angular distribution, evaporation residue cross-section and the fission cross-section were calculated for 197Tl formed in 16O+181Ta reactions in the framework of the modified statistical model and the results were compared with the experimental data. The effects of temperature and projection of spin about the symmetry axis K have been considered for calculating potential energy surfaces and fission widths. It was shown that in the framework of the modified statistical model, by choosing appropriate values for the temperature coefficient of the effective potential, α , and scaling factor of the fission-barrier height, rs, one can satisfactorily reproduce the above-mentioned experimental data. It was also shown that the appropriate values of these parameters for 197Tl are α = 0.0185 ± 0.0050 MeV-2 and rs = 1.0006 ± 0.0020. (author)

  20. Determination of the total photo-absorption cross section of 197Au from (γ,chin) reaction cross sections

    International Nuclear Information System (INIS)

    Cross sections for the reaction 197Au(γ, chin)(chi<=12) have been measured for bremsstrahlung end-point energies in the range 60-340 MeV. From these dominant cross sections, the total photon absorption cross section is determined using a cascade-evaporation calculation to account for the missing reaction channels. The enhancement factor for the classical E1 sum rule is found to be 0.93+-0.10. (orig.)

  1. Helium projectile fragment emission in interactions of 197Au with emulsion at 10.7A GeV

    International Nuclear Information System (INIS)

    The total and partial production cross-sections of the multiple helium fragments emitted in 10.7A GeV 197Au–emulsion interactions are reported and compared with those obtained from different projectiles at high energies. The multiplicity distributions of the helium fragments exhibit a KNO scaling. The dependence of Cq moments and on the mass number of the incident beams is plotted. (author)

  2. Cytotoxic activity of Tivantinib (ARQ 197) is not due solely to MET inhibition

    Science.gov (United States)

    Katayama, Ryohei; Aoyama, Aki; Yamori, Takao; Qi, Jie; Oh-hara, Tomoko; Song, Youngchul; Engelman, Jeffrey A.; Fujita, Naoya

    2013-01-01

    The receptor tyrosine kinase c-MET is the high-affinity receptor for the hepatocyte growth factor (HGF). The HGF/c-MET axis is often dysregulated in tumors. c-MET activation can be caused by MET gene amplification, activating mutations, and auto- or paracrine mechanisms. Thus, c-MET inhibitors are under development as anti-cancer drugs. Tivantinib (ARQ 197) was reported as a small molecule c-MET inhibitor and early clinical studies suggest anti-tumor activity. To assess if the anti-tumor activity of tivantinib was due to inhibition of c-MET, we compared the activity of tivantinib to other c-MET inhibitors in both c-MET addicted and non-addicted cancer cells. As expected, other c-MET inhibitors, crizotinib and PHA-665752, suppressed the growth of c-MET addicted cancers, but not the growth of cancers that are not addicted to c-MET. In contrast, tivantinib inhibited cell viability with similar potency in both c-MET addicted and non-addicted cells. These results suggest that tivantinib exhibits its antitumor activity in a manner independent of c-MET status. Tivantinib treatment induced a G2/M cell cycle arrest in EBC1 cells similarly to vincristine treatment, whereas PHA-665752 or crizotinib treatment markedly induced G0/G1 cell cycle arrest. To identify the additional molecular target of tivantinib, we performed COMPARE analysis, an in silico screening of a database of drug sensitivities across 39 cancer cell lines (JFCR39), and identified microtubule as a target of tivantinib. Tivantinib treated cells demonstrated typical microtubule disruption similar to vincristine and inhibited microtubule assembly in vitro. These results suggest that tivantinib inhibits microtubule polymerization in addition to inhibiting c-MET. PMID:23598276

  3. Measurement of isotopic cross sections of spallation residues in 800 A MeV {sup 197}Au + p collisions

    Energy Technology Data Exchange (ETDEWEB)

    Rejmund, F.; Mustapha, B.; Bernas, M.; Stephan, C.; Taieb, J.; Tassan-Got, L. [Institut de Physique Nucleaire, (IN2P3/CNRS) 91 - Orsay (France); Armbruster, P.; Benlliure, J.; Enqvist, T.; Schmidt, K.H.; Taieb, J. [GSI, Planckstrasse, Darmstadt (Germany); Benlliure, J. [Universidad de Santiago de Compostela (Spain); Boudard, A.; Legrain, R.; Leray, S.; Volant, C. [CEA/Saclay, Dept. d' Astrophysique, de la Physique des Particules, de la Physique Nucleaire et de l' Instrumentation Associee (DAPNIA), 91 - Gif-sur-Yvette (France); Dufour, J.P. [CENBG, IN2P3, 33 - Gradignan (France)

    2000-07-01

    The spallation of {sup 197}Au by 800 MeV protons was investigated in inverse kinematics at GSI, Darmstadt, by use of a {sup 197}Au beam bombarding a liquid-hydrogen target. The fragment separator (FRS) was used to select and identify the reaction products prior to {beta} decay. The individual production cross sections and the kinematical properties of 396 isotopes for all elements between mercury (Z=80) and neodymium (Z=60) have been measured. A comparison with Monte Carlo calculations based on different two-step models of the spallation reaction is given. The shape of the isotopic distributions close to the projectile is found to differ strongly from that resulting from aluminium-induced fragmentation of {sup 197}Au. The mean kinetic energies of the fragments are deduced from the experimental data. The importance of the new data to improve our understanding of the spallation mechanism and the relevance for the design of accelerator-driven sub-critical reactors is discussed. (authors)

  4. 197Au Moessbauer spectroscopy; hyperfine interactions and dynamical behaviour of gold in molecular crystals and small particles

    International Nuclear Information System (INIS)

    The investigations described in this thesis are concerned with the Moessbauer effect in 197Au. The energy of the nuclear transitions is rather high (77 keV) and consequently the Moessbauer fraction is appreciable only at very low temperatures. Furthermore, the parent nucleus (197Pt) has a half life of 18 hrs and sources can be used for a few days only. Nevertheless this investigation has been undertaken because, once available, the technique can be readily applied to all gold-containing substances in order to study the hyperfine interactions which contain a lot of information on the chemical environment of the Moessbauer nucleus. These hyperfine effects on gold cannot be measured by other techniques like Electron Spin Resonance (ESR) or Nuclear Magnetic Resonance (NMR), except in a few special cases. Further, the source of 197Au in Pt exhibits the natural linewidth, not broadened by small hyperfine effects, in contrast with iron and tin sources. This makes it less complicated to determine absolute Moessbauer fractions

  5. The anti-tumor effect of cross-reacting material 197, an inhibitor of heparin-binding EGF-like growth factor, in human resistant ovarian cancer

    Energy Technology Data Exchange (ETDEWEB)

    Tang, Xiao-han; Deng, Suo; Li, Meng [Department of Gynecology and Obstetrics, The First Affiliated Hospital of Harbin Medical University, Harbin (China); Lu, Mei-song, E-mail: lumeisong0417@163.com [Department of Gynecology and Obstetrics, The First Affiliated Hospital of Harbin Medical University, Harbin (China)

    2012-06-15

    Highlights: Black-Right-Pointing-Pointer HB-EGF over-expression in A2780/Taxol, A2780/CDDP cells and the matched xenografts. Black-Right-Pointing-Pointer CRM197 induces enhanced apoptosis in A2780/Taxol and A2780/CDDP cells. Black-Right-Pointing-Pointer CRM197 arrests A2780/Taxol and A2780/CDDP cells at G0/G1 phase. Black-Right-Pointing-Pointer CRM197 suppressed the A2780/Taxol and A2780/CDDP growth of xenografts. -- Abstract: Heparin-binding epidermal growth factor-like growth factor (HB-EGF) is a promising target for ovarian cancer therapy. Cross-reacting material 197 (CRM197), a specific HB-EGF inhibitor, has been proven to represent possible chemotherapeutic agent for ovarian cancer. However, the effect of CRM197 on the resistant ovarian carcinoma cells has not been sufficiently elucidated. Here, we found that HB-EGF was over-expressed in a paclitaxel-resistant human ovarian carcinoma cell line (A2780/Taxol) and a cisplatin-resistant cell line (A2780/CDDP), as well as the xenograft mouse tissue samples with these cells. To investigate the possible significance of the HB-EGF over-expression in A2780/Taxol and A2780/CDDP cells, we inhibited HB-EGF expression by CRM197 to investigate the effect of CRM197 treatment on these cells. We observed that CRM197 significantly induced anti-proliferative activity in a dose-dependent manner with the cell-cycle arrest at the G0/G1 phase and enhanced apoptosis in A2780/Taxol and A2780/CDDP cells. The sensitive ovarian carcinoma parental cell line (A2780), A2780/Taxol and A2780/CDDP cells formed tumors in nude mice, and enhanced tumorigenicity was observed in drug-resistant tumors. Furthermore, we observed that CRM197 significantly suppressed the growth of drug-resistant ovarian cancer xenografts in vivo (p < 0.001). These results suggest that CRM197 as an HB-EGF-targeted agent has potent anti-tumor activity in paclitaxel- and cisplatin-resistant ovarian cancer which over-express HB-EGF.

  6. The anti-tumor effect of cross-reacting material 197, an inhibitor of heparin-binding EGF-like growth factor, in human resistant ovarian cancer

    International Nuclear Information System (INIS)

    Highlights: ► HB-EGF over-expression in A2780/Taxol, A2780/CDDP cells and the matched xenografts. ► CRM197 induces enhanced apoptosis in A2780/Taxol and A2780/CDDP cells. ► CRM197 arrests A2780/Taxol and A2780/CDDP cells at G0/G1 phase. ► CRM197 suppressed the A2780/Taxol and A2780/CDDP growth of xenografts. -- Abstract: Heparin-binding epidermal growth factor-like growth factor (HB-EGF) is a promising target for ovarian cancer therapy. Cross-reacting material 197 (CRM197), a specific HB-EGF inhibitor, has been proven to represent possible chemotherapeutic agent for ovarian cancer. However, the effect of CRM197 on the resistant ovarian carcinoma cells has not been sufficiently elucidated. Here, we found that HB-EGF was over-expressed in a paclitaxel-resistant human ovarian carcinoma cell line (A2780/Taxol) and a cisplatin-resistant cell line (A2780/CDDP), as well as the xenograft mouse tissue samples with these cells. To investigate the possible significance of the HB-EGF over-expression in A2780/Taxol and A2780/CDDP cells, we inhibited HB-EGF expression by CRM197 to investigate the effect of CRM197 treatment on these cells. We observed that CRM197 significantly induced anti-proliferative activity in a dose-dependent manner with the cell-cycle arrest at the G0/G1 phase and enhanced apoptosis in A2780/Taxol and A2780/CDDP cells. The sensitive ovarian carcinoma parental cell line (A2780), A2780/Taxol and A2780/CDDP cells formed tumors in nude mice, and enhanced tumorigenicity was observed in drug-resistant tumors. Furthermore, we observed that CRM197 significantly suppressed the growth of drug-resistant ovarian cancer xenografts in vivo (p < 0.001). These results suggest that CRM197 as an HB-EGF-targeted agent has potent anti-tumor activity in paclitaxel- and cisplatin-resistant ovarian cancer which over-express HB-EGF.

  7. Comprehesive analysis on the histological classifications in 42 197 cases of ovarian tumors in China

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Objective:The histological types of ovarian tumors were investigated and analyzed in China in order to compare with those in other countries,which will benefit to the prevention and treatment of ovarian cancer.Methods:The pathological data from 42 197 cases of ovarian tumors in ten years during 1980 to 1989 were registered according to the WHO classification for ovarian tumors. Some indefinite cases pathologically in the first diagnosis should bereconfirmed according to the WHO classification.Results: Forty-two thousand one hundred and ninety seven cases ofovarian tumors were selected from all tumors in 21 provinces and 3 major regional cities in China.There were 10 288(24.4%) malignant tumors in all cases.They were composed by 5 650(54.9%) cases of epithelial tumors,1 871(18.2%) cases of germ cell tumors,837(8.5%) cases of sex cord tumors,1 003(9.7%) cases of secondarytumors,and 891(8.7%) cases of other tumors.The malignant tumors constituent ratios were 58.5% and 50.9% respectively in the north and south of the Yangtze River..The histological types of ovarian tumors were about the same ratios,but the malignant tumors were different in Chinese six major administrative region andalso in the region both north and south of the Yangtzy River.The ratio of borderline epithelial ovarian tumors to epithelial tumors was 1:5.9.Borderlineserous cystadenocarcnoma appeared to be similar to borderline mucinous cystadenocarcinoma in frequency.Serous cystadenocarcinoma was found to be the most frequent one in malignant epithelial tumors.Conclusion:Compared with reports abroad,the different types of malignant ovarian tumors inChina represent a different distributive pattern.The malignant epithelial ovarian tumors were lower than that in other countries (55% vs 80%-90%),while the malignant germ cell tumors and sex cord stromal tumors were 6 and 3 times higher thanthose abroad,the main metastasizing tumors come from gastroenteric carcinoma,while the metastasizing tumors from breast

  8. Fission fragment angular distributions in proton-induced fission of 209 Bi(p,t) and 197 Au(p,f)

    OpenAIRE

    De, S S; N H; M. L.

    2001-01-01

      The fission fragment angular distributions have been measured for proton-induced fission of 209Bi and 197Au nuclei using surface barrier detectors at several energies between 25 MeV and 30 MeV. The experimental anisotropies are found to be in agreement with the predictions of the Standard Saddle-Point Statistical Model (SSPSM). The fission cross sections of 209Bi 197Au nuclei were also measured and compared with the previous works.

  9. Fission fragment angular distributions in proton-induced fission of 209 Bi(p,t and 197 Au(p,f

    Directory of Open Access Journals (Sweden)

    S. S.

    2001-12-01

    Full Text Available   The fission fragment angular distributions have been measured for proton-induced fission of 209Bi and 197Au nuclei using surface barrier detectors at several energies between 25 MeV and 30 MeV. The experimental anisotropies are found to be in agreement with the predictions of the Standard Saddle-Point Statistical Model (SSPSM. The fission cross sections of 209Bi 197Au nuclei were also measured and compared with the previous works.

  10. A novel c.197T ® A variant among Brazilian neonates with glucose-6-phosphate dehydrogenase deficiency

    Directory of Open Access Journals (Sweden)

    José Pereira de Moura Neto

    2008-01-01

    Full Text Available Glucose-6-phosphate dehydrogenase (G6PD, EC 1.1.1.49 deficiency is the most common enzyme deficiency worldwide, causing a spectrum of diseases including neonatal hyperbilirubinemia and acute or chronic hemolysis. We used the methemoglobin reduction test and G6PD electrophoresis to screen 655 neonates (354 females and 301 males for common G6PD mutations in the city of Salvador in the Northeastern Brazilian state Bahia and found that 66 (10.1% were G6PD-deficient (41 females and 25 males. The 66 (10.1% G6PD-deficient neonates were assessed for the c.376 A -> G (exon 5 and c.202 G -> A (exon 4 mutations using the polymerase chain reaction and restriction enzyme fragment length polymorphism (PCR-RFLP analysis and the results validated by DNA sequencing. Of the 66 G6PD-deficient neonates investigated we found that 54 (81.8% presented the c.376 A -> G (p.Asn126Asp and c.202 G -> A (p.Val68Met mutations, two (3% had the c.376 A -> G mutation only, two (3% had the c.202 G -> A mutation only, five (7.6% exhibited a previously unrecorded 197T -> A (p.Phe66Thr substitution in exon 4 and three showed no mutations at any of these sites. Of the five neonates exhibiting the new 197T -> A (p.Phe66Thr substitution, four (6.1% also presented the c.202 G -> A and c.376 A -> G mutations and one (1.5% had the c.[197T -> A / 202 G -> A] combination. We propose to name the new variant G6PD Bahia.

  11. Neutron capture cross section measurements for {sup 197}Au from 3.5 to 84 keV at GELINA

    Energy Technology Data Exchange (ETDEWEB)

    Massimi, C. [University of Bologna, Department of Physics, Bologna (Italy); Joint Research Centre - IRMM, European Commission, Geel (Belgium); INFN, Bologna (Italy); Becker, B.; Kopecky, S.; Lampoudis, C.; Schillebeeckx, P.; Wynants, R. [Joint Research Centre - IRMM, European Commission, Geel (Belgium); Dupont, E. [OECD Nuclear Energy Agency, Issy-les-Moulineaux (France); Massarczyk, R. [Helmholtz-Zentrum Dresden-Rossendorf, Dresden (Germany); Technische Universitaet Dresden, Dresden (Germany); Pronyaev, V. [Institute of Physics and Power Engineering, Obninsk (Russian Federation); Sirakov, I. [Institute for Nuclear Research and Nuclear Energy, Sofia (Bulgaria); Moxon, M.

    2014-08-15

    Cross section measurements have been performed at the time-of-flight facility GELINA to determine the average capture cross section for {sup 197}Au in the energy region between 3.5 keV and 84 keV. Prompt γ-rays, originating from neutron-induced capture events, were detected by two C{sub 6} D{sub 6} liquid scintillators. The sample was placed at about 13m distance from the neutron source. The total energy detection principle in combination with the pulse height weighting technique was applied. The energy dependence of the neutron flux was measured with a double Frisch-gridded ionization chamber based on the {sup 10}B(n,α) reaction. The data have been normalized to the well-isolated and saturated {sup 197}Au resonance at 4.9 eV. Special care was taken to reduce bias effects due to the weighting function, normalization, dead time and background corrections. The total uncertainty due to normalization, neutron flux and weighting function is 1.0%. An additional uncertainty of 0.5% results from the correction for self-shielding and multiple interaction events. Fluctuations due to resonance structures have been studied by complementary measurements at a 30m flight path station. The results reported in this work deviate systematically by more than 5% from the cross section that is recommended as a reference for astrophysical applications. They are about 2% lower compared to an evaluation of the {sup 197}Au(n, γ) cross section, which was based on a least squares fit of experimental data available in the literature prior to this work. The average capture cross section as a function of neutron energy has been parameterized in terms of average resonance parameters. Maxwellian average cross sections at different temperatures have been calculated. (orig.)

  12. Neutron capture cross section measurements for 197Au from 3.5 to 84 keV at GELINA

    Science.gov (United States)

    Massimi, C.; Becker, B.; Dupont, E.; Kopecky, S.; Lampoudis, C.; Massarczyk, R.; Moxon, M.; Pronyaev, V.; Schillebeeckx, P.; Sirakov, I.; Wynants, R.

    2014-08-01

    Cross section measurements have been performed at the time-of-flight facility GELINA to determine the average capture cross section for 197Au in the energy region between 3.5 keV and 84 keV. Prompt γ-rays, originating from neutron-induced capture events, were detected by two C6 D6 liquid scintillators. The sample was placed at about 13m distance from the neutron source. The total energy detection principle in combination with the pulse height weighting technique was applied. The energy dependence of the neutron flux was measured with a double Frisch-gridded ionization chamber based on the 10B(n,α) reaction. The data have been normalized to the well-isolated and saturated 197Au resonance at 4.9 eV. Special care was taken to reduce bias effects due to the weighting function, normalization, dead time and background corrections. The total uncertainty due to normalization, neutron flux and weighting function is 1.0%. An additional uncertainty of 0.5% results from the correction for self-shielding and multiple interaction events. Fluctuations due to resonance structures have been studied by complementary measurements at a 30m flight path station. The results reported in this work deviate systematically by more than 5% from the cross section that is recommended as a reference for astrophysical applications. They are about 2% lower compared to an evaluation of the 197Au(n, γ) cross section, which was based on a least squares fit of experimental data available in the literature prior to this work. The average capture cross section as a function of neutron energy has been parameterized in terms of average resonance parameters. Maxwellian average cross sections at different temperatures have been calculated.

  13. Multifragment Emission in Central Collisions of ARGON-36 + GOLD-197 at E/a = 50, 80 and 110 Mev

    Science.gov (United States)

    Phair, Larry William

    Multifragment disintegrations of highly excited nuclear systems may carry information about the equation of state and the liquid-gas phase transition of low density nuclear matter. The mechanism causing multifragment decays is, however, not yet understood. To study this phenomenon we constructed a low threshold 4pi charged-particle detector, the Miniball, and studied the reaction of ^{36}Ar + ^{197}Au at E/A=50, 80 and 110 MeV. For central collisions, the chance for equilibration of the system is highest. We therefore determined the most efficient method of selecting central collisions by comparing the ability of several global observables to select events with suppressed projectile-like fragment emission and small anisotropic azimuthal emission patterns. Similar event selection was obtained by using the following global observables: the charged particle multiplicity N _{c}, the total transverse energy E_{t}, and summed charge emitted at midrapidity Z_{y}. An average multiplicity of 4 intermediate mass fragments (IMF) was observed for the most central collisions at E/A = 110 MeV. These IMF multiplicities are consistent with predictions from a statistical model for evaporation from an expanding compound nucleus. The statistical decay model predictions are sensitive to the low-density nuclear equation of state. The IMF yields are also consistent with predictions from a standard percolation model for the ^ {36}Ar + ^{197} Au system. Assuming a spherical decay geometry, percolation fails, however, to predict the measured fragment multiplicities for the heavier system ^ {129}Xe + ^{197} Au at E/A = 50 MeV investigated by our group. For noncompact decay configurations (bubbles and toroids) the percolation model can reproduce the large fragment multiplicities observed for this reaction.

  14. Neutron capture cross section measurements for 197Au from 3.5 to 84 keV at GELINA

    OpenAIRE

    Massimi, C.; BECKER BJÖRN; Dupont, E.; Kopecky, Stefan; LAMPOUDIS CHRISTOS; Massarczyk, R.; Moxon, M.; PRONYAEV V. G; Schillebeeckx, Peter; Sirakov, I.; WYNANTS Ruud

    2014-01-01

    Cross section measurements have been performed at the time-of-flight facility GELINA to determine the average capture cross section for 197Au in the energy region between 3.5 keV and 84 keV. Prompt gamma-rays, originating from neutron induced capture events, were detected by two C6D6 liquid scintillators. The sample was placed at about 13 m distance from the neutron source. The total energy detection principle in combination with the pulse height weighting technique was applied. The energy de...

  15. Fragment-fragment correlations in the 4.8 GeV {sup 3}He + {sup 197}Au system

    Energy Technology Data Exchange (ETDEWEB)

    Kwiatkowski, K.; Wang, G.; Morley, K.B.; Bracken, D.S. [and others

    1995-10-01

    Both small- and large-angle IMF-IMF correlations have been investigated for the multifragmentation events from the 4.8 GeV {sup 3}He + {sup 197}Au reaction. Relative velocities are found to depend on fragment charge, but to be only weakly sensitive to IMF multiplicity. The large-angle data are compared with predictions of simulations based on sequential statistical evaporation, an expanding evaporating source and statistical multifragmentation models. The Coulomb hole in the small angle correlations is examined to estimate the multifragmentation time scale.

  16. Multifragmentation in the 4.8-GeV 3He+ natAg, 197Au reactions

    International Nuclear Information System (INIS)

    Multifragmentation of natAg and 197Au nuclei induced by a 4.8-GeV 3He ions has been studied with the Indiana Silicon Sphere 4π detector array. Rapidity and moving source analyses are consistent with thermal emission from a source in approximate kinetic equilibrium. For the most dissipative collisions, the spectral Coulomb peaks are broadened to very low energies, indicative of emission from an extended nuclear system. Predictions of a model with an intranuclear cascade and an expanding, emitting source compare well with experimental multiplicity distributions and the evolution of fragment spectral shapes

  17. Multifragmentation in the 4.8-GeV {sup 3}He+ {sup nat}Ag, {sup 197}Au reactions

    Energy Technology Data Exchange (ETDEWEB)

    Kwiatkowski, K.; Morley, K.B.; Foxford, E.R.; Bracken, D.S.; Viola, V.E.; Yoder, N.R.; Legrain, R.; Pollacco, E.C.; Volant, C.; Friedman, W.A.; Korteling, R.G.; Brzychczyk, J.; Breuer, H. [Department of Chemistry and Physics and IUCF, Indiana University, Bloomington, Indiana 47405 (United States)]|[Commissariat a l`Energie Atomique DAPNIA/Service de Physique des Particles, Centre d`Etudes de Saclay, 91191 Gif-sur-Yvette Cedex (France)]|[Department of Chemistry, Simon Fraser University, Burnaby, British Columbia, Canada V5A 1SG (Canada)]|[Department of Physics, University of Wisconsin, Madison, Wisconsin 53706 (United States)]|[Institute of Physics, Jagiellonian University, 30-059 Krakow (Poland)]|[Department of Physics, University of Maryland, College Park, Maryland 20742 (United States)

    1995-05-08

    Multifragmentation of {sup nat}Ag and {sup 197}Au nuclei induced by a 4.8-GeV {sup 3}He ions has been studied with the Indiana Silicon Sphere 4{pi} detector array. Rapidity and moving source analyses are consistent with thermal emission from a source in approximate kinetic equilibrium. For the most dissipative collisions, the spectral Coulomb peaks are broadened to very low energies, indicative of emission from an extended nuclear system. Predictions of a model with an intranuclear cascade and an expanding, emitting source compare well with experimental multiplicity distributions and the evolution of fragment spectral shapes.

  18. Fragment-fragment correlations in the 4.8 GeV 3He + 197Au system

    International Nuclear Information System (INIS)

    Both small- and large-angle IMF-IMF correlations have been investigated for the multifragmentation events from the 4.8 GeV 3He + 197Au reaction. Relative velocities are found to depend on fragment charge, but to be only weakly sensitive to IMF multiplicity. The large-angle data are compared with predictions of simulations based on sequential statistical evaporation, an expanding evaporating source and statistical multifragmentation models. The Coulomb hole in the small angle correlations is examined to estimate the multifragmentation time scale

  19. Radiation damage in single crystal CVD diamond material investigated with a high current relativistic 197Au beam

    International Nuclear Information System (INIS)

    Single-crystal Chemical Vapor Deposition (ScCVD) diamond based prototype detectors have been constructed for the high intensity heavy ion experiments HADES and CBM at the future FAIR facility at GSI Darmstadt. Their properties have been studied with a high current density beam (about 2–3×106/s/mm2) of 1.25A GeV 197Au69+ ions. Details of the design, the intrinsic properties of the detectors and their performance after irradiation with such a beam are reported

  20. 197Au Moessbauer study of the deactivation and reactivation of a carbon-supported AuCl4- hydrochlorination catalyst

    International Nuclear Information System (INIS)

    Acetylene hydrochlorination catalysts consisting of activated carbon impregnated with a solution of HAuCl4.xH2O in aqua regia have been studied by 197Au Moessbauer spectroscopy. The relative amounts of AuCl4-, of Au(0), and of an Au(I) species formed under certain process conditions were determined quantitatively. Deactivation of the catalyst at low and high temperatures was shown to be due to different mechanisms, and the reactivation of the catalyst by Cl2 gas was studied. (orig.)

  1. Results of time-of-flight transmission measurements for 197Au at a 50 m station of GELINA

    OpenAIRE

    Kopecky, Stefan; BECKER BJÖRN; DROHE Jean Claude; OTUKA N.; Schillebeeckx, Peter; VENDELBO Danny; WYNANTS Ruud

    2013-01-01

    Transmission measurements have been performed at the time-of-flight facility GELINA to determine the total cross section for neutron induced reactions in 197Au. The measurements have been carried out at a 50 m transmission station of GELINA with the accelerator operating at 800 Hz. This report provides the experimental details required to deliver the data to the EXFOR data library which is maintained by the Nuclear Data Section of the IAEA and the Nuclear Energy Agency of the OECD. The experi...

  2. Catalytic residues Lys197 and Arg199 of Bacillus subtilis phosphoribosyl diphosphate synthase. Alanine-scanning mutagenesis of the flexible catalytic loop

    DEFF Research Database (Denmark)

    Hove-Jensen, Bjarne; Bentsen, Ann-Kristin K; Harlow, Kenneth W

    2005-01-01

    Eleven of the codons specifying the amino acids of the flexible catalytic loop [KRRPRPNVAEVM(197-208)] of Bacillus subtilis phosphoribosyl diphosphate synthase have been changed individually to specify alanine. The resulting variant enzyme forms, as well as the wildtype enzyme, were produced in an...... Escherichia coli strain lacking endogenous phosphoribosyl diphosphate synthase activity and purified to near homogeneity. The B. subtilis phosphoribosyl diphosphate synthase mutant variants K197A and R199A were studied in detail. The physical properties of the two enzymes were similar to those of the wildtype...

  3. Enhanced inhibition of murine prostatic carcinoma growth by immunization with or administration of viable human umbilical vein endothelial cells and CRM197

    Directory of Open Access Journals (Sweden)

    Zhang Huiyong

    2011-02-01

    Full Text Available Vaccination with xenogeneic and syngeneic endothelial cells is effective for inhibiting tumor growth. Nontoxic diphtheria toxin (CRM197, as an immunogen or as a specific inhibitor of heparin-binding EGF-like growth factor, has shown promising antitumor activity. Therefore, immunization with or administration of viable human umbilical vein endothelial cells (HUVECs combined with CRM197 could have an enhanced antitumor effect. Six-week-old C57BL/6J male mice were vaccinated with viable HUVECs, 1 x 10(6 viable HUVECs combined with 100 μg CRM197, or 100 μg CRM197 alone by ip injections once a week for 4 consecutive weeks. RM-1 cells (5 x 10(5 were inoculated by sc injection as a preventive procedure. During the therapeutic procedure, 6-week-old male C57BL/6J mice were challenged with 1 x 10(5 RM-1 cells, then injected sc with 1 x 10(6 viable HUVECs, 1 x 10(6 viable HUVECs + 100 μg CRM197, and 100 μg CRM197 alone twice a week for 4 consecutive weeks. Tumor volume and life span were monitored. We also investigated the effects of immunization with HUVECs on the aortic arch wall and on wound healing. Vaccination with or administration of viable HUVECs+CRM197 enhanced the inhibition of RM-1 prostatic carcinoma by 24 and 29%, respectively, and prolonged the life span for 3 and 4 days, respectively, compared with those of only vaccination or administration with viable HUVECs of tumor-bearing C57BL/6J mice. Furthermore, HUVEC immunization caused some damage to the aortic arch wall but did not have remarkable effects on the rate of wound healing; the wounds healed in approximately 13 days. Treatment with CRM197 in combination with viable HUVECs resulted in a marked enhancement of the antitumor effect in the preventive or therapeutic treatment for prostatic carcinoma in vivo, suggesting a novel combination for anti-cancer therapy.

  4. Simulations of dynamic pion production in 60 and 200 GeV collisions of 16O + 197Au

    International Nuclear Information System (INIS)

    The authors have investigated collision of 16O with 197Au at bombarding energies of 60 and 200 GeV/N in the laboratory frame. Their hydrodynamics-based 3-D model, with a modified gamma-law equation of state, includes detailed dynamic pion production and propagation. A comparison of hydrodynamic simulations with and without the inclusion of pions shows that including the pion channel yields results which more closely reproduce the experimental data. The authors show direct comparisons of several predicted observables with experimental measurements made over various pseudorapidity ranges. In general, they find that while their overall energy agreement with calorimetry experiments is good, and their predicted spatial distributions are in fair agreement with experimental data, their model produces pions which are to energetic and too few in balancing proportions. The authors results indicate that most of the emitted (measured) pions emerge from the cooler surface, and not from the hot, dense interior of the hadronic composite

  5. Elastic scattering of 10 MeV/μ - 238U ions by 197Au and 165Ho

    International Nuclear Information System (INIS)

    In the present paper, we describe the use of mica solid state nuclear track detectors for the determination of 'quarter-point-angles' in the elastic scattering of 2380 MeV-uranium ions by 197Au and 165Ho target atoms. The exposed mica detectors were etched in 48% HF acid and scanned for two-prong events using an optical microscope at a total magnification of 500 X. The track parameters were converted to particle parameters, and results so obtained were utilized to isolate the elastic-scattering events from the inelastic two-prong events. The angular scattering measurements were used to determine the quarter-point-angle which was then utilized to compute total reaction cross-section and other reaction parameters. (author)

  6. High resolution measurements of heavy residues from 197Au projectile fragmentation at 20 MeV/u

    International Nuclear Information System (INIS)

    The yields and momentum distributions of heavy residues from the fragmentation of 197Au projectiles at 20MeV/nucleon by C, Al and Ti targets have been measured at 0 degrees. Projectile residues (and fission fragments) were analyzed using the A1200 mass separator at the NSCL and stopped in a Si-detector telescope placed at the focal plane of the separator. The nuclear charge, ionic charge, mass and momentum of the residues were deduced. The analysis of the data has shown that unit Z and A resolution is obtained for a broad range of reaction products, from near-projectile residues to fission fragments. The residue properties at this energy show a target dependence, in contrast to available data at higher energies. The momentum distributions indicate that incomplete and complete fusion (accompanied by fission or particle emission) and fragmentation are the main mechanisms contributing to the production of the residues at this energy regime

  7. Breakup of 42 MeV 7Li projectiles in the fields of 12C and 197Au nuclei

    Indian Academy of Sciences (India)

    Dhruba Gupta; C Samanta; R Kanungo; P Basu; Subinit Roy; S Kailas; A Chatterjee; B J Roy; K Mahata; A Samant; A Shrivastava

    2001-07-01

    Inclusive cross sections of particles and tritons from the breakup of 42 MeV 7Li by 12C and 197Au targets are presented and analysed in the framework of the Serber model. Spectral distortions due to the targets and relevant reaction mechanisms are discussed.

  8. Proton-induced fission at 190 MeV of W-nat, Au-197, Pb-nat, Pb-208, and Th-232

    NARCIS (Netherlands)

    Duijvestijn, MC; Koning, AJ; Beijers, JPM; Gastal, M; van Klinken, J; Ostendorf, RW

    1999-01-01

    Proton-induced fission at 190 MeV of W-nat, Au-197, Pb-nat, Pb-208, and Th-232 is studied by means of an innovative method based on activation analysis. The fission-product mass distribution is reconstructed from the fission-product yields, which are obtained from off-line observed gamma-ray spectra

  9. Mass and charge flow in the reaction 7.1 MeV/u197Au+63Cu

    Science.gov (United States)

    Jäckel, B.; Rox, A.; Esterlund, R. A.; Westmeier, W.; Knaack, M.; Patzelt, P.

    1991-12-01

    Mass-yield and angular-distribution data are presented for products from the reaction of 7.1 MeV/ μ 197Au with63Cu. With help from information derived from the latter, the former are classified into components corresponding to quasielastic transfer (580±80 mb), deep-inelastic transfer plus quasifission (1300±130 mb), fusionfission (≦195 mb), and sequential fission (195±45 mb). The fusion excitation function calculated with the Dynamic Capture model standard parameter set reproduces our deduced fusion-fission cross section well. Moreover, using this cross section as well as additional published data for the same reaction system, we extract an s-wave fusion-barrier shift (“extra push”) for this system of 35±7 MeV, which is in good agreement with the systematics derived from other fusion-barrier shifts which have been reported in the literature. Lastly, support is found for the Dissipative Diabatic Dynamics model prediction that dynamically-hindered fusion trajectories are reflected into quasielastic channels.

  10. Multiplicity correlations of intermediate-mass fragments with pions and fast protons in 12C + 197AU

    International Nuclear Information System (INIS)

    Low-energy π+ (Eπ 12C+197Au collisions at incident energies from 300 to 1800 MeV per nucleon were detected with the Si-Si(Li)-CsI(Tl) calibration telescopes of the INDRA multidetector. The inclusive angular distributions are approximately isotropic, consistent with multiple rescattering in the target spectator. The multiplicity correlations of the low-energy pions and of energetic protons (Ep >or ≤ 150 MeV) with intermediate-mass fragments were determined from the measured coincidence data. The deduced correlation functions 1 + R ∼ 1.3 for inclusive event samples reflect the strong correlations evident from the common impact-parameter dependence of the considered multiplicities. For narrow impact-parameter bins (based on charged-particle multiplicity), the correlation functions are close to unity and do not indicate strong additional correlations. Only for pions at high particle multiplicities (central collisions) a weak anticorrelation is observed, probably due to a limited competition between these emissions. Overall, the results are consistent with the equilibrium assumption made in statistical multifragmentation scenarios. Predictions obtained with intranuclear cascade models coupled to the statistical multifragmentation model are in good agreement with the experimental data. (orig.)

  11. Study of correlations between light particles in 16O + 197Au reaction at 94 MeV/u

    International Nuclear Information System (INIS)

    Heavy ions collisions produce particles sources for which it is possible to determine the spatial and temporal extent by constructing the correlation functions of the emitted particles pairs. The first part of this work composed of four parts, describes the theoretical models required for the extraction of the size and lifetime of the source. The second part presents the set-up of the 16O + 197Au at 94 MeV/u experiment. The set-up was constituted by a correlator to measure correlation functions and by a 2 π multidetector to detect light charged particles. We show the experimental technics we have used for the correction from the background coincidences in a multidetector, the experimental correlation functions determination and also, the speed spectra construction for particles which are detected in the multidetector. The third part exhibits our experimental results and shows that the multidetector allows to select different physical events classes according to which we can study the evolution of the sources sizes. The fourth part is a discussion about results coming from the previous part. On the one hand we show that the light charged particles multiplicity between 300 and 900 is a good filter for the violence of the collision and on the other hand, remarks are made on the validity of the theoretical models. We propose also a different construction technics for the correlation functions. The necessity to calculate correlation functions by considering the statistical model is also mentioned

  12. Study on Safety and Immunogenicity of Haemophilus Influenzae Type b Conjugate Vaccine (Polyribosylribitol Phosphate-Cross Reacting Material 197)%b型流行性感冒嗜血杆菌结合疫苗(磷酸多核糖基核糖醇-白喉毒素突变体197)的安全性和免疫原性研究

    Institute of Scientific and Technical Information of China (English)

    赵玉良; 张建立; 陈玉国; 马景臣; 郝志勇; 王志国; 张志勇; 刘金凤

    2013-01-01

    Objective To evaluate the safety,immunogenicity and booster effect of a Haemophilus influenzae type b (Hib) conjugated vaccine (polyribosylribitol phosphate-cross reacting material 197,PRP-CRM197) against Hib for Chinese children,Methods The Hib PRP-CRM197 was evaluated in three trials.The first (phase Ⅰ) safety study were conducted in two Firstly,20 toddlers aged 16-20 months were enrolled and received one dose of PRP-CRM197 vaccine; 15 days later,20 infants aged 2-4 months were enrolled and received 3 doses of PRP-CRM197 vaccine with 1 months interval.Safety data only were collected up to 30 days post each dose of vaccination.The second trial,a phase Ⅲ study,primary immunization enrolled randomly 916 subjects who were the age of 2-4 months to receive either PRP-CRM197 (N=611) or PRP-T (tetanus toxoid) vaccine as control group (N=305) administered three doses with one month interval.In a third (phase Ⅲ)trial,booster immunization,the subjects received a booster dose of vaccine for toddlers (12 to 18 months of age)after completed 3 doses.In the phase Ⅲ studies,safety and immunogenicity data were collected.The immunogenicity was measured via anti-PRP enzyme-linked immunosorbant assay.Results The safety study of phase Ⅰ found that the PRP-CRM197 was well tolerated in both age groups (infants and toddlers).The trial of phase Ⅲ for three-dose primary immunization schedule and booster dose demonstrated the safety of PRP-CRM197 are similar to that of PRP-T.All subjects achieved short-term seroprotective anti-PRP antibody levels (≥ 0.15μg/ml) following primary immunization with two kind of vaccines; 99% and 97% of subjects achieved long-term (≥ 1.0μg/ml) seroprotection in the PRP-CRM197 and PRP-T vaccine groups respectively,one month after completion of the primary vaccination series.All subjects receiving booster mmunization among trial group and control group got short-term and long-term seroprotective antibody.Administration of PRP-CRM197

  13. miRNA-197 and miRNA-223 Predict Cardiovascular Death in a Cohort of Patients with Symptomatic Coronary Artery Disease.

    Directory of Open Access Journals (Sweden)

    Christian Schulte

    Full Text Available Circulating microRNAs (miRNAs have been described as potential diagnostic biomarkers in cardiovascular disease and in particular, coronary artery disease (CAD. Few studies were undertaken to perform analyses with regard to risk stratification of future cardiovascular events. miR-126, miR-197 and miR-223 are involved in endovascular inflammation and platelet activation and have been described as biomarkers in the diagnosis of CAD. They were identified in a prospective study in relation to future myocardial infarction.The aim of our study was to further evaluate the prognostic value of these miRNAs in a large prospective cohort of patients with documented CAD.Levels of miR-126, miR-197 and miR-223 were evaluated in serum samples of 873 CAD patients with respect to the endpoint cardiovascular death. miRNA quantification was performed using real time polymerase chain reaction (RT-qPCR.The median follow-up period was 4 years (IQR 2.78-5.04. The median age of all patients was 64 years (IQR 57-69 with 80.2% males. 38.9% of the patients presented with acute coronary syndrome (ACS, 61.1% were diagnosed with stable angina pectoris (SAP. Elevated levels of miRNA-197 and miRNA-223 reliably predicted future cardiovascular death in the overall group (miRNA-197: hazard ratio (HR 1.77 per one standard deviation (SD increase (95% confidence interval (CI 1.20; 2.60, p = 0.004, C-index 0.78; miRNA-223: HR 2.23 per one SD increase (1.20; 4.14, p = 0.011, C-index 0.80. In ACS patients the prognostic power of both miRNAs was even higher (miRNA-197: HR 2.24 per one SD increase (1.25; 4.01, p = 0.006, C-index 0.89; miRA-223: HR 4.94 per one SD increase (1.42; 17.20, p = 0.012, C-index 0.89.Serum-derived circulating miRNA-197 and miRNA-223 were identified as predictors for cardiovascular death in a large patient cohort with CAD. These results reinforce the assumption that circulating miRNAs are promising biomarkers with prognostic value with respect to future

  14. The clinical relevance of the miR-197/CKS1B/STAT3-mediated PD-L1 network in chemoresistant non-small-cell lung cancer.

    Science.gov (United States)

    Fujita, Yu; Yagishita, Shigehiro; Hagiwara, Keitaro; Yoshioka, Yusuke; Kosaka, Nobuyoshi; Takeshita, Fumitaka; Fujiwara, Tomohiro; Tsuta, Koji; Nokihara, Hiroshi; Tamura, Tomohide; Asamura, Hisao; Kawaishi, Makoto; Kuwano, Kazuyoshi; Ochiya, Takahiro

    2015-04-01

    Programmed cell death ligand-1 (PD-L1) has recently gained considerable attention for its role in tumor immune escape. Here, we identify a miR-197/CKS1B/STAT3-mediated PD-L1 network in chemoresistant non-small-cell lung cancer (NSCLC), independent of immunoinhibitory signals. miR-197 is downregulated in platinum-resistant NSCLC specimens, resulting in the promotion of chemoresistance, tumorigenicity, and pulmonary metastasis in vitro and in vivo. Mechanistic investigations reveal that a miR-197-mediated CKS1B/STAT3 axis exerts tumor progression regulated by various oncogenic genes (Bcl-2, c-Myc, and cyclin D1), and PD-L1 is a putative biomarker of this axis. Furthermore, we demonstrate that a miR-197 mimic sensitizes PD-L1(high) drug-resistant cells to chemotherapy. These results indicate that the biological interaction between PD-L1 and chemoresistance occurs through the microRNA regulatory cascade. More importantly, expression levels of miR-197 are inversely correlated with PD-L1 expression (n = 177; P = 0.026) and are associated with worse overall survival (P = 0.015). Our discoveries suggest that the miR-197/CKS1B/STAT3-mediated network can drive tumor PD-L1 expression as a biomarker of this cascade, and miR-197 replacement therapy may be a potential treatment strategy for chemoresistant NSCLC. PMID:25597412

  15. 4π studies of the 1.8-4.8 GeV 3He+natAg, 197Au reactions. I. Energy deposition

    International Nuclear Information System (INIS)

    The 4π detector ISiS has been used to measure light-charged particles and intermediate-mass-fragments emitted in the 1.8-4.8 GeV 3He+natAg, 197Au reactions. Ejectile multiplicity and total event kinetic energy distribution scale systematically with projectile energy and target mass, except for the natAg target at 3.6 and 4.8 GeV. For this system, a saturation in deposition energy is indicated by the data, suggesting the upper projectile energy for stopping has been reached. Maximum deposition energies of ∼950 MeV for the natAg target and ∼1600 MeV for the 197Au target are inferred from the data. Comparison of the experimental distributions with intranuclear cascade predictions shows qualitative agreement. (author)

  16. 4{pi} studies of the 1.8-4.8 GeV {sup 3}He+{sup nat}Ag, {sup 197}Au reactions. I. Energy deposition

    Energy Technology Data Exchange (ETDEWEB)

    Morley, K.B.; Kwiatkowski, K.; Bracken, D.S.; Renshaw Foxford, E. [Indiana Univ., Bloomington, IN (United States). Dept. of Chemistry; Legrain, R.; Pollacco, E.C.; Volant, C. [CEA Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France). Dept. d`Astrophysique, de la Physique des Particules, de la Physique Nucleaire et de l`Instrumentation Associee; Korteling, R.G. [Simon Fraser Univ., Burnaby, BC (Canada). Dept. of Chemistry; Breuer, H. [Maryland Univ., College Park, MD (United States). Dept. of Physics; Brzychczyk, J. [Jagellonian Univ., Krakow (Poland). Inst. of Physics

    1996-01-01

    The 4{pi} detector ISiS has been used to measure light-charged particles and intermediate-mass-fragments emitted in the 1.8-4.8 GeV {sup 3}He+{sup nat}Ag, {sup 197}Au reactions. Ejectile multiplicity and total event kinetic energy distribution scale systematically with projectile energy and target mass, except for the {sup nat}Ag target at 3.6 and 4.8 GeV. For this system, a saturation in deposition energy is indicated by the data, suggesting the upper projectile energy for stopping has been reached. Maximum deposition energies of {approx}950 MeV for the {sup nat}Ag target and {approx}1600 MeV for the {sup 197}Au target are inferred from the data. Comparison of the experimental distributions with intranuclear cascade predictions shows qualitative agreement. (author). Submitted to Physical Review, C (US); 46 refs.

  17. Astatination of closo-dodecaborate(2-) anion

    Czech Academy of Sciences Publication Activity Database

    Orlova, A.; Lebeda, Ondřej; Tolmachev, V.; Lundquist, H.; Carlsson, J.; Sjöberg, S.

    Cambridge : The Royal Society of Chemistry , 2000 - (Davidson, M.; Hughes, A.; Marder, T.; Wade , K.), s. 144-147 [Conference "Contemporary Boron Chemistry ". Durham (GB), 11.07.1999-15.07.1999] Institutional research plan: CEZ:AV0Z1048901 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  18. The sustainability of quinoa production in Southern Bolivia : from misrepresentations to questionable solutions. Comments on Jacobsen (2011, J. Agron. Crop Sci. 197: 390-399)

    OpenAIRE

    Winkel, Thierry; Bertero, H. D.; Van Bommel, P.; Bourliaud, J.; Lazo, M. C.; Cortes, G.; Gasselin, P.; Geerts, S; Joffre, R; Leger, F.; Avisa, B. M.; S. Rambal; Rivière, G.; Tichit, M.; Tourrand, J.F.

    2012-01-01

    Reviewing the situation of quinoa production in southern Bolivia, Jacobsen (2011, J. Agron. Crop Sci. 197: 390) argues that the booming export market has a negative effect on the environment and on the home consumption of quinoa, thereby leading to an environmental disaster in the region. In view of the scarcity of scientific knowledge on the rapid social and environmental dynamics in the region, we consider that Jacobsens review misrepresents the situation of quinoa production in southern Bo...

  19. Two-step processes in the population of the 22+ state via the 197Au(d,3He)196Pt reaction

    International Nuclear Information System (INIS)

    The 197Au(d,3He)196Pt reaction has been studied at E/sub d/ = 50 MeV. A coupled channels analysis is presented which shows that the strong excitation of the 22+ state, with a cross section of 80% of the 21+ state, cannot be explained without an important direct spectroscopic amplitude. Thus the discrepancy with the U(6Vertical Bar4) supersymmetry model, in which this transition is forbidden, remains

  20. Two-particle rapidity correlations between relativistic particles in central collisions of $^{197}$Au nuclei in emulsion at 11.6 A GeV/c

    CERN Document Server

    Abdurakhmanov, U U; Navotny, V Sh

    2015-01-01

    It is shown that in central collisions of $^{197}$Au nuclei with heavy emulsion nuclei at 11.6 $A$GeV/c the magnitude of two-particles pseudorapidity short-range correlations for produced particles is strongly suppressed whereas the magnitude of long-range correlations is considerably enhanced in comparison with nucleon-nucleon interactions. The experimental data are compared with calculations based on the FRITIOF-M model and the model of independent emission of particles.

  1. Experimental study of the fusion dynamics of 32,34S + 197Au with quasi-elastic scattering

    International Nuclear Information System (INIS)

    Full text: The fusion dynamics of heavy systems, such as 64Ni + 208Pb, leading to the synthesis of super-heavy elements is presently not fully understood. Typical beam energies in such reactions are of the order or smaller than the Coulomb barrier height to minimize the excitation energy of the compound system and increase the survival probability of evaporation residues. It is known that at such energies the relative motion of projectile and target couples to internal degrees of freedom of the system, such as collective motion and particle transfer. This can give rise to a distribution of fusion barriers, which generally leads to an enhancement of the fusion cross-section below the Coulomb barrier. The important role of the individual degrees of freedom can be identified by extracting representations of the barrier distribution from fusion excitation functions. Complementary representations can be obtained from measurements of the quasi-elastic or elastic scattering excitation functions at backward angles. The sensitivity of the representations from scattering is limited to the lower energy part of the barrier distribution, which, however, may contain important signatures of positive Q-value neutron transfer channels. Neutron transfer may be a precursor of neutron flow and neck-formation, which are considered in macroscopic models of the fusion of heavy systems. In order to study the influence of neutron transfer in heavy fusion reactions, quasielastic scattering has been measured for 32,34S + 197Au at energies spanning the Coulomb barrier. The quasi-elastic yield, including inelastic and transfer reactions, was detected at 165 deg with a Si-surface barrier detector. The excitation functions have been normalized to Rutherford scattering, detected at 30 deg using an existing gas ionisation detector. Representations of the barrier distributions have been extracted and are compared with earlier measurements for 32S + 208Pb

  2. Tivantinib (ARQ 197) exhibits antitumor activity by directly interacting with tubulin and overcomes ABC transporter-mediated drug resistance.

    Science.gov (United States)

    Aoyama, Aki; Katayama, Ryohei; Oh-Hara, Tomoko; Sato, Shigeo; Okuno, Yasushi; Fujita, Naoya

    2014-12-01

    Tivantinib (ARQ197) was first reported as a highly selective inhibitor of c-MET and is currently being investigated in a phase III clinical trial. However, as recently reported by us and another group, tivantinib showed cytotoxic activity independent of cellular c-MET status and also disrupted microtubule dynamics. To investigate if tivantinib exerts its cytotoxic activity by disrupting microtubules, we quantified polymerized tubulin in cells and xenograft tumors after tivantinib treatment. Consistent with our previous report, tivantinib reduced tubulin polymerization in cells and in mouse xenograft tumors in vivo. To determine if tivantinib directly binds to tubulin, we performed an in vitro competition assay. Tivantinib competitively inhibited colchicine but not vincristine or vinblastine binding to purified tubulin. These results imply that tivantinib directly binds to the colchicine binding site of tubulin. To predict the binding mode of tivantinib with tubulin, we performed computer simulation of the docking pose of tivantinib with tubulin using GOLD docking program. Computer simulation predicts tivantinib fitted into the colchicine binding pocket of tubulin without steric hindrance. Furthermore, tivantinib showed similar IC50 values against parental and multidrug-resistant cells. In contrast, other microtubule-targeting drugs, such as vincristine, paclitaxel, and colchicine, could not suppress the growth of cells overexpressing ABC transporters. Moreover, the expression level of ABC transporters did not correlate with the apoptosis-inducing ability of tivantinib different from other microtubule inhibitor. These results suggest that tivantinib can overcome ABC transporter-mediated multidrug-resistant tumor cells and is potentially useful against various tumors. PMID:25313010

  3. Proton hole response function on 196Pt and 197Au transitional target nuclei up to high excitation energy

    International Nuclear Information System (INIS)

    The proton hole response functions have been studied on the transitional target nuclei 196Pt and 197Au via the (d, 3He) reaction at Ed = 108.4 MeV, up to 6 MeV and 18.5 MeV excitation energy respectively. 196Pt low lying levels have been studied in addition at Ed = 50 MeV. Spectroscopic information gained on the low lying levels in the 195Ir and 196Pt residual nuclei allows the discussion of the 3s1/2 and 2d3/2 orbital filling. For both 195Ir and 196Pt, new 2d5/2 and 1h11/2 levels or groups are observed. The 196Pt spectra exhibit a broad bump between 6 and 15 MeV excitation energy riding over a continuous background. The study of the excitation energy spectra up to 27 MeV leads to a consistent subtraction of the background. The contributions of the 1g9/2, 2p and 1f inner hole strengths are deduced by least square fits of DWBA angular distributions. About the whole 1g9/2 and 2p inner hole strengths and 50% of the 1f strengths are found below Ex = 18.5 MeV. The background correction is also used to reanalyse previous data obtained via the same reaction on the spherical 208Pb target for comparison. Experimental results on centroid separation energies are compared with Hartree Fock predictions. The spreading widths and specific features of the strength distribution shapes in 195Ir and 196Pt and 207Tl are discussed in connection with the dominant quadrupole collective degrees of freedom of the two first nuclei contrasting with the strong vibrational modes in 207Tl. The valence hole fragmentation in 195Ir is described in the framework of the Core-Quasi-Particle-Coupling-Model

  4. The quadrupole moments of 195-197Ausup(m)(11/2) and the low temperature thermal relaxation of gold in cadmium

    International Nuclear Information System (INIS)

    sup(195, 197m)Hg has been oriented at low temperature in a cadmium single crystal. From the orientation pattern of the 388 keV gamma ray Vsub(zz)(HgCd) = +1.82(25)x1018 V/cm2 has been deduced. Using the dipole-relaxation mechanism on the gold isomeric state, the relaxation constant Csub(K) = 0.044(5)Ks, the quadrupole interaction frequencies γsub(Q)(195m-AuCd) = +395(18) MHz, γsub(Q)(197m-AuCd) = +380(58) MHz and delta(E2/M1 ; 261 keV) < 0 are obtained from the orientation pattern of the 261 and 279 keV gamma rays. Using literature electric field gradient of gold in cadmium, Q(195m-Au,11/2) = (+)1.41(10) b and Q(197m-Au,11/2) = (+)1.35(22) b can be deduced. (Auth.)

  5. Gold nanoparticles production using reactor and cyclotron based methods in assessment of (196,198)Au production yields by (197)Au neutron absorption for therapeutic purposes.

    Science.gov (United States)

    Khorshidi, Abdollah

    2016-11-01

    Medical nano-gold radioisotopes is produced regularly using high-flux nuclear reactors, and an accelerator-driven neutron activator can turn out higher yield of (197)Au(n,γ)(196,198)Au reactions. Here, nano-gold production via radiative/neutron capture was investigated using irradiated Tehran Research Reactor flux and also simulated proton beam of Karaj cyclotron in Iran. (197)Au nano-solution, including 20nm shaped spherical gold and water, was irradiated under Tehran reactor flux at 2.5E+13n/cm(2)/s for (196,198)Au activity and production yield estimations. Meanwhile, the yield was examined using 30MeV proton beam of Karaj cyclotron via simulated new neutron activator containing beryllium target, bismuth moderator around the target, and also PbF2 reflector enclosed the moderator region. Transmutation in (197)Au nano-solution samples were explored at 15 and 25cm distances from the target. The neutron flux behavior inside the water and bismuth moderators was investigated for nano-gold particles transmutation. The transport of fast neutrons inside bismuth material as heavy nuclei with a lesser lethargy can be contributed in enhanced nano-gold transmutation with long duration time than the water moderator in reactor-based method. Cyclotron-driven production of βeta-emitting radioisotopes for brachytherapy applications can complete the nano-gold production technology as a safer approach as compared to the reactor-based method. PMID:27524041

  6. Physical and underway data collected aboard the KNORR during cruise KN197-03 in the North Atlantic Ocean from 2010-01-24 to 2010-02-14 (NODC Accession 0104285)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104285 includes physical and underway data collected aboard the KNORR during cruise KN197-03 in the North Atlantic Ocean from 2010-01-24 to...

  7. Physical and underway data collected aboard the KNORR during cruise KN197-08 in the Caribbean Sea and North Atlantic Ocean from 2010-05-22 to 2010-06-24 (NODC Accession 0104289)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104289 includes physical and underway data collected aboard the KNORR during cruise KN197-08 in the Caribbean Sea and North Atlantic Ocean from...

  8. Physical and underway data collected aboard the KNORR during cruise KN197-10 in the North Atlantic Ocean from 2010-07-10 to 2010-08-01 (NODC Accession 0104293)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104293 includes physical and underway data collected aboard the KNORR during cruise KN197-10 in the North Atlantic Ocean from 2010-07-10 to...

  9. The rise and fall of multifragment production in 197Au+C, Al, and Cu reactions at E/A=600 MeV

    International Nuclear Information System (INIS)

    We have studied the transition from the evaporation of the vaporization regime in 197Au induced reactions on C, Al, and Cu targets at a beam energy of 600 MeV per nucleon. The experiment was performed with the ALADIN forward spectrometer at SIS. We find that with increasing violence of the collision the mean multiplicity of intermediate mass fragments first increases to an maximum IMF> ≅3.5 and then decreases again. Calculations using the BUU model suggest that the fragmentation is governed by the energy Edep deposited into the Au nucleus and that the maximum of IMF> is reached around Edep=8 MeV/nucleon. (orig.)

  10. Effect of concrete buildings on the environmental neutron flux by using the reaction 197Au (n,γ) 198Au and extremely low level gamma ray spectroscopy

    Institute of Scientific and Technical Information of China (English)

    K. KOMURA; N.K. AHMED; A.H. EL-KAMEL; A.M.M. YOUSEF

    2004-01-01

    The activation of gold by environmental neutrons through the reaction 197Au (n,γ) 198Au was used to study the effect of concrete buildings on the neutron flux, and to estimate the thermal neutron flux inside and outside these buildings. The results showed that three ceilings of thickness 34 g/cm2 decrease the fast neutrons to 26% from its original value. However, the same reinforced concrete decreases the slow neturon flux to only 62% of its original value. The thermal neutron flux at 283 m from the center of Training Reactor of Kinki University, was twice higher than the environmental neutron background.

  11. Measurement of excitation functions and isomeric ratios of the 197Au(3He,xn)200- sup(x)Tl reactions, where x=2,3 and 4

    International Nuclear Information System (INIS)

    The excitation functions and isomer ratios of the 197Au(3He,xn)200- sup(x)Tl reactions, with x = 2, 3 and 4, were measured at bombarding energies in the range from 15 to 36 MeV. The measured values were compared to those obtained with the use of the statistical an hybrid modeles, calculated by the ALICE code. Best fit was achieved using the simple statistical model. The results were also compared to those found in literature for the (3He,xn) and (4He,xn) reactions in gold. (Author)

  12. Comparative study of fixation of Co57 labelled bleomycin, labelled gallium citrate and Hg197 labelled mercury chloride, benign or malignant pulmonary lesions

    International Nuclear Information System (INIS)

    Over the last ten years, numerous labelled molecules have been used in lung diseases, in order to attempt definite localisation of primary or secondary carcinoma. Three of these substances are now used: cobalt 57-labelled bleomycin, Hg197Cl2 and Ga67 citrate. A study of 34 patient with malignant or tuberculous lung disease with definite diagnosis, permitted demonstration of the fact that the highest uptake, or the best images, were obtained with labelled bleomycin. However, the long period of Co57 limits its indications in young subjects and, in these cases, HgCl2 is indicated

  13. Multifragment emission in the interaction of 86 MeV/μ 18O-ions with 197Au, 184W, and 106Ag

    International Nuclear Information System (INIS)

    Thin targets of 197Au, 184W, and 106Ag were vacuum deposited on Muscovite mica, CR-39, Makrofol-E, and phosphate glass track detectors. The 'target-detector' assemblies were then exposed perpendicularly to 86 MeV/μ 18O ions at CERN-SC. The exposed detectors were etched in appropriate etchants for various time intervals. Correlated reaction products were scanned in order to obtain multiprong events with different multiplicities. Multiplicity-distributions, fission-and total-reaction cross-sections have been determined. (author)

  14. A 1.97 μm multiwavelength thulium-doped silica fiber laser based on a nonlinear amplifier loop mirror

    International Nuclear Information System (INIS)

    A 1.97 μm multiwavelength Tm-doped fiber laser based on a nonlinear amplifier loop mirror (NALM) has been experimentally demonstrated. The NALM with 500 m standard single mode fiber introduces intensity-dependent gain to alleviate mode competition caused by homogeneous gain broadening in Tm-doped fibers. At room temperature, up to 42 wavelengths with a wavelength spacing of 0.33 nm oscillate within a 10-dB bandwidth simultaneously. Repeat measurement of the laser spectrum shows the wavelength drift of a multiwavelength Tm-doped fiber laser is less than 0.05 nm in 40 min. (letter)

  15. Evaporation residue formation competing with the fission process in the 197Au+16O, 12C reactions and fission barriers at a specified J window

    International Nuclear Information System (INIS)

    Evaporation-residue excitation functions for 16O and 12C+197Au reactions were measured by means of the activation technique. The competition between evaporation and fission of the compound nuclei was studied by comparing the observed evaporation-residue data with the published fission excitation functions. A newly devised analysis was applied in order to deduce a fission barrier height at a specified angular momentum and determine the relevant fissioning nucleus as well. We found the fission barriers to be 8.2 MeV for the 211Fr nucleus at 16 ℎ and 8.2 MeV for the 207At nucleus at 27 ℎ. (orig.)

  16. Efficacy, but not antibody titer or affinity, of a heroin hapten conjugate vaccine correlates with increasing hapten densities on tetanus toxoid, but not on CRM197 carriers.

    Science.gov (United States)

    Jalah, Rashmi; Torres, Oscar B; Mayorov, Alexander V; Li, Fuying; Antoline, Joshua F G; Jacobson, Arthur E; Rice, Kenner C; Deschamps, Jeffrey R; Beck, Zoltan; Alving, Carl R; Matyas, Gary R

    2015-06-17

    Vaccines against drugs of abuse have induced antibodies in animals that blocked the biological effects of the drug by sequestering the drug in the blood and preventing it from crossing the blood-brain barrier. Drugs of abuse are too small to induce antibodies and, therefore, require conjugation of drug hapten analogs to a carrier protein. The efficacy of these conjugate vaccines depends on several factors including hapten design, coupling strategy, hapten density, carrier protein selection, and vaccine adjuvant. Previously, we have shown that 1 (MorHap), a heroin/morphine hapten, conjugated to tetanus toxoid (TT) and mixed with liposomes containing monophosphoryl lipid A [L(MPLA)] as adjuvant, partially blocked the antinociceptive effects of heroin in mice. Herein, we extended those findings, demonstrating greatly improved vaccine induced antinociceptive effects up to 3% mean maximal potential effect (%MPE). This was obtained by evaluating the effects of vaccine efficacy of hapten 1 vaccine conjugates with varying hapten densities using two different commonly used carrier proteins, TT and cross-reactive material 197 (CRM197). Immunization of mice with these conjugates mixed with L(MPLA) induced very high anti-1 IgG peak levels of 400-1500 μg/mL that bound to both heroin and its metabolites, 6-acetylmorphine and morphine. Except for the lowest hapten density for each carrier, the antibody titers and affinity were independent of hapten density. The TT carrier based vaccines induced long-lived inhibition of heroin-induced antinociception that correlated with increasing hapten density. The best formulation contained TT with the highest hapten density of ≥30 haptens/TT molecule and induced %MPE of approximately 3% after heroin challenge. In contrast, the best formulation using CRM197 was with intermediate 1 densities (10-15 haptens/CRM197 molecule), but the %MPE was approximately 13%. In addition, the chemical synthesis of 1, the optimization of the conjugation

  17. Study of the correlations between intermediate mass fragments in the 86Kr + 197 Au reaction at 43 MeV/nucleon

    International Nuclear Information System (INIS)

    The different reaction mechanisms occurring in the 86Kr and 197 Au reaction, at 43 MeV/nucleon, are studied. The experiment is performed in an experimental device using, for the first time, three (among four) multidetectors available at Nautilus. The reaction crocs section is obtained. The investigation on the fragments coincidence allowed to show different components in the velocity correlation spectra. The reaction main characteristics are given. The simultaneous analysis of the quasi-projectile and the fragment(s), having intermediate velocities, showed the coexistence of different reaction mechanisms

  18. Precise αK Measurement of 346.5 keV Transition in ^197Pt as a Test of Internal Conversion Theory

    Science.gov (United States)

    Hernberg, Mark; Hardy, John; Nica, Ninel; Goodwin, John; Iacob, Victor

    2007-10-01

    We have determined the K-shell internal conversion coefficient (ICC) of the 346.5 keV M4 transition in ^197Pt using an HPGe detector at the Texas A&M University Cyclotron. ICCs are used in the study of nuclear decay schemes, branching ratios and transition rates, as well as spin and parity assignments. We have recently been measuring ICCs (in ^193Ir , ^137Ba, ^134Cs) with the specific purpose of testing the method used to treat the atomic vacancy in calculating ICCs. Previous measurements of the ICC for the 346.5 keV transition in ^197Pt have disagreed significantly from calculated coefficients regardless of the method used to consider the vacancy. This could have indicated some other unknown factor causing a problem in the calculations. Our preliminary result, determined with an uncertainty of 3% is αK= 4.24(13). This disagrees with previous measurements (αK= 4.02(8)) and is now consistent with the calculated ICCs.

  19. Precise measurements of αk for the 346.5 keV M4 transition from ^197Pt^m: A test of internal conversion theory

    Science.gov (United States)

    Nolan, J.; Nica, N.; Hardy, J. C.; Hernberg, M.; Goodwin, J. R.; Iacob, V. E.

    2008-10-01

    Precise values for internal conversion coefficients (ICCs) are important in the study of nuclear decay schemes; they are also useful for detector efficiency calibration. A recent survey revealed that few measured ICCs are known to a high precision (˜ 1%); in addition, there is some theoretical uncertainty over how to deal with the atomic vacancy left by the departing electron during the internal conversion process. Texas A&M has previously precisely measured the ICCs for ^193Ir, ^137Ba, and ^134Cs as a test of internal conversion theory; we now consider the ICC for ^197Pt^m as a further test. The ^197Pt^m was produced by thermal neutron activation of separated ^196Pt (97.43% pure). Two separate sources were produced; x-ray and gamma-ray emissions from each source were recorded by a High Purity Germanium Detector (+/- 0.20% absolute efficiency uncertainty). After impurity subtraction and attenuation correction, preliminary results for the αk value for the two sources have now been obtained. The αk from source one is 4.24 (13); the αk from source two is 4.26 (8). While these values are still tentative, the results show agreement with the theory that considers the atomic vacancy.

  20. Near-infrared Observations of Magnetars: XTE J1810-197, 1RXS J1708-4009, 1E 1841-045 and SGR 1900+14

    CERN Document Server

    Testa, V; Mignani, R P; Israel, G L; Perna, R; Chaty, S; Stella, L; Covino, S; Turolla, R; Zane, S; Curto, G Lo; Campana, S; Marconi, G; Mereghetti, S

    2007-01-01

    . We report on near-infrared (IR) observations of the three anomalous X-ray pulsars XTE J1810-197, 1RXS J1708-4009, 1E 1841-045 and the soft gamma-ray repeater SGR 1900+14, taken with the ESO-VLT, the Gemini, and the CFHT telescopes. . This work is aimed at identifying and/or confirming the IR counterparts of these magnetars, as well as at measuring their possible IR variability. . In order to perform photometry of objects as faint as Ks~20, we have used data taken with the largest telescopes, equipped with the most advanced IR detectors and in most of the cases with Adaptive Optics devices. The latter are critical to achieve the sharp spatial accuracy required to pinpoint faint objects in crowded fields. . We confirm with high confidence the identification of the IR counterpart to XTE J1810-197, and its IR variability. For 1E 1841-045 and SGR 1900+14 we propose two candidate IR counterparts based on the detection of IR variability. For 1RXS J1708-4009 we show that none of the potential counterparts within th...

  1. The Clinical Relevance of the miR-197/CKS1B/STAT3-mediated PD-L1 Network in Chemoresistant Non-small-cell Lung Cancer

    OpenAIRE

    FUJITA Yu; Yagishita, Shigehiro; Hagiwara, Keitaro; Yoshioka, Yusuke; Kosaka, Nobuyoshi; Takeshita, Fumitaka; Fujiwara, Tomohiro; Tsuta, Koji; Nokihara, Hiroshi; Tamura, Tomohide; Asamura, Hisao; Kawaishi, Makoto; Kuwano, Kazuyoshi; Ochiya, Takahiro

    2015-01-01

    Programmed cell death ligand-1 (PD-L1) has recently gained considerable attention for its role in tumor immune escape. Here, we identify a miR-197/CKS1B/STAT3-mediated PD-L1 network in chemoresistant non-small-cell lung cancer (NSCLC), independent of immunoinhibitory signals. miR-197 is downregulated in platinum-resistant NSCLC specimens, resulting in the promotion of chemoresistance, tumorigenicity, and pulmonary metastasis in vitro and in vivo. Mechanistic investigations reveal that a miR-1...

  2. Interferometry of light particles with a CsI(Tl) multi-detector in the collision: 16O(93.6 MeV/A) + 197Au

    International Nuclear Information System (INIS)

    Back angle emissions of light particles have been studied by interferometry in the 160 + 197Au reaction. The experiment was performed at GANIL at 93,6 MeV/A. To achieve the correlation functions in the average backward direction we built entirely a compact multi-detector of Csl scintillators which was set up at 115 degrees to the beam direction. This work describes the relevant tests of the detector, data taking and data processing. The p-p, α-α, d-d, α-d, α-t correlations that we studied exhibit a complete damping of two body resonant nuclear effects. The most surprising result concerns the p-p correlation which, by its new shape, could be the signature of a de-excitation process in two steps. The ordering time of the 2 proton cascade would be of the order of 1.5*10-21 s. (author)

  3. 4π studies of the 1.8 endash 4.8 GeV 3He+natAg, 197Au reactions. II. Multifragmentation

    International Nuclear Information System (INIS)

    Multifragmentation of natAg and 197Au nuclei induced by 1.8 endash 4.8 GeV 3He ions has been studied with the Indiana Silicon Sphere 4π detector array. Rapidity, moving source, and sphericity-coplanarity analyses are consistent with near-simultaneous emission from a source in approximate kinetic equilibrium. For the most dissipative collisions, the spectral peaks are broadened and shifted to very low energies, indicative of emission from an extended nuclear system with ρ/ρ0∼1/3. Predictions of an intranuclear cascade/expanding, emitting source model compare well with experimental multiplicity distributions and the evolution of fragment spectral shapes. copyright 1996 The American Physical Society

  4. Polarization transfer in quasifree p-vector,n-vector reactions on C, Ca, and Pb targets at 197 MeV

    International Nuclear Information System (INIS)

    A complete set of polarization-transfer observables has been measured at 197 MeV in the quasifree region for the (p(vector sign),n(vector sign)) reactions on C, Ca, and Pb targets. Data have been obtained at laboratory scattering angles of 13 deg., 24 deg., 37 deg., and 48 deg., which span an energy-loss range up to 150 MeV, with a corresponding momentum-transfer range q=0.75-2.4 fm-1. The empirical results are compared to the observables obtained from the free nucleon-nucleon data base. Derived spin-longitudinal and spin-transverse responses for Ca are compared with those previously obtained at 346 and 495 MeV incident energies

  5. Etude de la reaction $^{208}$Pb + $^{197}$Au a 29 MeV/u a l'aide de la multiplicite de neutrons associee

    OpenAIRE

    Bresson, S.

    1993-01-01

    La disponibilité de faisceaux d'ions très lourds au GANIL a rendu possible l'étude de la réaction 208Pb+197au à 29 MeV/u. L'analyse de ce système lourd et symétrique a été réalisée a l'aide de la multiplicité de neutrons associée. Dans la première partie de ce travail, qui en compte quatre, nous décrivons l'ensemble des techniques expérimentales et le traitement des informations, en particulier pour le détecteur de neutrons ORION et pour le détecteur de produits charges utilise ici, un hodosc...

  6. Roman Policies towards Antiochus III and the Greeks from Winter 197/196 B.C. to Autumn 196 B.C.

    Directory of Open Access Journals (Sweden)

    Deutschmann, Eike Hellmut

    2012-01-01

    Full Text Available In the Second Macedonian War (200-196 B.C., the res publica reduced the strength of the enemy King Philip V apparently to establish a new political order in Southern Balkans: Assumedly a pro-Roman balance of forces should prevail there, untainted by influence of another major power. A particular senatorial policy towards the Greeks probably did not exist before the fighting in Hellas came to an end in summer 197 B.C. In the same year, the Seleucid king Antiochus III brought large parts of the west coast of Asia Minor under control and set about crossing the Hellespont. Rome subsequently stylized itself as the guardian of freedom for the Greeks living in Hellas and Asia Minor. The statesmen of the res publica could have perceived Antiochus’ expansion as a threat to the mentioned new order. Therefore, the Roman Policy of Freedom was possibly applied primarily to take action against the Seleucid king. Die res publica verminderte im Zweiten Makedonischen Krieg (200-196 a.c. die Macht des gegnerischen Königs Philipp V - anscheinend um eine neue politische Ordnung im südlichen Balkanraum zu etablieren: Vermutlich sollte dort ein romfreundliches Kräftegleichgewicht vorherrschen, auf das keine andere Großmacht Einfluß hat. Eine speziell an die Griechen gerichtete Politik seitens des römischen Senats gab es wahrscheinlich nicht vor Ende der Kampfhandlungen in Hellas im Sommer 197 a.c. In dem Jahr erweiterte der seleukidische König Antiochos III. seinen Einflussbereich auf große Teile der kleinasiatischen Westküste und schickte sich an, den Hellespont zu überqueren. Rom stilisierte sich in der Folgezeit zum Freiheitsgarant der in Hellas und Kleinasien lebenden Griechen. Antiochos Expansion könnte von den Staatsmännern der res publica als Bedrohung der genannten neuen Ordnung angesehen worden sein. Demzufolge wurde die römische Freiheitspolitik möglicherweise in erster Linie angewendet, um gegen den seleukidischen König vorzugehen.

  7. Central collisions between 28Si nuclei at 12.4, 19.7 and 30.0 MeV per nucleon

    International Nuclear Information System (INIS)

    The formation and decay of nuclei in central collisions of the 28Si + 28Si system at bombarding energies of 12.4, 19.7 and 30.0 MeV per nucleon is studied by analysis of the light particle (LP) spectra measured in coincidence with evaporation residues (ER) and measurements of the inclusive velocity distribution of ER's. From the last set of measurements a strong reduction of the ER cross section at increasing incident energy was observed and especially the relation to a possible vanishing fusion cross section is discussed. The coincidence measurements determines the LP pre-equilibrium contribution and the LP decay modes of highly excited systems. The ER's produced in fusion reactions between 28Si nuclei were detected with a simple ionization chamber ΔE detector and a surface barrier E detector. For the LP detection multidetector systems consisting of CsI(TL) detectors were used. In this thesis the developments that have led to the construction of a CsI(TL) charged particle detector and of the Utrecht multidetector system, the experimental setup and the methods used in the acquisition, processing and analysis of the data, are described. The results of the heavy-ion velocity measurements are presented and conclusions are drawn about equilibrium and pre-equilibrium processes from the analysis. (H.W.). 124 refs.; 44 figs.; 24 tabs

  8. Study of the fission process of 200Pb and 197Tl produced in fusion reactions with the modified statistical model and multidimensional dynamical model

    Science.gov (United States)

    Eslamizadeh, H.

    2015-09-01

    The fission probability, pre-scission neutron, proton and alpha multiplicities, anisotropy of fission fragment angular distribution and the fission time have been calculated for the compound nuclei 200Pb and 197Tl based on the modified statistical model and four-dimensional dynamical model. In dynamical calculations, dissipation was generated through the chaos weighted wall and window friction formula. The projection of the total spin of the compound nucleus to the symmetry axis, K, was considered as the fourth-dimension in Langevin dynamical calculations. In our dynamical calculations, we have used a constant dissipation coefficient of K, {γ }K=0.077{({{MeV}} {{zs}})}-{1/2}, and a non-constant dissipation coefficient to reproduce the above-mentioned experimental data. Comparison of the theoretical results of the fission probability and pre-scission particle multiplicities with the experimental data showed that the difference between the results of both dynamical models is small whereas, for the anisotropy of fission fragment angular distribution, it is slightly large. Furthermore, comparison of the results of the modified statistical model with the above-mentioned experimental data showed that with choosing appropriate values of the temperature coefficient of the effective potential, λ , and the scaling factor of the fission-barrier height, {r}s, the experimental data were satisfactorily reproduced.

  9. Equilibration in the reaction of 175 and 252 MeV /sup 20/Ne with /sup 197/Au. [Energy, element, and angular distributions

    Energy Technology Data Exchange (ETDEWEB)

    Moulton, J.B.

    1978-06-01

    The highly inelastic nuclear reaction of /sup 197/Au with /sup 20/Ne at 175 and 252 MeV laboratory energies is studied. Energy-, elemental-, and angular- distributions for atomic numbers 5 to 30 (175 MeV) or 34 (252 MeV) are presented. The means and widths of the kinetic energy spectra for detected elements are compared with a theoretical calculation. The calculation postulates thermalization of the incident projectile kinetic energy, and includes one sha(e-vibrational degree of freedom and rigid rotation of the reaction complex. The effect of particle evaporation is considered. Good agreement of the expurimental mean energies with the theory is obtained. Poorer agreement of the kinetic energy widths with the theory may be due to a low-temperature quantal effect. The relative elemental yields are analyzed for their degree of equilibration, based on a model of diffusive nucleon exchange as described by the master equation. A similar degree of equilibration is observed for both reaction energies. The absolute elemental yields are reproduced qualitatively by employing an advanced diffusion code, coupled with calculation of the subsequent fission of heavy reaction products, including the compound nucleus. The angular distributions are analyzed with a simple model, to estimate the reaction lifetime of selected elements.

  10. Decay analysis of pre-actinide and trans-actinide nuclei formed using various projectiles on a 197Au target at ECN*=60 MeV

    Science.gov (United States)

    Grover, Neha; Kaur, Gurvinder; Sharma, Manoj K.

    2016-01-01

    The collective clusterization approach of the dynamical cluster decay model (DCM) has been applied to study the decay of odd mass nuclei 223Pa*, 215Fr*, 227Np*, and 233Am*, which are formed in heavy-ion-induced reactions. The aim of this study is to investigate the decay pattern and related behavior of these heavy mass nuclei formed in four distinct reactions involving different projectiles (with mass A =18 -36 ) induced on 197Au target nucleus. Further, in order to analyze the role of deformations, the calculations have been done by considering spherical choice of fragmentation as well as with inclusion of quadrupole (β2) deformation. For the heavy mass region, with fission being the dominant decay mode, an attempt has been made to investigate the effect of projectile mass in reference to fission decay patterns of the pre-actinide 215Fr* nucleus and the trans-actinide nuclei 227Np* 223Pa*, 223Am* and formed at common excitation energy, ECN*=60 MeV . Besides this, the shell closure effects and the role of orientation have been explored, which suggest the presence of a noncompound nucleus process such as quasifission (QF) for the odd mass nuclei under consideration. For both the compound nucleus and the noncompound nucleus processes, the results obtained using DCM are found to have nice agreement with experimental observations. The isotopic and isobaric analysis is also worked out so as to have a comprehensive idea about the dynamics involved.

  11. Ternary fission with 4He emission in 16O(144 Mev) + 232Th and 12C(108 Mev) + 197Au reactions

    International Nuclear Information System (INIS)

    Results of coincidence study of 4He emission with fission fragments in 12C (108 MeV) ions with sup(197)Au target and 16O (144 MeV) ions with sup(223)Th target reactions are presented. On the basis of Monte Carlo kinematic simulation of nuclear reactions analysis of energy and velocity spectra of α-particles has been performed. The conclusion has been performed. The conclusion has been drawn that the main source of 4He emission was the evaporation from a fissioning compound nucleus. Substantial part of α-particles was emitted from fully accelerated fission fragments. Some of 4He nuclei with mean energy of about 16 MeV emitted mainly perpendicular to the fission axis were identified as similar to long range α-particles in ternary fission of heavy nuclei with low excitation energy. Multiplicities of emission of these particles are considerably higher than those at low excitation energy. Comparison of experimental results with statistical model calculations has been made

  12. Complete angular distribution measurements of pp spin correlation parameters Axx, Ayy, and Axz and analyzing power Ay at 197.4 MeV

    International Nuclear Information System (INIS)

    Measurements of pp spin correlation coefficients Axx, Ayy, and Axz and analyzing power Ay for pp elastic scattering at 197.4 MeV over the laboratory angular range 3.5 degree - 43.5 degree (θc.m.=7 degree - 90 degree) have been carried out. The typical statistical accuracy per 1 degree angle bin is better than 0.02 for the Amn and better than 0.005 for Ay. Systematic errors are negligible except for an overall normalization uncertainty of 2.5% for Amn and 1.3% for Ay. The experiment makes use of a polarized hydrogen gas target internal to a proton storage ring (IUCF Cooler) and a circulating beam of polarized protons. The target polarization is switched in sign and direction (x,y,z) every 2 s by reversing a weak guide field (∼0.3 mT). Scattered and recoil protons are detected in coincidence by two sets of wire chambers, by scintillators, and by silicon-strip recoil detectors placed 5 cm from the proton beam. Analysis methods and comparison to recent pp partial-wave analyses and NN potential models are described. copyright 1998 The American Physical Society

  13. Individual renal clearance measurements in man using the early part of 131I-hippuran renogram. Comparison with 197HgCl2 fixation

    International Nuclear Information System (INIS)

    Quantitative measurement of individual renal function was assayed using analysis of the early part of 131I-Hippuran uptake curve obtained from single probes over kidneys and subclavicular area and recorded on magnetic tape. Blood background substraction was performed by calibration of the blood curve with a prior 131I-Albumin injection. Postulating the same detection efficiency for each kidney by a previous 125I-Hippuran injection, we calculated the clearance ratio as the ratio of the angular coefficient of the early part of the corrected renogram against the corresponding blood integral activity curve. Data processing was performed without any preimposed model. Individual clearances were calculated from the total clearance simultaneously measured using the simplified method without urine collection. In 7 control subjects, clearances expressed in per cent of total clearance, were 51.2+-1.3 and 48.3+-1.4 ml/min for right and left kidney respectively. In 4 uninephrectomized patients a precision of 5% in calculating individual clearance was estimated from data recorded at the level of the remaining kidney. In 8 patients with functional asymmetry, results were compared with 197Hg Cl2 fixation. A correlation coefficient of 0.95 was found. The method we propose seems valuable for clinical investigation, allowing repetitive measurements

  14. Percutaneous Excision of a Benign Breast Mass Using Ultrasound-guided, Vacuum-assisted Core Biopsy:A Review of 197 Cases with Long Term Follow-up

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, Hoi Soo; Han, Heon; Kim, Sam Soo; Jeon, Yong Hwan; Lee, Ji Won; Kim, Hyoung Rae [Kangwon National University College of Medicine, Chuncheon (Korea, Republic of); Moon, Jin Hee; Lee, Hyun; Koh, Sung Hye [Hallym University College of Medicine, Chuncheon (Korea, Republic of); Kim, Sun Mi [Bundang Seoul National University Hospital, Seoul (Korea, Republic of)

    2010-03-15

    To assess long term results of excising benign masses using ultrasound (US)-guided, vacuum-assisted core biopsy (Mammotome). We enrolled 163 patients (197 masses) receiving US guided excision using vacuum-assisted core biopsy and follow-up sonography in this retrospective study. The masses were category 3 as determined by ultrasound imaging according to the Breast Imaging Reporting and Data System (BI-RADS) (n=145) or pathologically confirmed as benign masses by a previous core-needle biopsy although category 4a and 4b (n = 52). Pathology, the presence of hematoma and residual tissue, as well as scar formation were assessed. We diagnosed 190 (96.5%) benign masses, 4 (2.0%) malignant masses, and 3 (1.5%) high-risk lesions. Most (176 masses, 91.2%) were excised completely as demonstrated by the follow-up ultrasound examination. Scar changes were minimal (68.7%) or moderate (31.3%), with regression in 53%. US-guided excision using vacuum-assisted core biopsy is effective for the removal of benign breast masses. The majority of scars are minimal, with good cosmetic effect. However, subsequent excision should be done for malignant masses or phyllodes tumor because radiologic absence does not guarantee complete removal

  15. Calibration factors for determination of relativistic particle induced fission rates in natU, 235U, 232Th, natPb and 197Au foils

    International Nuclear Information System (INIS)

    Calibration factors w, for determination of fission rate in metallic foils of natU, 235U, 232Th, natPb and 197Au were determined for foils in contact with synthetic mica track detectors. Proton-induced fission at proton energies of 0.7 GeV and 1.5 GeV were used. Using our experimental results as well as those of the other authors, w for different foil-mica systems were determined. Two methods were used to calculate w, relative to the calibration factor for uranium-mica system, which has been obtained in a standard neutron field of energy 14.7 MeV. One of these methods requires the knowledge of the mean range of the fission fragments in the foils of interest and other method needs information on the values of the fission cross-sections at the required energies as well as the density of the tracks recorded in the track detectors in contact with the foil surfaces. The obtained w-values were compared with Monte Carlo calculations and good agreements were found. It is shown that a calibration factor obtained at low energy neutron induced fissions in uranium isotopes deviates only by less than 10% from those obtained at relativistic proton induced fissions.

  16. Determining conductivity and mobility values of individual components in multiphase composite Cu{sub 1.97}Ag{sub 0.03}Se

    Energy Technology Data Exchange (ETDEWEB)

    Day, Tristan W.; Brown, David R.; Snyder, G. Jeffrey, E-mail: jsnyder@caltech.edu [Department of Materials Science, California Institute of Technology, MC 309-81, Pasadena, California 91106 (United States); Zeier, Wolfgang G. [Department of Materials Science, California Institute of Technology, MC 309-81, Pasadena, California 91106 (United States); Department of Chemistry, University of Southern California, Seeley G. Mudd Bldg., 3620 McClintock Ave., Los Angeles, California 90089-1062 (United States); Melot, Brent C. [Department of Chemistry, University of Southern California, Seeley G. Mudd Bldg., 3620 McClintock Ave., Los Angeles, California 90089-1062 (United States)

    2014-10-27

    The intense interest in phase segregation in thermoelectrics as a means to reduce the lattice thermal conductivity and to modify the electronic properties from nanoscale size effects has not been met with a method for separately measuring the properties of each phase assuming a classical mixture. Here, we apply effective medium theory for measurements of the in-line and Hall resistivity of a multiphase composite, in this case Cu{sub 1.97}Ag{sub 0.03}Se. The behavior of these properties with magnetic field as analyzed by effective medium theory allows us to separate the conductivity and charge carrier mobility of each phase. This powerful technique can be used to determine the matrix properties in the presence of an unwanted impurity phase, to control each phase in an engineered composite, and to determine the maximum carrier concentration change by a given dopant, making it the first step toward a full optimization of a multiphase thermoelectric material and distinguishing nanoscale effects from those of a classical mixture.

  17. Study of the reaction mechanisms in the system20Ne + 197Au at projectile energies between 7.5 and 20 MeV/u

    International Nuclear Information System (INIS)

    In the present thesis the system 20Ne + 197Au was studied at projectile energies of 150, 220, 290 and 400 MeV. Energy and angular distributions of the projectile-like fragments, the light particles, and the fission fragments were measured. From the comparison of the fission cross section and the cross section of the projectile-like fragments it turned out that these two contributions supplement mutually to the reaction cross section which was determined by calculations by means of the optical model. Both contributions have to be assigned to mutually independent reaction types. In the second part the measured data are compared with different models (Qgg systematics, models for the optimal Q value, for projectile fragmentation and sequential emission of light particles). Thereby result following results: Evidence for the projectile fragmentation as it was described by Gelbke et al. (1977) couldn't be found, rather the sequential emission of light particles increasing with growing projectile energy. By this process at high energies about the half of the cross section of the 'fast', i.e. about with projectile velocity flying alpha particles can be explained. The other half must then result from the incomplete fusion of the projectile with the target which explains a part of the against theoretical expectations too large cross section. (orig./HSI)

  18. Percutaneous Excision of a Benign Breast Mass Using Ultrasound-guided, Vacuum-assisted Core Biopsy:A Review of 197 Cases with Long Term Follow-up

    International Nuclear Information System (INIS)

    To assess long term results of excising benign masses using ultrasound (US)-guided, vacuum-assisted core biopsy (Mammotome). We enrolled 163 patients (197 masses) receiving US guided excision using vacuum-assisted core biopsy and follow-up sonography in this retrospective study. The masses were category 3 as determined by ultrasound imaging according to the Breast Imaging Reporting and Data System (BI-RADS) (n=145) or pathologically confirmed as benign masses by a previous core-needle biopsy although category 4a and 4b (n = 52). Pathology, the presence of hematoma and residual tissue, as well as scar formation were assessed. We diagnosed 190 (96.5%) benign masses, 4 (2.0%) malignant masses, and 3 (1.5%) high-risk lesions. Most (176 masses, 91.2%) were excised completely as demonstrated by the follow-up ultrasound examination. Scar changes were minimal (68.7%) or moderate (31.3%), with regression in 53%. US-guided excision using vacuum-assisted core biopsy is effective for the removal of benign breast masses. The majority of scars are minimal, with good cosmetic effect. However, subsequent excision should be done for malignant masses or phyllodes tumor because radiologic absence does not guarantee complete removal

  19. Synthesis and characterization of multidoped lithium manganese oxide spinel LiCo0.02La0.01Mn1.97O3.98Cl0.02

    Institute of Scientific and Technical Information of China (English)

    ZHANG Na; TANG Zhi-yuan; HUANG Qing-hua; LU Xing-he

    2006-01-01

    Multidoped spinel LiCo0.02La0.01Mn1.97O3.98Cl0.02 was synthesized by solid-state method. The structure and electrochemical performance were characterized by XRD, ESEM, particle size distribution analysis, specific surface area testing, galvanostatic cycling and electrochemical impedance spectroscopy. The XRD analysis shows that the sample exhibits pure spinel phase. The substitution of Co, La for Mn and Cl for O in the LiMn2O4 stabilizes the structural integrity of the spinel host, which in turn increases the electrochemical cycleability. The electrochemical experiments confirm that the capacity of the LiCo0.02La0.01Mn1.97O3.98Cl0.02electrode maintains 90.6% of the initial capacity at 180th cycle.

  20. Study on Safety and Immunogenicity of Haemophilus Influenzae Type b Conjugate Vaccine (Polyribosylribitol Phosphate-Cross Reacting Material 197) among the Children Aged 13-59 Months%b型流行性感冒嗜血杆菌结合疫苗(磷酸多核糖基核糖醇-白喉毒素突变体197)在13~59月龄儿童中的安全性和免疫原性研究

    Institute of Scientific and Technical Information of China (English)

    陈玉国; 李军; 刘金凤; 孟华伟; 谢艳华; 李秀华; 朱永贵; 马景臣; 赵玉良

    2013-01-01

    Objective To evaluate the safety and immunogenicity of a Haemophilus influenzae type b (Hib) conjugated vaccine (polyribosylribitol phosphate-cross reacting material 197,PRP-CRM197)among the toddlers and young children from13 months to 59 months.Methods 728 children from 13 to 59 months which were divided into two groups randomly.The trial group (N=365)were administered one dose of the PRP-CRM197 by intramuscular injection,the control group (N=363)were administered one dose of the PRP-T (tetanus toxoid).Both the local and systemic adverse reactions were observed during the first 7 days after vaccination.The Adverse Events Following Immunization (AEFIs) and any medicine used were reported within 30 days after vaccination.Blood samples were collected before vaccination and 30 days after the vaccination.Levels of antibody to PRP (Anti-PRP) were measured by enzymelinked immunosorbant assay (EIISA).Results 99% and 100% of subjects receiving PRP-CRM197 and PRP-T achieved Short term (≥ 0.15μg/ml) and long-term (≥ 1.0μg/ml) seroprotective Anti-PRP levels respectively,were Both formulations had similar safety profiles.Conclusion One dose of PRP-CRM197 has good tolerance and the immunogenicity which is similar to one dose of PRP-T,which provide seroprotective antibody titres against Hib infection to 99% subjects.PRP-CRM197 is suitable for routine immunization against Haemophilus Influenzae Type b disease for children among the age of 13-59 months.Clinical Trial Registration State Food and Drug Administration Approval Number:2008 L03160.%目的 评价b型流行性感冒嗜血杆菌结合疫苗(Haemophilus Influenzae Type b Conjugate Vaccine,Hib)[磷酸多核糖基核糖醇-白喉毒素突变体197(Polyribosylribitol Phosphate-Cross Reacting Material 197,PRP-CRM197)]在13~59月龄儿童中使用的安全性和免疫原性.方法 选择728名13~59月龄儿童,按1∶1的比例随机分配到试验组(365人)和对照组(363人),分

  1. Measurement of the (n,2n) cross sections for 89Y, 93Nb, 103Rh, 107Ag, 169Tm, 175Lu and 197Au at 14.1 and 14.8 MeV incident neutron energies

    International Nuclear Information System (INIS)

    The (n,2n) cross sections for 89Y, 93Nb, 103Rh, 107Ag, 169Tm, 175Lu and 197Au have been measured at 14.1 and 14.8 MeV incident neutron energies. The samples were irradiated at the 14 MeV neutron generator of C.E. VALDUC. 27Al(n,α)24Na cross section was used for standard. The cross sections were obtained with an accuracy of about 5%

  2. Validation of absolute axial neutron flux distribution calculations with MCNP with 197Au(n,γ)198Au reaction rate distribution measurements at the JSI TRIGA Mark II reactor.

    Science.gov (United States)

    Radulović, Vladimir; Štancar, Žiga; Snoj, Luka; Trkov, Andrej

    2014-02-01

    The calculation of axial neutron flux distributions with the MCNP code at the JSI TRIGA Mark II reactor has been validated with experimental measurements of the (197)Au(n,γ)(198)Au reaction rate. The calculated absolute reaction rate values, scaled according to the reactor power and corrected for the flux redistribution effect, are in good agreement with the experimental results. The effect of different cross-section libraries on the calculations has been investigated and shown to be minor. PMID:24316530

  3. Analysis of chemical composition of urinary calculi%南疆地区197例患者泌尿系结石成份分析

    Institute of Scientific and Technical Information of China (English)

    黄睿; 孟晓辉

    2012-01-01

    Objective To analyze the composition of urinary stone and investigate its prevention method. Methods 197 cases with urinary stones related to melamine milk were collected. The qualitative determination was performed by infrared spectroscopy automatic analyzer. Results 8 components in urinary stone were detected. 98 cases (51. 8%) were pure type, while 91 cases (48. 1%) were the mixed type. 38% of the calculi were calcium-containing stones. 34. 8% of the stones were non-calcium- containing. The rest were mixed. The percentage of various stone compositions were as follows: urinary ammonium calculi was 44. 9% (48 cases) , calcium oxalate monohydrate (COM) + urinary ammonium calculi was 28. 5% (28 cases), calcium lactate was 26. 8% (24cases). The clinical features of three kinds of urinary stones were Uygur nationality cases accounted for 67% , 71% male and 52. 8% was infants under 3 years old. The proportion of patients with kidney stones was 61. 4%. The urinary stones ammonium was the main ingredient, while a certain percentage of patients with calcium oxalate stones. Conclusion Combination of case history, inferred that incidence of kidney stones in Uighur nationality is higher than that of Han nationality significantly. It is inferred that urinary ammonium stones could be easily induced by melamine milk powder.%目的 探讨南疆地区泌尿系结石患者的结石成份及防治方法.方法 搜集新疆南部地区与三聚氰胺奶粉相关尿路结石病例197例.手术取石,采用红外光谱自动分析仪定性检测.结果 除外8例资料不全,纳入统计189例,共检测出8种成份,其中单纯成份结石51.85%(98例),混合成份结石48.15%(91例).按结石主要成份分为含钙结石72例(38%),非钙结石66例(34.8%),混合型结石51例(28%).各种成份的结石病例的构成比从高到低依次为尿酸铵结石44例(44.9%),一水草酸钙和尿酸铵28例(28.5%),一水草酸钙24例(26.3%).三种结石的临床特点是67

  4. Dual binding mode of antithyroid drug methimazole to mammalian heme peroxidases - structural determination of the lactoperoxidase-methimazole complex at 1.97 Å resolution.

    Science.gov (United States)

    Singh, Rashmi Prabha; Singh, Avinash; Sirohi, Harsh Vardhan; Singh, Amit Kumar; Kaur, Punit; Sharma, Sujata; Singh, Tej P

    2016-07-01

    Lactoperoxidase (LPO, EC 1.11.1.7) is a member of the mammalian heme peroxidase family which also includes thyroid peroxidase (TPO). These two enzymes have a sequence homology of 76%. The structure of LPO is known but not that of TPO. In order to determine the mode of binding of antithyroid drugs to thyroid peroxidase, we have determined the crystal structure of LPO complexed with an antithyroid drug, methimazole (MMZ) at 1.97 Å resolution. LPO was isolated from caprine colostrum, purified to homogeneity and crystallized with 20% poly(ethylene glycol)-3350. Crystals of LPO were soaked in a reservoir solution containing MMZ. The structure determination showed the presence of two crystallographically independent molecules in the asymmetric unit. Both molecules contained one molecule of MMZ, but with different orientations. MMZ was held tightly between the heme moiety on one side and the hydrophobic parts of the side chains of Arg255, Glu258, and Leu262 on the opposite side. The back of the cleft contained the side chains of Gln105 and His109 which also interacted with MMZ. In both orientations, MMZ had identical buried areas and formed a similar number of interactions. It appears that the molecules of MMZ can enter the substrate-binding channel of LPO in two opposite orientations. But once they reach the distal heme pocket, their orientations are frozen due to equally tight packing of MMZ in both orientations. This is a novel example of an inhibitor binding to an enzyme with two orientations at the same site with nearly equal occupancies. PMID:27398304

  5. Coherent phenomena of charge separation in reaction centers of LL131H and LL131H/LM160H/FM197H mutants of Rhodobacter sphaeroides.

    Science.gov (United States)

    Yakovlev, A G; Vasilieva, L G; Shkuropatov, A Y; Shuvalov, V A

    2011-10-01

    Primary stage of charge separation and transfer of charges was studied in reaction centers (RCs) of point mutants LL131H and LL131H/LM160H/FM197H of the purple bacterium Rhodobacter sphaeroides by differential absorption spectroscopy with temporal resolution of 18 fsec at 90 K. Difference absorption spectra measured at 0-4 psec delays after excitation of dimer P at 870 nm with 30 fsec step were obtained in the spectral range of 935-1060 nm. It was found that a decay of P* due to charge separation is considerably slower in the mutant RCs in comparison with native RCs of Rba. sphaeroides. Coherent oscillations were found in the kinetics of stimulated emission of the P* state at 940 nm. Fourier analysis of the oscillations revealed a set of characteristic bands in the frequency range of 20-500 cm(-1). The most intense band has the frequency of ~130 cm(-1) in RCs of mutant LL131H and in native RCs and the frequency of ~100 cm(-1) in RCs of the triple mutant. It was found that an absorption band of bacteriochlorophyll anion B(A)(-) which is registered in the difference absorption spectra of native RCs at 1020 nm is absent in the analogous spectra of the mutants. The results are analyzed in terms of the participation of the B(A) molecule in the primary electron transfer in the presence of a nuclear wave packet moving along the inharmonic surface of P* potential energy. PMID:22098236

  6. Results from two years of Matricaria inodora L. and Matricaria chamomilla L. monitoring (2012 + 2013 – greenhouse efficacy trials with Tribenuron and Florasulam and ALS target site resistance test at Pro 197 and Thr 574

    Directory of Open Access Journals (Sweden)

    Tiede, Anke

    2014-02-01

    Full Text Available The first ALS resistant Matricaria chamomilla (MATCH biotype was found in 2006 in Schleswig Holstein in Witzwort (SCHLEICH-SAIDFAR et al., 2011. Since 2006 ALS resistant Matricaria chamomilla and Matricaria inodora (MATIN were found at other locations near the North Sea coastline in Schleswig-Holstein and Lower Saxony (ULBER et al., 2012. As there were more and more cases of reduced efficacy of sulfonylureas on mayweed, Dow AgroSciences decided in 2012 and 2013 to test MATCH and MATIN samples in Germany. In 2012 seed samples collected by Dow AgroSciences were planted in greenhouse environment and treated with tribenuron or florasulam. As a second step plants were checked for mutations of the ALS gene at positions Pro 197 and Thr 574 via Pyrosequencing. In Europe there is no known case of metabolic ALS-resistance (ULBER et al., 2012. It was found that mayweed plants showed a mutation at position Pro 197 only. In 2013 leaf samples were taken only and investigated for mutations of ALS position Pro 197 and Thr 574.

  7. Intermittency in 197Au fragmentation

    International Nuclear Information System (INIS)

    The concept of factorial moments was applied to an analysis of the dynamical fluctuations in the charge distributions of the fragments emitted from gold nuclei with energies 10.6 and < 1.0 GeV/n interacting with emulsion nuclei. Clear evidence for intermittent fluctuations has been found in an analysis using all the particles released from the gold projectile, with a stronger effect observed below 1 GeV/n than at 10.6 GeV/n. For the full data sets, however, the intermittency effect was found to be very sensitive to the singly charged particles, and neglecting these particles strongly reduces the intermittency signal. When the analysis is restricted to the multiply charged fragments, an intermittency effect is revealed only for multifragmentation events, although one that is enhanced as compared to the analysis of all, singly and multiply charged, particles. The properties of the anomalous fractal dimensions suggest a sequential decay mechanism, rather than the existence of possible critical behaviour in the process of nuclear fragmentation. The likely influence of the charge conservation effects and the finite size of decaying systems on the observed intermittency signals was pointed out. (author). 37 refs, 9 figs, 5 tabs

  8. Network of vascular diseases, death and biochemical characteristics in a set of 4,197 patients with type 1 diabetes (The FinnDiane Study

    Directory of Open Access Journals (Sweden)

    Wadén Johan

    2009-10-01

    Full Text Available Background Cardiovascular disease is the main cause of premature death in patients with type 1 diabetes. Patients with diabetic kidney disease have an increased risk of heart attack or stroke. Accurate knowledge of the complex inter-dependencies between the risk factors is critical for pinpointing the best targets for research and treatment. Therefore, the aim of this study was to describe the association patterns between clinical and biochemical features of diabetic complications. Methods Medical records and serum and urine samples of 4,197 patients with type 1 diabetes were collected from health care centers in Finland. At baseline, the mean diabetes duration was 22 years, 52% were male, 23% had kidney disease (urine albumin excretion over 300 mg/24 h or end-stage renal disease and 8% had a history of macrovascular events. All-cause mortality was evaluated after an average of 6.5 years of follow-up (25,714 patient years. The dataset comprised 28 clinical and 25 biochemical variables that were regarded as the nodes of a network to assess their mutual relationships. Results The networks contained cliques that were densely inter-connected (r > 0.6, including cliques for high-density lipoprotein (HDL markers, for triglycerides and cholesterol, for urinary excretion and for indices of body mass. The links between the cliques showed biologically relevant interactions: an inverse relationship between HDL cholesterol and the triglyceride clique (r P -16, a connection between triglycerides and body mass via C-reactive protein (r > 0.3, P -16 and intermediate-density cholesterol as the connector between lipoprotein metabolism and albuminuria (r > 0.3, P -16. Aging and macrovascular disease were linked to death via working ability and retinopathy. Diabetic kidney disease, serum creatinine and potassium, retinopathy and blood pressure were inter-connected. Blood pressure correlations indicated accelerated vascular aging in individuals with kidney disease

  9. The IL-17A G-197A and IL-17F 7488T/C polymorphisms are associated with increased risk of cancer in Asians: a meta-analysis

    Directory of Open Access Journals (Sweden)

    Wang H

    2015-09-01

    Full Text Available Huifen Wang,1,* Yanli Zhang,1,* Zhaolan Liu,2 Yin Zhang,3 Hongchuan Zhao,1 Shiyu Du1 1Department of Gastroenterology, China-Japan Friendship Hospital, 2Center for Evidence-Based Chinese Medicine, Beijing University of Chinese Medicine, 3Institute of Basic Research in Clinical Medicine, China Academy of Chinese Medical Sciences, Beijing, People’s Republic of China *These authors contributed equally to this work Background: Interleukin-17 (IL-17 is a family of emerged pro-inflammatory cytokines. The IL-17A and IL-17F are two important members of IL-17 family. Previous studies have shown that the functional IL-17A G-197A and IL-17F 7488T/C polymorphisms may contribute to susceptibility to cancer but the results were inconclusive. This meta-analysis was performed to determine the exact association between IL-17 polymorphisms and cancer risk.Methods: Online databases were searched to identify eligible case–control studies. Pooled odds ratios (ORs and confidence intervals (CIs were calculated by fixed-effect models or random-effect models. Publication bias was detected by Egger’s test and Begg’s test.Results: Nine eligible case–control studies of IL-17A G-197A and seven studies of IL-17F 7488T/C, including 3,181 cases and 4,005 controls, were identified. Pooled analysis suggested the variant IL-17A-197A allele was associated with increased risk cancer (GA/AA vs GG, OR =1.27, 95% CI: 1.15, 1.41, Pheterogeneity =0.374; and A vs G, OR =1.30, 95% CI: 1.17, 1.45, Pheterogeneity =0.021. For IL-17F 7488T/C, the homozygote 7488CC genotype significantly increased risk of cancer (CC vs TC/TT, OR =1.36, 95% CI: 0.97, 1.91, Pheterogeneity =0.875; and CC vs TT, OR =1.39, 95% CI: 1.03, 1.88, Pheterogeneity =0.979, especially for gastric cancer.Conclusion: The variant IL-17A-197A allele and IL-17F 7488CC genotype were associated with increased risk of cancer, especially for gastric cancer. Keywords: interleukin-17, gene polymorphism, gastric cancer, risk

  10. Process for producing astatine-211 for radiopharmaceutical use

    International Nuclear Information System (INIS)

    A one-step chemical manipulation is described in combination with a distillation and collection process for producing At-211 comprising; a. providing a target of irradiated Bismuth coated to a predetermined thickness of a backing member, b. providing a vapor-producing still operably connected with a condenser that has a water cooled condensate collector formed of a dry silica gel mesh maintained at a temperature above the freezing point of water, and providing an effluent gas filter that is operably connected to receive effluent gas from the condenser, c. heating the target in the still at a temperature in the range of about 6300-6800C for a time period in the range of 50 to 80 minutes, to evole At-211 vapor from the target, c. providing a dry carrier gas having an oxygen concentration that is sufficient to form Bi/sub 2/O/sub 3/ thereby to essentially preclude vaporization of Bi metal, passing the carrier gas through the still to carry the At-211 vapor to the condenser, and to carry effluent from the condenser to the effluent gas filter, e. eluting At-211 from the condensate collector of the condenser with a controlled volume of eluent containing predetermined solvents that are compatible with a given desired radiopharmaceutical procedure, and f. collecting the At-211 in the controlled volume of eluent for use in the given radiopharmaceutical procedure

  11. 外固定架加克氏针固定治疗桡骨远端粉碎性骨折197例临床分析

    Institute of Scientific and Technical Information of China (English)

    崔裕伟

    2014-01-01

    目的:探讨外固定架加克氏针固定治疗桡骨远端粉碎性骨折的临床疗效。方法:回顾性分析我院2000年3月~2011年6月施行外固定架加克氏针固定治疗桡骨远端粉碎性骨折197例患者的临床资料。结果:本组197例均获得随访3个月~2年,平均6个月。桡骨骨折全部愈合,平均愈合时间6.1周。腕关节功能按Dient评定标准评定,优168例,良22例,可7例。结论:外固定架加克氏针固定治疗桡骨远端粉碎性骨折方法简单、适用范围广,不需二次手术,疗效显著,可临床推广。

  12. 4{pi} studies of the 1.8{endash}4.8 GeV {sup 3}He+{sup nat}Ag, {sup 197}Au reactions. I. Energy deposition

    Energy Technology Data Exchange (ETDEWEB)

    Morley, K.B.; Kwiatkowski, K.; Bracken, D.S.; Renshaw Foxford, E.; Viola, V.E.; Woo, L.W.; Yoder, N.R. [Departments of Chemistry and Physics and Indiana University Cyclotron Facility, Indiana University, Bloomington, Indiana 47405 (United States); Legrain, R.; Pollacco, E.C.; Volant, C. [Commissariat a l`Energie Atomique, DAPNIA Service de Physique Nucleaire, C.E. Saclay, 91191 Gir-sur-Yvette Cedex (France); Korteling, R.G. [Department of Chemistry, Simon Fraser University, Burnaby, British Columbia (Canada); Breuer, H. [University of Maryland, College Park, Maryland 20742 (United States); Brzychczyk, J. [Institute of Physics, Jagiellonian University, 30-059 Krakow (Poland)

    1996-08-01

    The Indiana Silicon Sphere 4{pi} detector has been used to measure light-charged particles and intermediate-mass fragments (IMFs) emitted in the 18{endash}4.8 GeV {sup 3}He+{sup nat}Ag, {sup 197}Au reactions. Ejectile multiplicity and total event kinetic energy distributions scale systematically with projectile energy and target mass, except for the {sup nat}Ag target at 3.6 and 4.8 GeV. For this system, a saturation in deposition energy is indicated by the data, suggesting the upper projectile energy for stopping has been reached. Maximum deposition energies of {approximately}950 MeV for the {sup nat}Ag target and {approximately}1600 MeV for the {sup 197}Au target are inferred from the data. The results also demonstrate the importance of accounting for fast cascade processes in defining the excitation energy of the targetlike residue. Correlations between various observables and the average IMF multiplicity indicate that the total thermal energy and total observed charge provide useful gauges of the excitation energy of the fragmenting system. Comparison of the experimental distributions with intranuclear cascade predictions shows qualitative agreement. {copyright} {ital 1996 The American Physical Society.}

  13. Thermal neutron calibration of a tritium extraction facility using the 6Li(n,t)4He/197Au(n,γ)198Au cross section ratio for standardization

    International Nuclear Information System (INIS)

    Absolute tritium activities in a neutron-activated metallic lithium samples have been measured by liquid scintillation methods to provide data needed for the determination of capture-to-fission ratios in fast breeder reactor spectra and for recent measurements of the 7Li(n,n't)4He cross section. The tritium extraction facility used for all these experiments has now been calibrated by measuring the 6Li(n,t)4He/197Au/n,γ)198Au activity ratio for thermal neutrons and comparing the result with the well-known cross sections. The calculated-to-measured activity ratio was found to be 1.033 +- 0.018. 2 figures, 20 tables

  14. 4{pi} studies of the 1.8{endash}4.8 GeV {sup 3}He+{sup nat}Ag, {sup 197}Au reactions. II. Multifragmentation

    Energy Technology Data Exchange (ETDEWEB)

    Renshaw Foxford, E.; Kwiatkowski, K.; Bracken, D.S.; Morley, K.B.; Viola, V.E.; Yoder, N.R. [Departments of Chemistry and Physics and Indiana University Cyclotron Facility, Indiana University, Bloomington, Indiana 47405 (United States); Volant, C.; Pollacco, E.C.; Legrain, R. [Commissariat a l`Energie Atomique, DAPNIA Service de Physique Nucleaire, C. E. Saclay, 91191 Gif-sur-Yvette, Cedex (France); Korteling, R.G. [Department of Chemistry, Simon Fraser University, Burnaby, British Columbia (Canada); Friedman, W.A. [Department of Physics, University of Wisconsin, Madison, Wisconsin 53706 (United States); Brzychczyk, J. [Institute of Physics, Jagiellonian University, 30-059 Krakow (Poland); Breuer, H. [Department of Physics, University of Maryland, College Park, Maryland 20742 (United States)

    1996-08-01

    Multifragmentation of {sup nat}Ag and {sup 197}Au nuclei induced by 1.8{endash}4.8 GeV {sup 3}He ions has been studied with the Indiana Silicon Sphere 4{pi} detector array. Rapidity, moving source, and sphericity-coplanarity analyses are consistent with near-simultaneous emission from a source in approximate kinetic equilibrium. For the most dissipative collisions, the spectral peaks are broadened and shifted to very low energies, indicative of emission from an extended nuclear system with {rho}/{rho}{sub 0}{approximately}1/3. Predictions of an intranuclear cascade/expanding, emitting source model compare well with experimental multiplicity distributions and the evolution of fragment spectral shapes. {copyright} {ital 1996 The American Physical Society.}

  15. Measurement of Fragment Production Cross Sections in the $^{12}$C+$^{12}$C and $^{12}$C+$^{197}$Au Reactions at 62 $A$ MeV for Hadrontherapy and Space Radiation Protection

    CERN Document Server

    Tropea, S; Agodi, C; Blancato, A A; Bondì, M; Cappuzzello, F; Carbone, D; Cavallaro, M; Cirrone, G A P; Cuttone, G; Giacoppo, F; Nicolosi, D; Pandola, L; Raciti, G; Rapisarda, E; Romano, F; Sardina, D; Scuderi, V; Sfienti, C

    2014-01-01

    Over the last twenty years, there has been a renewed interest in nuclear fragmentation studies for both hadrontherapy applications and space radiation protection. In both fields, fragmentation cross sections are needed to predict the effects of the ions nuclear interactions within the patient’s and the astronaut’s body. Indeed, the Monte Carlo codes used in planning tumor treatments and space missions must be tuned and validated by experimental data. However, only a limited set of fragmentation cross sections are available in literature, especially at Fermi energies. Therefore, we have studied the production of secondary fragments in the 12 C+ 12 C and 12 C+ 197 Au reactions at 62 A MeV. In this work, the measured 4 He cross sections angular distributions at four selected angles are presented and compared.

  16. Absolute NMR shielding scales and nuclear spin–rotation constants in 175LuX and 197AuX (X = 19F, 35Cl, 79Br and 127I)

    International Nuclear Information System (INIS)

    We present nuclear spin–rotation constants, absolute nuclear magnetic resonance (NMR) shielding constants, and shielding spans of all the nuclei in 175LuX and 197AuX (X = 19F, 35Cl, 79Br, 127I), calculated using coupled-cluster singles-and-doubles with a perturbative triples (CCSD(T)) correction theory, four-component relativistic density functional theory (relativistic DFT), and non-relativistic DFT. The total nuclear spin–rotation constants determined by adding the relativistic corrections obtained from DFT calculations to the CCSD(T) values are in general in agreement with available experimental data, indicating that the computational approach followed in this study allows us to predict reliable results for the unknown spin–rotation constants in these molecules. The total NMR absolute shielding constants are determined for all the nuclei following the same approach as that applied for the nuclear spin–rotation constants. In most of the molecules, relativistic effects significantly change the computed shielding constants, demonstrating that straightforward application of the non-relativistic formula relating the electronic contribution to the nuclear spin–rotation constants and the paramagnetic contribution to the shielding constants does not yield correct results. We also analyze the origin of the unusually large absolute shielding constant and its relativistic correction of gold in AuF compared to the other gold monohalides

  17. Formation of tetragonal or monoclinic ZrO2 coatings by oxygen plasma treatment of Zr74.7Cu19.7Nb5.6 glassy thin films

    International Nuclear Information System (INIS)

    The authors report on the production of stable nanostructured tetragonal and/or monoclinic ZrO2 nanopillars achieved by means of oxygen plasma treatment of ternary Zr74.7Cu19.7Nb5.6 glassy films. The Zr-based metallic glass thin films were successfully deposited by magnetron sputtering and subsequently subjected to oxygen plasma for various exposure times. The compositions of the oxidized films were determined by Auger electron spectroscopy and X-Ray photoelectron spectroscopy depth profiling while the surface morphology was evaluated by means of atomic force microscopy and scanning electron microscopy. X-Ray diffraction was used for the structural analysis. Our results show that, depending on the length of time of oxygen plasma treatment, tetragonal and/or monoclinic ZrO2 films can be formed, the surface morphology of which exhibit nanopillar structures with an increased effective surface. These findings provide an easy and efficient way for growing ZrO2 coatings with a predefined structure suitable for protective and possibly for catalytic applications.

  18. Effects of in-medium cross-sections and optical potential on thermal-source formation in p+197Au reactions at 6.2-14.6 GeV/c

    CERN Document Server

    Turbide, S; Danielewicz, P; Viola, V E; Roy, R; Kwiatkowski, K; Hsi, W C; Wang, G; Lefort, T; Bracken, D S; Breuer, H; Cornell, E; Gimeno-Nogues, F; Ginger, D S; Gushue, S; Huang, R; Korteling, R; Lynch, W G; Morley, K B; Ramakrishnan, E; Remsberg, L P; Rowland, D; Tsang, M B; Xi, H; Yennello, S J

    2004-01-01

    Effects of in-medium cross-sections and of optical potential on pre-equilibrium emission and on formation of a thermal source are investigated by comparing the results of transport simulations with experimental results from the p+{197}Au reaction at 6.2-14.6 GeV/c. The employed transport model includes light composite-particle production and allows for inclusion of in-medium particle-particle cross-section reduction and of momentum dependence in the particle optical-potentials. Compared to the past, the model incorporates improved parameterizations of elementary high-energy processes. The simulations indicate that the majority of energy deposition occurs during the first ~25 fm/c of a reaction. This is followed by a pre-equilibrium emission and readjustment of system density and momentum distribution toward an equilibrated system. Good agreement with data, on the d/p and t/p yield ratios and on the residue mass and charge numbers, is obtained at the time of ~ 65 fm/c from the start of a reaction, provided red...

  19. Estimation of double differential angle-dependent neutron production cross sections from tritons on 197Au at energies from 5.97 to 19.14 MeV

    CERN Document Server

    Drosg, Manfred

    2016-01-01

    Estimated cross sections for neutron production from triton bombardment of gold are deduced from measurements of triton interactions with gas targets that used gold as a triton beam stop material. Differential cross sections for production of neutrons from 5.97-, 7.47-, 10.45-, 16.41- and 19.14-MeV tritons on 197Au were evaluated. Corrections for the neutron interaction in gold, in the target structure and in the air of the flight path were obtained by means of a Monte Carlo technique. Uncorrelated scale uncertainties range from 24 to 41% whereas those of double differential cross sections range from 0.2 to 5%. Based on these cross section data, calculation of neutron yield at 0o from fully stopped tritons at 20.22 MeV agree with an independent measurement. Least-squares fits with a gamma distribution model indicate an anisotropy in the high energy portion of the neutron spectra. Legendre polynomial fits of differential cross sections are reported. All neutron cross section data are made available through the...

  20. 46 CFR 197.204 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... Institute “Code for Pressure Piping, Power Piping.” ASME Code means the American Society of Mechanical... diving operations. Bottom time means the total elapsed time measured in minutes from the time the diver leaves the surface in descent to the time to the next whole minute that the diver begins...

  1. Burrowing Owl - Palo Verde Valley [ds197

    Data.gov (United States)

    California Department of Resources — These burrowing owl observations were collected during the spring and early summer of 1976 in the Palo Verde Valley, eastern Riverside County, California. This is...

  2. 46 CFR 197.560 - Medical surveillance.

    Science.gov (United States)

    2010-10-01

    ... current employment. (ii) A complete physical examination. (iii) A complete blood count, including a... exposure to potential marrow toxins, changes in medicinal drug use, and the appearance of physical signs..., if any. (5) Records of all previous employment-related medical examinations of the affected...

  3. 46 CFR 197.570 - Recordkeeping.

    Science.gov (United States)

    2010-10-01

    ... classification of each person monitored and of all other persons whose exposure the monitoring is intended to... toxin. (c) Availability of records. (1) All records required to be maintained by this section must...

  4. 46 CFR 197.346 - Diver's equipment.

    Science.gov (United States)

    2010-10-01

    ... reserve cylinder connected and ready for use; (2) A face mask; (3) An inflatable floatation device; (4) A... assembly capable of quick release; (3) A mask group consisting of a lightweight mask and associated...

  5. Canadian Cancer Trials Group IND197: a phase II study of foretinib in patients with estrogen receptor, progesterone receptor, and human epidermal growth factor receptor 2-negative recurrent or metastatic breast cancer.

    Science.gov (United States)

    Rayson, Daniel; Lupichuk, Sasha; Potvin, Kylea; Dent, Susan; Shenkier, Tamara; Dhesy-Thind, Sukhbinder; Ellard, Susan L; Prady, Catherine; Salim, Muhammad; Farmer, Patricia; Allo, Ghasson; Tsao, Ming-Sound; Allan, Alison; Ludkovski, Olga; Bonomi, Maria; Tu, Dongsheng; Hagerman, Linda; Goodwin, Rachel; Eisenhauer, Elizabeth; Bradbury, Penelope

    2016-05-01

    In murine models, overexpression of the MET receptor transgene induces tumors with human basal gene expression characteristics supporting MET inhibition as a treatment strategy for triple-negative breast cancer (TNBC). Foretinib is an oral multi-kinase inhibitor of MET, RON, AXL, TIE-2, and VEGF receptors with anti-tumor activity in advanced HCC and papillary renal cell cancer. Patients with centrally reviewed primary TNBC and 0-1 prior regimens for metastatic disease received daily foretinib 60 mg po in a 2-stage single-arm trial. Primary endpoints were objective response and early progression rates per RECIST 1.1. In stage 2, correlative studies of MET, PTEN, EGFR, and p53 on archival and fresh tumor specimens were performed along with enumeration of CTCs. 45 patients were enrolled with 37 patients having response evaluable and centrally confirmed primary TNBC (cTNBC). There were 2 partial responses (ITT 4.7 % response evaluable cTNBC 5.4 %) with a median duration of 4.4 months (range 3.7-5 m) and 15 patients had stable disease (ITT 33 %, response evaluable cTNBC 40.5 %) with a median duration of 5.4 months (range 2.3-9.7 m). The most common toxicities (all grades/grade 3) were nausea (64/4 %), fatigue (60/4 %), hypertension (58/49 %), and diarrhea (40/7 %). Six serious adverse events were considered possibly related to foretinib and 4 patients went off study due to adverse events. There was no correlation between MET positivity and response nor between response and PTEN, EGFR, p53, or MET expression in CTCs. Although CCTG IND 197 did not meet its primary endpoint, the observation of a clinical benefit rate of 46 % in this cTNBC population suggests that foretinib may have clinical activity as a single, non-cytotoxic agent in TNBC (ClinicalTrials.gov number, NCT01147484). PMID:27116183

  6. The expression profile of Dopamine D2 receptor, MGMT and VEGF in different histological subtypes of pituitary adenomas: a study of 197 cases and indications for the medical therapy

    Science.gov (United States)

    2014-01-01

    Background To study the expression of D2R, MGMT and VEGF for clinical significance in pituitary adenomas, and to predict the potential curative medical therapy of dopamine agonists, temozolomide and bevacizumab on pituitary adenomas. Methods Immunohistochemistry and western blot were performed to detect the expression of expression of D2R, MGMT and VEGF in pituitary adenoma tissue samples. The ratio of high expression of D2R, MGMT or VEGF in different subtypes of PA was compared by the use of chi-squared tests. The relationships between D2R, MGMT and VEGF expression were assessed by the Spearman rank correlation test. The association between their expression and clinical parameters was analyzed using a chi-squared test, or Fisher's exact probability test when appropriate. Results The data showed that in 197 different histological subtypes of pituitary adenomas (PAs), 64.9% of them were D2R high expression, 86.3% were MGMT low expression and 58.9% were VEGF high expression. D2R high expression existed more frequently in PRL- and GH- secreting PAs. MGMT low expression existed in all PA subtypes. VEGF high expression existed more frequently in PRL, ACTH, FSH secreting and non-functioning PAs. The data of western blot also support the results. Spearman's rank correlation analysis showed that expression of MGMT was positively associated with D2R (r = 0.154, P = 0.031) and VEGF (r = 0.161, P = 0.024) in PAs, but no correlation was showed between D2R and VEGF expression (r = −0.025, P = 0.725 > 0.05). The association between their expression and clinical parameters was analyzed using a chi-squared test, or Fisher's exact probability test when appropriate, but the result showed no significant association. Conclusions PRL-and GH-secreting PAs exist high expression of D2R, responding to dopamine agonists; Most PAs exist low expression of MGMT and high expression of VEGF, TMZ or bevacizumab treatment could be applied under the premise of

  7. Measurement of isomeric yield ratios of 197m,gPt and 190m2,g+m1Ir from the 198Pt(γ,n) and natPt(γ,xn1p) reactions induced by 55-, 60-, and 65-MeV bremsstrahlung

    International Nuclear Information System (INIS)

    We have measured the isomeric yield ratios of 197m,gPt from the 198Pt(γ,n) reaction and 190m2,g+m1Ir from the natPt(γ,xn1p) reaction, induced with the bremsstrahlung end-point energies of 55-, 60-, and 65-MeV. The measurements were carried out by the activation method in combination with the direct γ-spectrometry. The experiments were performed at the 100 MeV electron linac of the Pohang Accelerator Laboratory (PAL). The obtained results at 55-, 60- and 65-MeV for the 197m,gPt from the 198Pt(γ,n) reaction are 0.166 ± 0.012, 0.174 ± 0.011, and 0.175 ± 0.011, whereas for the 190m2,g+m1Ir from the natPt(γ,xn1p) reaction are 0.072 ± 0.006, 0.084 ± 0.006 and 0.087 ± 0.006, respectively. The present results are measured for the first time over the investigated energy range. The present data are compared with the similar literature data at lower energy to examine the role of excitation energy

  8. Measurement of isomeric yield ratios of {sup 197m,g}Pt and {sup 190m2,g+m1}Ir from the {sup 198}Pt(γ,n) and {sup nat}Pt(γ,xn1p) reactions induced by 55-, 60-, and 65-MeV bremsstrahlung

    Energy Technology Data Exchange (ETDEWEB)

    Kye, Yong-Uk; Shin, Sung-Gyun [Department of Advanced Nuclear Engineering, Pohang University of Science and Technology, Pohang 790-784 (Korea, Republic of); Cho, Moo-Hyun [Department of Advanced Nuclear Engineering, Pohang University of Science and Technology, Pohang 790-784 (Korea, Republic of); Pohang Accelerator Laboratory, Pohang University of Science and Technology, Pohang 790-784 (Korea, Republic of); Kim, Kyung Sook; Namkung, Won [Pohang Accelerator Laboratory, Pohang University of Science and Technology, Pohang 790-784 (Korea, Republic of); Kim, Guinyun, E-mail: gnkim@knu.ac.kr [Department of Physics, Kyungpook National University, Daegu 702-701 (Korea, Republic of); Kim, Kwangsoo [Department of Physics, Kyungpook National University, Daegu 702-701 (Korea, Republic of); Kang, Yeong-Rok; Lee, Man-Woo [Research Center, Dongnam Institute of Radiological and Medical Sciences, Busan 619-953 (Korea, Republic of); Yang, Sung-Chul [Department of Physics, Kyungpook National University, Daegu 702-701 (Korea, Republic of); Korea Atomic Energy Research Institute, P.O. Box 105, Yusong, Daejon 305-600 (Korea, Republic of); Nguyen, Van Do; Pham, Duc Khue; Kim, Tien Thanh [Institute of Physics, Vietnam Academy of Science and Technology, 10 Dao Tan, Hanoi (Viet Nam); Naik, Haladhara [Radiochemistry Division, Bhabha Atomic Research Centre, Mumbai 400085 (India)

    2015-05-15

    We have measured the isomeric yield ratios of {sup 197m,g}Pt from the {sup 198}Pt(γ,n) reaction and {sup 190m2,g+m1}Ir from the {sup nat}Pt(γ,xn1p) reaction, induced with the bremsstrahlung end-point energies of 55-, 60-, and 65-MeV. The measurements were carried out by the activation method in combination with the direct γ-spectrometry. The experiments were performed at the 100 MeV electron linac of the Pohang Accelerator Laboratory (PAL). The obtained results at 55-, 60- and 65-MeV for the {sup 197m,g}Pt from the {sup 198}Pt(γ,n) reaction are 0.166 ± 0.012, 0.174 ± 0.011, and 0.175 ± 0.011, whereas for the {sup 190m2,g+m1}Ir from the {sup nat}Pt(γ,xn1p) reaction are 0.072 ± 0.006, 0.084 ± 0.006 and 0.087 ± 0.006, respectively. The present results are measured for the first time over the investigated energy range. The present data are compared with the similar literature data at lower energy to examine the role of excitation energy.

  9. Evaluation of a Wet Chemistry Method for Isolation of Cyclotron Produced [211At]Astatine

    Directory of Open Access Journals (Sweden)

    Shigeki Watanabe

    2013-09-01

    Full Text Available A “wet chemistry” approach for isolation of 211At from an irradiated bismuth target is described. The approach involves five steps: (1 dissolution of bismuth target in conc. HNO3; (2 removal of the HNO3 by distillation; (3 dissolution of residue in 8 M HCl; (4 extraction of 211At from 8 M HCl into DIPE; and (5 extraction of 211At from DIPE into NaOH. Results from 55 “optimized” 211At isolation runs gave recovery yields of approximately 78% after decay and attenuation corrections. An attenuation-corrected average of 26 ± 3 mCi in the target provided isolated (actual yields of 16 ± 3 mCi of 211At. A sixth step, used for purification of 211At from trace metals, was evaluated in seven runs. In those runs, isolated 211At was distilled under reductive conditions to provide an average 71 ± 8% recovery. RadioHPLC analyses of the isolated 211At solutions, both initial and after distillation, were obtained to examine the 211At species present. The primary species of 211At present was astatide, but astatate and unidentified species were also observed. Studies to determine the effect of bismuth attenuation on 211At were conducted to estimate an attenuation factor (~1.33 for adjustment of 211At readings in the bismuth target.

  10. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  11. Astatination of nanoparticles containing silver as possible carriers of 211At

    Czech Academy of Sciences Publication Activity Database

    Lebeda, Ondřej; Kučka, Jan; Hrubý, Martin; Koňák, Čestmír; Kozempel, Ján

    2006-01-01

    Roč. 64, - (2006), s. 201-206. ISSN 0969-8043 R&D Projects: GA AV ČR KJB4048302; GA AV ČR KJB4050408 Institutional research plan: CEZ:AV0Z1048901 Keywords : nanoparticles * 211AT * Atalpha particle therapy Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.924, year: 2006

  12. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  13. 27 CFR 24.197 - Production by fermentation.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Production by fermentation... fermentation. In producing special natural wine by fermentation, flavoring materials may be added before or during fermentation. Special natural wine produced by fermentation may be ameliorated in the same...

  14. 26 CFR 1.197-0 - Table of contents.

    Science.gov (United States)

    2010-04-01

    ... property. (6) Certain rights to receive tangible property or services. (7) Certain interests in patents or copyrights. (8) Interests under leases of tangible property. (i) Interest as a lessor. (ii) Interest as a... acquisitions. (9) Gain-recognition exception. (i) Applicability. (ii) Effect of exception. (iii) Time...

  15. 46 CFR 197.340 - Breathing gas supply.

    Science.gov (United States)

    2010-10-01

    ...); and (4) Be grade A, B, or C. (h) Helium used for breathing mixtures must be grades A, B, or C produced...,000 parts per million of carbon dioxide; (ii) 20 parts per million carbon monoxide; (iii) 5 milligrams.... (f) Oxygen used for breathing mixtures must— (1) Meet the requirements of Federal Specification...

  16. Slow particle multiplicity distributions for 197Au+Em interactions

    International Nuclear Information System (INIS)

    Multiplicity distributions of slow (g- and b-) particles in aurum + emulsion interactions calculated in the generalized Andersson - Otterlund - Stenlund (AOS) model are presented. 3 bumps in distributions are observed. 6 refs.; 2 figs.; 1 tab

  17. Dynamics of Populations of Planetary Systems (IAU C197)

    Science.gov (United States)

    Knezevic, Zoran; Milani, Andrea

    2005-05-01

    1. Resonances and stability of extra-solar planetary systems C. Beaugé, N. Callegari, S. Ferraz-Mello and T. A. Michtchenko; 2. Formation, migration, and stability of extrasolar planetary systems Fred C. Adams; 3. Dynamical evolution of extrasolar planetary systems Ji-Lin Zhou and Yi-Sui Sun; 4. Dynamics of planetesimals: the role of two-body relaxation Eiichiro Kokubo; 5. Fitting orbits Andrzej J. Maciejewski, Krzysztof Gozdziewski and Szymon Kozlowski; 6. The secular planetary three body problem revisited Jacques Henrard and Anne-Sophie Libert; 7. Dynamics of extrasolar systems at the 5/2 resonance: application to 47 UMa Dionyssia Psychoyos and John D. Hadjidemetriou; 8. Our solar system as model for exosolar planetary systems Rudolf Dvorak, Áron Süli and Florian Freistetter; 9. Planetary motion in double stars: the influence of the secondary Elke Pilat-Lohinger; 10. Planetary orbits in double stars: influence of the binary's orbital eccentricity Daniel Benest and Robert Gonczi; 11. Astrometric observations of 51 Peg and Gliese 623 at Pulkovo observatory with 65 cm refractor N. A. Shakht; 12. Observations of 61 Cyg at Pulkovo Denis L. Gorshanov, N. A. Shakht, A. A. Kisselev and E. V. Poliakow; 13. Formation of the solar system by instability Evgeny Griv and Michael Gedalin; 14. Behaviour of a two-planetary system on a cosmogonic time-scale Konstantin V. Kholshevnikov and Eduard D. Kuznetsov; 15. Boundaries of the habitable zone: unifying dynamics, astrophysics, and astrobiology Milan M. Cirkovic; 16. Asteroid proper elements: recent computational progress Fernando Roig and Cristian Beaugé; 17. Asteroid family classification from very large catalogues Anne Lemaitre; 18. Non-gravitational perturbations and evolution of the asteroid main belt David Vokrouhlicky, M. Broz and W. F. Bottke, D. Nesvorny and A. Morbidelli; 19. Diffusion in the asteroid belt Harry Varvoglis; 20. Accurate model for the Yarkovsky effect David Capek and David Vokrouhlicky; 21. The population of asteroids in the 2:1 mean motion resonance with Jupiter revised Miroslav Broz, D. Vokrouhlicky, F. Roig, D. Nesvorny, W. F. Bottke and A. Morbidelli; 22. On the reliability of computation of maximum Lyapunov Characteristic Exponents for asteroids Zoran Knezevic and Slobodan Ninkovic; 23. Nekhoroshev stability estimates for different models of the Trojan asteroids Christos Efthymiopoulos; 24. The role of the resonant 'stickiness' in the dynamical evolution of Jupiter family comets A. Alvarez-Canda and F. Roig; 25. Regimes of stability and scaling relations for the removal time in the asteroid belt: a simple kinetic model and numerical tests Mihailo Cubrovic; 26. Virtual asteroids and virtual impactors Andrea Milani; 27. Asteroid population models Alessandro Morbidelli; 28. Linking Very Large Telescope asteroid observations M. Granvik, K. Muinonen, J. Virtanen, M. Delbó, L. Saba, G. De Sanctis, R. Morbidelli, A. Cellino and E. Tedesco; 29. Collision orbits and phase transition for 2004 AS1 at discovery Jenni Virtanen, K. Muinonen, M. Granvik and T. Laakso; 30. The size of collision solutions in orbital elements space G. B. Valsecchi, A. Rossi, A. Milani and S. R. Chesley; 31. Very short arc orbit determination: the case of asteroid 2004 FU162 Steven R. Chesley; 32. Nonlinear impact monitoring: 2-dimensional sampling Giacomo Tommei; 33. Searching for gravity assisted trajectories to accessible near-Earth asteroids Stefan Berinde; 34. KLENOT - Near Earth and other unusual objects observations Michal Kocer, Jana Tichá and M. Tichy; 35. Transport of comets to the Inner Solar System Hans Rickman; 36. Nongravitational Accelerations on Comets Steven R. Chesley and Donald K. Yeomans; 37. Interaction of planetesimals with the giant planets and the shaping of the trans-Neptunian belt Harold F. Levison and Alessandro Morbidelli; 38. Transport of comets to the outer p

  18. New quaternary arsenide oxides with square planar coordination of gold(I) - structure, (197)Au Mössbauer spectroscopic, XANES and XPS characterization of Nd10Au3As8O10 and Sm10Au3As8O10.

    Science.gov (United States)

    Bartsch, Timo; Niehaus, Oliver; Johrendt, Dirk; Kobayashi, Yasuhiro; Seto, Makoto; Abdala, Paula M; Bartsch, Manfred; Zacharias, Helmut; Hoffmann, Rolf-Dieter; Gerke, Birgit; Rodewald, Ute Ch; Pöttgen, Rainer

    2015-03-28

    The quaternary gold(I) arsenide oxides Nd10Au3As8O10 and Sm10Au3As8O10 were synthesized in sealed quartz ampoules from the rare earth (RE) elements, their appropriate sesquioxides, arsenic, arsenic(III) oxide and finely dispersed gold at maximum annealing temperatures of 1223 K. Both structures were refined from X-ray single crystal diffractometer data at room temperature and at 90 K. Nd10Au3As8O10 and Sm10Au3As8O10 crystallize with a new structure type that derives from the BaAl4 structure through distortions and formation of ordered vacancies. The structures consist of stacked polycationic [RE10O10](10+) layers with oxygen in tetrahedral rare earth coordination and polyanionic [Au(I)3(As2)4](10-) layers with gold in square planar or rectangular planar coordination of four arsenic dumbbells (255 pm As1-As2). In contrast to the well known ionic rare earth oxide layers, the gold arsenide layers rather show covalent bonding and account for the metallic nature of these two new arsenide oxides. This is confirmed by electronic structure calculations and resistivity measurements. The oxidation state of gold was investigated by (197)Au Mössbauer, X-ray absorption near edge structure (XANES) and photoelectron (XPS) spectroscopy. Due to missing comparative gold arsenide compounds, the monovalent gold phosphide oxides RE2AuP2O were measured for comparison. The XANES measurements additionally comprise monovalent gold arsenides REAuAs2. The XPS study contains BaAuAs as reference compound instead. Combination of all data clearly indicates Au(I), which was not observed in square planar coordination up to now. Temperature dependent magnetic susceptibility data show Curie-Weiss paramagnetism for Nd10Au3As8O10 and no magnetic ordering down to 2.5 K. Sm10Au3As8O10 shows the typical Van Vleck type paramagnetism for samarium compounds along with a transition to an antiferromagnetically ordered state at TN = 8.6 K. PMID:25716906

  19. Fragment production and collective Behaviour in central 197Au + 197Au reactions at E/A = 100 MeV to 800 MeV

    International Nuclear Information System (INIS)

    In this thesis results of the reaction Au on Au at incident energies of 100 to 800 MeV/u are preentes, which were obtained with the phase 1 of the 4π detector system at the GSI in Darmstadt. The studies are concentrated to collective behaviour and the production of medium-heavy fragments (IMF) in hot and dense nuclear matter, as it is produced in semicentral and central collisions. The data set consists of the measurement of triple respectively quadruple differential cross sections of charged fragments in a large range of the phase space over nearly one order of magnitude in the incident energy. In this thesis for the first time the existence of a central source of medium-heavy fragments in very central collisions is shown. For this new criteria for the event selection are applied, as the combination of large particle multiplicity and the absence of a directed sideward flow, or the degree of the stopping in the energy flow. The analysis of the central source yielded a large mean IMF multiplicity of 13±2 (extrapolated to 4π, 100 MeV/u incident energy). Furthermore the quantitative change of the directed sideward flow with the ''centrality'' of the collisions was evaluated. With the measurments performed here now a new data set exists, which prepares many observables for the test of the numerous theoretical transport theories

  20. Re-evaluation of microscopic and integral cross-section data for important dosimetry reactions. Re-evaluation of the excitation functions for the 24Mg(n,p)24Na, 32S(n,p)32P, 60Ni(n,p)60m+gCo, 63Cu(n,2n)62Cu, 65Cu(n,2n)64Cu, 64Zn(n,p)64Cu, 115In(n,2n)114mIn, 127I(n,2n)126I, 197Au(n,2n)196Au and 199Hg(n,n')199mHg reactions

    International Nuclear Information System (INIS)

    Re-evaluations of cross sections and their associated covariance matrices have been carried out for ten dosimetry reactions: - excitation functions for the 63Cu(n,2n)62Cu, 65Cu(n,2n)64Cu, 64Zn(n,p)64Cu, 115In(n,2n)114mIn and 199Hg(n,n')199mHg reactions were re-evaluated over the neutron energy range from threshold to 20 MeV; - excitation functions for the 24Mg(n,p)24Na, 32S(n,p)32P and 60Ni(n,p)60m+gCo were reevaluated in the energy range from threshold to 21 MeV; - excitation functions for the 127I(n,2n)126I and 197Au(n,2n)196Au reactions were reevaluated in the energy range from threshold to 32 and 40 MeV, respectively. Benchmark calculations performed for 235U thermal fission and 252Cf spontaneous fission neutron spectra show that the integral cross sections derived from the newly evaluated excitation functions exhibit improved agreement with related experimental data when compared with the equivalent data from the IRDF-2002 library. (author)

  1. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  2. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE,CERN

    OpenAIRE

    Rothe, Sebastian

    2012-01-01

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spec...

  3. Inactivation of human osteosarcoma cells in vitro by {sup 211}At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, R.H. [Univ. of Oslo (Norway)]|[Institute for Cancer Research, Oslo (Norway); Bruland, O.S. [Institute for Cancer Research, Oslo (Norway); Hoff, P.; Alstad, J. [Univ. of Oslo (Norway); Lindmo, T. [Institute for Cancer Research, Oslo (Norway); Rofstad, E.K. [Norwegian Institute of Technology, Trondheim (Norway)

    1994-08-01

    The potential usefulness of {alpha}-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) {sup 211}At-TP-3 of different specific activities, (b) {sup 211}At-labeled bovine serum albumin (BSA), (c) free {sup 211}At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, {sup 211}At-BSA or free {sup 211}At. The D{sub o}`s were lower for free {sup 211}At than for {sup 211}At-BSA. The survival curves for {sup 211}At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to {sup 211}At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to {sup 211}At-TP-3 treatment was the antigen expression. Cell inactivation after {sup 211}At-TP-3 treatment increased substantially with increasing specific activity of the {sup 211}At-TP-3. At high specific activities, the cytotoxic effect of {sup 211}At-TP-3 was significantly higher than that of {sup 211}At-BSA. In conclusion, {sup 211}At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs.

  4. SU-E-T-197: Helical Cranial-Spinal Treatments with a Linear Accelerator

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, J; Bernard, D; Liao, Y; Templeton, A; Turian, J; Chu, J [Rush University Medical Center, Chicago, IL (United States)

    2014-06-01

    Purpose: Craniospinal irradiation (CSI) of systemic disease requires a high level of beam intensity modulation to reduce dose to bone marrow and other critical structures. Current helical delivery machines can take 30 minutes or more of beam-on time to complete these treatments. This pilot study aims to test the feasibility of performing helical treatments with a conventional linear accelerator using longitudinal couch travel during multiple gantry revolutions. Methods: The VMAT optimization package of the Eclipse 10.0 treatment planning system was used to optimize pseudo-helical CSI plans of 5 clinical patient scans. Each gantry revolution was divided into three 120° arcs with each isocenter shifted longitudinally. Treatments requiring more than the maximum 10 arcs used multiple plans with each plan after the first being optimized including the dose of the others (Figure 1). The beam pitch was varied between 0.2 and 0.9 (couch speed 5- 20cm/revolution and field width of 22cm) and dose-volume histograms of critical organs were compared to tomotherapy plans. Results: Viable pseudo-helical plans were achieved using Eclipse. Decreasing the pitch from 0.9 to 0.2 lowered the maximum lens dose by 40%, the mean bone marrow dose by 2.1% and the maximum esophagus dose by 17.5%. (Figure 2). Linac-based helical plans showed dose results comparable to tomotherapy delivery for both target coverage and critical organ sparing, with the D50 of bone marrow and esophagus respectively 12% and 31% lower in the helical linear accelerator plan (Figure 3). Total mean beam-on time for the linear accelerator plan was 8.3 minutes, 54% faster than the tomotherapy average for the same plans. Conclusions: This pilot study has demonstrated the feasibility of planning pseudo-helical treatments for CSI targets using a conventional linac and dynamic couch movement, and supports the ongoing development of true helical optimization and delivery.

  5. SDC muon barrel toroid 1/9.197 scale test model at SSC

    International Nuclear Information System (INIS)

    The purpose of the scale model for the muon barrel toroid (MBT) is to discover any problems in the preliminary design associated with the fabrication, assembly and installation. The information obtained from the model fabrication, assembly, installation, and testing processes will be used to evaluate the MBT preliminary design and to verify the finite element (FE) analysis. The final design of the MBT will take advantage of the experience gained from the test model to improve the design and engineering, fabrication methods, and assembly methods. The goals that are considered relevant to the test model include the following: Verify the in-plane and out-of-plane stiffness of the test model as predicted by the FE analysis. Verify the corner joint stiffness of the test model as predicted by the FE analysis. Verify the fabrication and assembly methods for the blocks, pins and keys on a small scale. Demonstrate the plate flattening scheme on a small scale. Insure that the preliminary design of the MBT can be assembled into the correct shape on a small scale. A magnetic measurement will be performed to record the field density inside an air gap. The main goal is to find out the field distribution for the test model due to geometry variation. The field measurements will also provide the information to verify the magnetic property of the steel material as well as the impact on the field distribution due to material variation

  6. Fission fragment mass distribution studies for 28Si + 197Au, 209Bi, 235U reactions

    International Nuclear Information System (INIS)

    In reactions with heavy ions, complete fusion and quasi-fission are the competing processes at energies above the Coulomb barrier. The quasi-fission process, in which the system reseparates before reaching a compact compound nucleus, is a major hurdle in forming heavy and superheavy evaporation residues (ER) in heavy-ion reactions. Fission fragment mass distribution for the fully equilibrated compound nucleus is decided at the scission point due to a long descent from saddle to scission. At higher excitation energies, the shell effects are washed out and the mass distribution is expected to be symmetric. The width of the distribution strongly depends on the entrance channel properties, such as mass asymmetry, deformation of interacting nuclei, collision energy, and the Coulomb factor Z1 Z2. Any sudden change in the width of the mass distribution would indicate departure from full equilibration, while onset of mass asymmetry or a sudden increase in width would be a strong signal of quasi fission

  7. 40 CFR Appendix A to Part 197 - Calculation of Annual Committed Effective Dose Equivalent

    Science.gov (United States)

    2010-07-01

    ... Alpha particles, fission fragments, heavy nuclei 20 1 All values relate to the radiation incident on the... (CONTINUED) RADIATION PROTECTION PROGRAMS PUBLIC HEALTH AND ENVIRONMENTAL RADIATION PROTECTION STANDARDS FOR... Dose Equivalent Unless otherwise directed by NRC, DOE shall use the radiation weighting factors...

  8. 197例供精人工授精患者的护理体会

    Institute of Scientific and Technical Information of China (English)

    杨春梅; 林小鸣; 游前

    2009-01-01

    @@ 供精人工授精(artificial insemination by donor,AID)是指通过非性交方式将供精者的精液注入于女性生殖道内,以期精子与卵子自然结合,达到生育目的而采用的一种辅助生育技术.

  9. Statistical report of A-bomb survivors detailed health examinations October 197 - March 1976

    International Nuclear Information System (INIS)

    The subject was 82,705 persons, and the number of female was larger by about 16,000. The number of cases which were exposed to atomic bomb at places within 2.0 km far from the center of explosion was 476 (212 males and 264 females), and it was 10.2% of the total. With respect to a correlation of each item for general examinations estimated from the statistical values, the mean age of male was 52.9 years old, and correlations of age with the number of erythrocytes, blood sedimentation, and hemoglobin were high. The mean age of female was 53.3 years old, and a correlation of age with the maximum blood pressure was high, while correlations of age, with blood sedimentation, and hemoglobin were not so high. The number of leukocyte was directly proportional to urine sugar only in male. Correlation coefficients between urobilinogen and protein in urine were low in both female and male. A correlation between the maximum blood pressure and the minimum blood pressure was properly high, and the maximum blood pressure in both female and male was directly proportional to age. In female, both the maximum and minimum blood pressures were directly proportional to the number of erythrocytes and hemoglobin. There was the highest correlation between the distance from the center of explosion and the minimum blood pressure in female and male. Factor analysis made on the basis of the above-mentioned correlation matrix demonstrated that the first factor was erythrocyte, and the second factor was blood pressure. (Kanao, N.)

  10. 26 CFR 1.197-2 - Amortization of goodwill and certain other intangibles.

    Science.gov (United States)

    2010-04-01

    ..., education, or training of a workforce), the terms and conditions of employment whether contractual or... existing futures contract, foreign currency contract, notional principal contract, interest rate swap,...

  11. 46 CFR 197.206 - Substitutes for required equipment, materials, apparatus, arrangements, procedures, or tests.

    Science.gov (United States)

    2010-10-01

    ... particular equipment, material, apparatus, arrangement, procedure, or test is unreasonable or impracticable, the Commandant may permit the use of alternate equipment, material, apparatus, arrangement, procedure, or test to such an extent and upon such condition as will insure, to his satisfaction, a degree...

  12. Clearance of mercury (HG-197, HG-203) vapor inhaled by human subjects

    International Nuclear Information System (INIS)

    Five human subjects inhaled a mixture of stable and radioactive mercury vapor for periods of 14 to 24 minutes. The subjects retained an average of 74 percent of that inhaled. Evidence is submitted to show that the retention occurred almost entirely in the alveoli. For 3 days after exposure, the exhaled breath was passed at intervals through activated charcoal traps for sampling periods of 10 to 35 minutes. The data indicated that an average of 7 percent of the retained mercury was lost in the expired breath, with a half time of 18 hours. Examination of the subjects in a whole body counter yielded average half times for mercury clearance from different parts of the body as follows: lung, 1.7 days; head, 21 days; kidney region, 64 days; chest, 43 days; and whole body, 58 days

  13. Antithrombin gene Arg197Stop mutation-associated venous sinus thrombosis in a Chinese family

    Institute of Scientific and Technical Information of China (English)

    Ang Li; Dexin Wang; Qiming Xue; Baoen Wang; Tianhui Liu; Zhandong Liu; Jimei Li; Chunling Zhang; Jun Chen; Jinmei Sun; YanfeiHan; Lili Wang

    2011-01-01

    This study sought to elucidate the genetic correlation of cerebral venous sinus thrombosis caused by a hereditary antithrombin deficiency in a Chinese family, at the genetic and protein levels. A nonsense mutation from C to T on locus 6431 in exon 3B of the antithrombin gene was observed,leading to an arginine (CGA) to stop codon (TGA) change in the protein. This is the first report of this mutation in China. Ineffective heparin therapy in the propositus patient is associated with a lack of heparin binding sites after antithrombin gene mutation. Characteristic low intracranial pressure in the acute phase might be specific to this patient with cerebral venous sinus thrombosis.

  14. Thermally-induced expansion in the 8 GeV/c $\\pi^{-} + ^{197}Au$ reaction

    CERN Document Server

    Lefort, T; Botvina, A S; Durand, D; Kwiatkowski, K K; Hsi, W C; Pienkowski, L; Back, B B; Breuer, H; Gushue, S; Korteling, R G; Martin, R L E; Ramakrishnan, E; Remsberg, L P; Rowland, D; Ruangma, A; Viola, V E; Winchester, E M; Yennello, S J

    2000-01-01

    Fragment kinetic energy spectra for reactions induced by 8.0 GeV/c order to deduce the possible existence and influence of thermal expansion. The average fragment kinetic energies are observed to increase systematically with fragment charge and to be nearly independent of excitation energy. Comparison of the data with statistical multifragmentation models indicates the onset of extra collective thermal expansion near an excitation energy of E*/A expansion observed in heavy-ion-induced reactions, consistent with the interpretation that the latter expansion may be driven primarily by dynamical effects such as compression/decompression.

  15. Fission of 209Bi, natPb and 197Au in the particle field of a fast accelerator driven system

    International Nuclear Information System (INIS)

    Highlights: ► Fission rates of Bi, Pb and Au were measured in a particle field similar to that of fast ADS. ► The experimental results on fission rates are in agreement with MCNPX calculations. ► The most up to date fission cross-sections and related parameterizations were used. ► New parameterizations were produced from the published cross-section data. - Abstract: Accelerator driven systems (ADS) are expected to have particle spectra of significantly greater energy range than that of current power reactors. The Energy plus Transmutation (EpT) set-up of the Joint Institute for Nuclear Research, Dubna, Russia, is designed to emulate the neutron spectrum in a fast ADS through the use of a spallation target surrounded by a blanket of natural uranium. The spectrum is further modified by a reflective layer of polyethylene and an internal absorbing layer of cadmium. The spallation target of EpT was irradiated with a beam of 4 GeV deuterons, and the fission rates of bismuth, lead and gold samples, placed in the target-blanket region were recorded using a fission track detector technique. The fission rates were also calculated using the MCNPX Monte Carlo code with the INCL4 cascade model and cross sections for nucleon induced fission obtained from literature. Agreement between the measured and calculated results indicates the model’s ability to predict the particle spectra and spatial distribution

  16. Tivantinib (ARQ-197) exhibits anti-tumor activity with down-regulation of FAK in oral squamous cell carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Xi, Wei-Hong [Department of Oral and Maxillofacial Surgery, First Affiliated Hospital, Nanchang University, Nanchang 330006 (China); Yang, Li-Yun [Department of Blood Transfusion, First Affiliated Hospital, Nanchang University, Nanchang 330006 (China); Cao, Zhong-Yi, E-mail: m18070383032@163.com [Department of Oral and Maxillofacial Surgery, First Affiliated Hospital, Nanchang University, Nanchang 330006 (China); Qian, Yong, E-mail: yfykqkqy@163.com [Department of Oral and Maxillofacial Surgery, First Affiliated Hospital, Nanchang University, Nanchang 330006 (China)

    2015-02-20

    Oral squamous cell carcinoma (OSCC) is one of the most common cancers worldwide and the 5 years survival rate of the patients is about 60% in the USA, due to acquired chemotherapeutic resistance and metastasis of the disease. In this study, we found that tivantinib, a selective MET inhibitor, suppresses OCSS cell proliferation and colony formation, however, anti-tumor activities induced by tivantinib are independent of the inhibition of MET signaling pathway. In addition, tivantinib cause G2/M cell cycle arrest and caspases-dependent apoptosis in OSCC cell lines. We also found that tivantinib dose-dependently suppressed the activation and expression of FAK. In all, these data suggested that tivantinib may be developed as a chemotherapeutic agent to effectively treat certain cancers including OSCC. - Highlights: • Tivantinib suppresses OSCC cell growth independent of the inhibition of HGF/MET signaling pathway. • Tivantinib blocks cell cycle and induces caspases-mediated apoptosis. • Tivantinib elicits its anti-tumor activity with the inhibition of FAK signaling pathway.

  17. Outer Membrane Protein Complex of Meningococcus Enhances the Antipolysaccharide Antibody Response to Pneumococcal Polysaccharide–CRM197 Conjugate Vaccine ▿

    OpenAIRE

    Lai, Zengzu; Schreiber, John R.

    2011-01-01

    Bacterial polysaccharides (PS) are T cell-independent antigens that do not induce immunologic memory and are poor immunogens in infants. Conjugate vaccines in which the PS is covalently linked to a carrier protein have enhanced immunogenicity that resembles that of T cell-dependent antigens. The Haemophilus influenzae type b (Hib) conjugate vaccine, which uses the outer membrane protein complex (OMPC) from meningococcus as a carrier protein, elicits protective levels of anti-capsular PS antib...

  18. SU-E-J-197: Investigation of Microsoft Kinect 2.0 Depth Resolution for Patient Motion Tracking

    International Nuclear Information System (INIS)

    Purpose: Investigate the use of the Kinect 2.0 for patient motion tracking during radiotherapy by studying spatial and depth resolution capabilities. Methods: Using code written in C#, depth map data was abstracted from the Kinect to create an initial depth map template indicative of the initial position of an object to be compared to the depth map of the object over time. To test this process, simple setup was created in which two objects were imaged: a 40 cm × 40 cm board covered in non reflective material and a 15 cm × 26 cm textbook with a slightly reflective, glossy cover. Each object, imaged and measured separately, was placed on a movable platform with object to camera distance measured. The object was then moved a specified amount to ascertain whether the Kinect’s depth camera would visualize the difference in position of the object. Results: Initial investigations have shown the Kinect depth resolution is dependent on the object to camera distance. Measurements indicate that movements as small as 1 mm can be visualized for objects as close as 50 cm away. This depth resolution decreases linearly with object to camera distance. At 4 m, the depth resolution had decreased to observe a minimum movement of 1 cm. Conclusion: The improved resolution and advanced hardware of the Kinect 2.0 allows for increase of depth resolution over the Kinect 1.0. Although obvious that the depth resolution should decrease with increasing distance from an object given the decrease in number of pixels representing said object, the depth resolution at large distances indicates its usefulness in a clinical setting

  19. New developments in renal physiopathology acquired using a quantitative renal functional test: the 197Hg uptake test

    International Nuclear Information System (INIS)

    The renal function of 331 obstructive uropathies, of which 112 were unilateral, were studied using the radioactive Hg renal uptake technique. The results obtained lead to the following observations: kidneys silent because of a chronic pelvi-ureteric-obstruction maintain a minimum function representing approximately one quarter of the normal value, which does not seem to be improved following the removal of the obstacle. Operative relief of obstruction on unilateral obstructive uropathies, except for cases of silent kidneys, are followed by a significative improvement in the function of the kidney on the operated side in more than a third of the cases studied. In 43% of obstructive uropathies considered as unilateral, the functional value of the two kidneys is decreased

  20. SU-E-J-197: Investigation of Microsoft Kinect 2.0 Depth Resolution for Patient Motion Tracking

    Energy Technology Data Exchange (ETDEWEB)

    Silverstein, E; Snyder, M [Wayne State University, Detroit, MI (United States)

    2015-06-15

    Purpose: Investigate the use of the Kinect 2.0 for patient motion tracking during radiotherapy by studying spatial and depth resolution capabilities. Methods: Using code written in C#, depth map data was abstracted from the Kinect to create an initial depth map template indicative of the initial position of an object to be compared to the depth map of the object over time. To test this process, simple setup was created in which two objects were imaged: a 40 cm × 40 cm board covered in non reflective material and a 15 cm × 26 cm textbook with a slightly reflective, glossy cover. Each object, imaged and measured separately, was placed on a movable platform with object to camera distance measured. The object was then moved a specified amount to ascertain whether the Kinect’s depth camera would visualize the difference in position of the object. Results: Initial investigations have shown the Kinect depth resolution is dependent on the object to camera distance. Measurements indicate that movements as small as 1 mm can be visualized for objects as close as 50 cm away. This depth resolution decreases linearly with object to camera distance. At 4 m, the depth resolution had decreased to observe a minimum movement of 1 cm. Conclusion: The improved resolution and advanced hardware of the Kinect 2.0 allows for increase of depth resolution over the Kinect 1.0. Although obvious that the depth resolution should decrease with increasing distance from an object given the decrease in number of pixels representing said object, the depth resolution at large distances indicates its usefulness in a clinical setting.

  1. Tivantinib (ARQ-197) exhibits anti-tumor activity with down-regulation of FAK in oral squamous cell carcinoma

    International Nuclear Information System (INIS)

    Oral squamous cell carcinoma (OSCC) is one of the most common cancers worldwide and the 5 years survival rate of the patients is about 60% in the USA, due to acquired chemotherapeutic resistance and metastasis of the disease. In this study, we found that tivantinib, a selective MET inhibitor, suppresses OCSS cell proliferation and colony formation, however, anti-tumor activities induced by tivantinib are independent of the inhibition of MET signaling pathway. In addition, tivantinib cause G2/M cell cycle arrest and caspases-dependent apoptosis in OSCC cell lines. We also found that tivantinib dose-dependently suppressed the activation and expression of FAK. In all, these data suggested that tivantinib may be developed as a chemotherapeutic agent to effectively treat certain cancers including OSCC. - Highlights: • Tivantinib suppresses OSCC cell growth independent of the inhibition of HGF/MET signaling pathway. • Tivantinib blocks cell cycle and induces caspases-mediated apoptosis. • Tivantinib elicits its anti-tumor activity with the inhibition of FAK signaling pathway

  2. Exclusive studies of angular distributions in GeV hadron-induced reactions with [sup 197]Au

    Energy Technology Data Exchange (ETDEWEB)

    Hsi, W.; Kwiatkowski, K.; Wang, G.; Bracken, D.S.; Cornell, E.; Ginger, D.S.; Viola, V.E. (Departments of Chemistry, Physics and IUCF, Indiana University, Bloomington, Indiana 47405 (United States)); Korteling, R.G. (Department of Chemistry, Simon Fraser University, Burnaby, British Columbia, (Canada) V5A I56); Morley, K.B. (Physics Division, Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States)); Huang, R.; Lynch, W.G.; Tsang, M.B.; Xi, H. (Department of Physics and NSCL, Michigan State University, East Lansing, Michigan 48824 (United States)); Gimeno-Nogues, F.; Ramakrishnan, E.; Rowland, D.; Yennello, S.J. (Department of Chemistry and Cyclotron Institute, Texas A M University, College Station, Texas 77843 (United States)); Breuer, H. (Department of Physics, University of Maryland, College Park, Maryland 20740 (United States)); Gushue, S.; Remsberg, L.P. (Chemistry Department, Brookhaven National Laboratory, Upton, New York 11973 (United States)); Botvin

    1999-09-01

    Exclusive studies of angular distributions for intermediate-mass fragments (IMFs) produced in GeV hadron-induced reactions have been performed with the Indiana Silicon Sphere (ISiS) 4[pi] detector array. Special emphasis has been given to understanding the origin of sideways peaking, which becomes prominent in the angular distributions for beam momenta above about 10 GeV/c. Both the magnitude of the effect and the peak angle increase as a function of fragment multiplicity and charge. When gated on IMF kinetic energy, the angular distributions evolve from forward-peaked to near isotropy as the fragment kinetic energy decreases. Fragment-fragment angular-correlation analyses show no obvious evidence for a dynamic mechanism that might signal shock wave effects or the breakup of exotic geometric shapes such as bubbles or toroids. Moving-source and intranuclear cascade simulations suggest that the observed sideways peaking is of kinematic origin, arising from significant transverse momentum imparted to the heavy recoil nucleus during the fast cascade stage of the collision. A two-step cascade and statistical multifragmentation calculation is consistent with this assumption. [copyright] [ital 1999] [ital The American Physical Society

  3. Exclusive studies of angular distributions in GeV hadron-induced reactions with {sup 197}Au

    Energy Technology Data Exchange (ETDEWEB)

    Hsi, W.; Kwiatkowski, K.; Wang, G.; Bracken, D.S.; Cornell, E.; Ginger, D.S.; Viola, V.E. [Departments of Chemistry, Physics and IUCF, Indiana University, Bloomington, Indiana 47405 (United States); Korteling, R.G. [Department of Chemistry, Simon Fraser University, Burnaby, British Columbia, (Canada) V5A I56; Morley, K.B. [Physics Division, Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Huang, R.; Lynch, W.G.; Tsang, M.B.; Xi, H. [Department of Physics and NSCL, Michigan State University, East Lansing, Michigan 48824 (United States); Gimeno-Nogues, F.; Ramakrishnan, E.; Rowland, D.; Yennello, S.J. [Department of Chemistry and Cyclotron Institute, Texas A M University, College Station, Texas 77843 (United States); Breuer, H. [Department of Physics, University of Maryland, College Park, Maryland 20740 (United States); Gushue, S.; Remsberg, L.P. [Chemistry Department, Brookhaven National Laboratory, Upton, New York 11973 (United States); Botvina, A. [Department of Physics, University of Bologna, Bologna I-40126 (Italy); Friedman, W.A. [Department of Physics, University of Wisconsin, Madison, Wisconsin 53706 (United States)

    1999-09-01

    Exclusive studies of angular distributions for intermediate-mass fragments (IMFs) produced in GeV hadron-induced reactions have been performed with the Indiana Silicon Sphere (ISiS) 4{pi} detector array. Special emphasis has been given to understanding the origin of sideways peaking, which becomes prominent in the angular distributions for beam momenta above about 10 GeV/c. Both the magnitude of the effect and the peak angle increase as a function of fragment multiplicity and charge. When gated on IMF kinetic energy, the angular distributions evolve from forward-peaked to near isotropy as the fragment kinetic energy decreases. Fragment-fragment angular-correlation analyses show no obvious evidence for a dynamic mechanism that might signal shock wave effects or the breakup of exotic geometric shapes such as bubbles or toroids. Moving-source and intranuclear cascade simulations suggest that the observed sideways peaking is of kinematic origin, arising from significant transverse momentum imparted to the heavy recoil nucleus during the fast cascade stage of the collision. A two-step cascade and statistical multifragmentation calculation is consistent with this assumption. {copyright} {ital 1999} {ital The American Physical Society}

  4. Structure of A197 from Sulfolobus Turreted Icosahedral Virus: a Crenarchaeal Viral Glycosyltransferase Exhibiting the GT-A Fold

    OpenAIRE

    Larson, Eric T.; Reiter, Dirk; Young, Mark; Lawrence, C. Martin

    2006-01-01

    Sulfolobus turreted icosahedral virus (STIV) was the first icosahedral virus characterized from an archaeal host. It infects Sulfolobus species that thrive in the acidic hot springs (pH 2.9 to 3.9 and 72 to 92°C) of Yellowstone National Park. The overall capsid architecture and the structure of its major capsid protein are very similar to those of the bacteriophage PRD1 and eukaryotic viruses Paramecium bursaria Chlorella virus 1 and adenovirus, suggesting a viral lineage that predates the th...

  5. Neutron capture measurements on 62Ni, 63Ni and 197Au and their relevance for stellar nucleosynthesis

    CERN Document Server

    Lederer, Claudia

    Neutron capture reactions in stars are responsible for forming about 99% of the elemental abundances heavier than Fe. Two processes contribute about equally to the overall abundance pattern: the slow neutron capture process (s process) where neutron densities are small and therefore radioactive decay is generally faster than subsequent neutron capture on radionuclides, and the rapid neutron capture process (r process) which takes place in environments of high neutron densities, driving the reaction path towards the neutron rich side. The key nuclear physics input for s process studies are stellar neutron capture cross sections, called MACS (Maxwellian-averaged cross section). In the course of this work, dierent reactions relevant to s process nucleosynthesis have been studied. To improve and check existing information, neutron capture cross sections of most stable Fe and Ni isotopes were measured via the time-of-flight technique at the n TOF facility at CERN. This campaign was triggered by a work of Sneden et...

  6. Single event 2-dimensional factorial moment analysis of 197Au-emulsion data from EMU01 experiment

    International Nuclear Information System (INIS)

    The meaning of single event analysis is discussed. Some examples are listed. The special interest in 2-D factorial moment analysis is explained in some detail. The single event 2-D factorial moment analysis of 11 A GeV central Au-Emulsion collision data from EMU01 is given

  7. 32 CFR Appendix B to Part 197 - Procedures for Historical Researchers Permanently Assigned Within the Executive Branch Working on...

    Science.gov (United States)

    2010-07-01

    ... information of any other Agency signatory to the Agreement found in OSD files. The Central Intelligence Agency... English, and in black ink. (6) All notes must be given to the facility staff at the end of each day....

  8. Book Review: "The Road to Sustainability, GDP and Future Generations" Pulselli et al, WIT Press, Southhampton, UK 197p 2008

    Science.gov (United States)

    “The Road to Sustainability, GDP and future generations” by Pulselli, F.M., Bastianoni, S., Marchettini, N. Tiezzi, E. was reviewed upon request by the journal’s editor. Briefly, this book presents the authors’ perspective on the complex and important topic of sustainability. Su...

  9. RRS James Clark Ross, Cruise JR197, December 12, 2008 - December 21, 2008, Sea Level Measurements in the Drake Passage

    OpenAIRE

    Hargreaves, G.W.

    2009-01-01

    Bottom Pressure Recorders have been used for making measurements of the Antarctic Circumpolar Current (ACC) since 1988, initially in the Scotia Sea and then later across the Drake Passage between the Falkland Islands and the Antarctic peninsula. Some of the Bottom Pressure Recorders (BPRs) are combined with Inverted Echo Sounders (IES). During this cruise, one BPR and one BPR/IES were recovered and re-deployed in the Drake Passage. An additional BPR was deployed and a data pod was also re...

  10. Measure of thermal neutron flux in the IPEN/MB-01 reactor using 197 Au wire activation detectors

    International Nuclear Information System (INIS)

    This dissertation has aimed at developing a neutron flux measurement technique by means of detectors activation analysis. The main task of this work was the implementation of this thermal neutron flux measurement technique, using gold wires as activation detectors in the IPEN/MB-01 reactor core. The neutron thermal flux spatial distribution was obtained by gold wire activation technique, with wire diameters of 0.125 mm and 0.250 mm in seven selected reactor experimental channels. The values of thermal flux were about 109 neutrons/cm2.s. This experiment has been the first one conducted with gold wires in the IPEN/MB-01 reactor, being this technique implemented for use by experiments in flux mapping of the core

  11. Shelf-Life of ɛ-Lysyl-3-(Trimethylstannyl)Benzamide Immunoconjugates, Precursors for 211At Labeling of Antibodies

    OpenAIRE

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per; Jensen, Holger; Holgersson, Stellan; Lindegren, Sture

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity and the complex radiochemistry of 211At are major obstacles for research and prospective clinical applications. In the present study, astatination of immunoconjugates, already prepared well in advance...

  12. Energetic particle emission and linear momentum transfer in central collisions induced by 32.5 MeV/nucleon 16O + 238U, 197Au

    International Nuclear Information System (INIS)

    Reaction kinetics of incomplete fusion reactions between heavy nuclei of Oxygen and Uranium and Oxygen and Gold are studied at 32.5 MeV bombarding energy to gain information about linear momentum transfer. It is found that the most probable linear momentum transfer is only about 75% of the beam momentum for these reactions. Binary massive transfer mechanisms and prompt nucleon emission are offered as explanations of this phenomena. It appears that nuclear mean field dynamics rather than nucleon-nucleon phenomenon dominate reaction kinetics at this bombarding energy. 5 refs., 8 figs

  13. Tivantinib (ARQ 197) affects the apoptotic and proliferative machinery downstream of c-MET: role of Mcl-1, Bcl-xl and Cyclin B1

    Science.gov (United States)

    Lu, Shuai; Török, Helga-Paula; Gallmeier, Eike; Kolligs, Frank T.; Rizzani, Antonia; Arena, Sabrina; Göke, Burkhard; Gerbes, Alexander L.; De Toni, Enrico N.

    2015-01-01

    Tivantinib, a c-MET inhibitor, is investigated as a second-line treatment of HCC. It was shown that c-MET overexpression predicts its efficacy. Therefore, a phase-3 trial of tivantinib has been initiated to recruit “c-MET-high”patients only. However, recent evidence indicates that the anticancer activity of tivantinib is not due to c-MET inhibition, suggesting that c-MET is a predictor of response to this compound rather than its actual target. By assessing the mechanisms underlying the anticancer properties of tivantinib we showed that this agent causes apoptosis and cell cycle arrest by inhibiting the anti-apoptotic molecules Mcl-1 and Bcl-xl, and by increasing Cyclin B1 expression regardless of c-MET status. However, we found that tivantinib might antagonize the antiapoptotic effects of c-MET activation since HGF enhanced the expression of Mcl-1 and Bcl-xl. In summary, we show that the activity of tivantinib is independent of c-MET and describe Mcl-1, Bcl-xl and Cyclin B1 as effectors of its antineoplastic effects in HCC cells. We suggest that the predictive effect of c-MET expression in part reflects the c-MET-driven overexpression of Mcl-1 and Bcl-xl in c-MET-high patients and that these molecules are considered as possible response predictors. PMID:26259250

  14. Impact parameter dependent light particle correlations for 40Ar induced reactions on 197Au at E/A = 60 MeV

    International Nuclear Information System (INIS)

    With the help of a multidetector system of 96 plastic detectors, mounted in the forward hemisphere between 30 and 300, we measured light charged particles to make an off-line event-type selection. The final aim to distinguish different impact parameter domains with the plastic wall could be achieved using the observed multiplicity as the sampling parameter. With the help of a computer simulation based on a participant-spectator model to describe the reation, the mean observed multiplicity could be established to vary smoothly with the total multiplicity, a variable which is often cited as an indicator for the violence of a reaction. Even if the simulation indicates a broad distribution of the observed multiplicity over the different impact parameters, we could separate the extreme cases of peripheral and central collisions. If the events are selected with the appropriate multiplicity gates, it turns out that peripheral collisions give rise to enhanced correlations, whereas the correlation function is strongly reduced for central collisions. Between these extreme values the correlation reduces smoothly with the impact parameter. The space-time extent of the emitting system is therefore larger for small impact parameters than in peripheral collisions. Supposing that the spatial extent is rather independent of the impact parameter (except for very peripheral collisions) we suggest that the observed variation of the correlation function could indicate a variation of the emission time for light particles rather than a spatial evolution. On the contrary the temperature, determined equally after an event-type selection with the observed multiplicity, shows no variation with the impact parameter. This could indicate that a limiting temperature is reached at a value at which the emission of particles is faster than the temporal development of the temperature. (orig./HSI)

  15. Fabrice Audié, Spinoza et les mathématiques, Paris, PUPS, 2005, 197 pages, 18 €.

    Directory of Open Access Journals (Sweden)

    Cécile Nicco

    2007-01-01

    Full Text Available Si, comme le souligne Pierre-François Moreau dans la préface, le rapport de la philosophie spinoziste aux mathématiques est « fort visible », il n’est pas pour autant facile à interpréter. En effet, l’intérêt de Spinoza pour les mathématiques est manifeste dans la forme géométrique de l’Éthique, des Principes de la philosophie de Descartes, et du premier Appendice du Court Traité ; mais elles sont aussi présentes en tant que problèmes à traiter ou comme illustrations dans la correspondance et...

  16. Study of fusion and nucleon transfer channels in the Au-197 + He-6 reaction in an energy range of He-6 to 20 Mev/A

    Czech Academy of Sciences Publication Activity Database

    Skobelev, N. K.; Penionzhkevich, Y. E.; Kulko, A. A.; Demekhina, N. A.; Kroha, Václav; Kugler, Andrej; Lukyanov, S. M.; Mrázek, Jaromír; Sobolev, Yu. G.; Maslov, V. A.; Muzychka, Yu. A.; Voskoboynik, E. I.; Fomichev, A. S.

    2013-01-01

    Roč. 10, č. 3 (2013), s. 248-255. ISSN 1547-4771 Institutional support: RVO:61389005 Keywords : nuclear reactions * gamma activity * cross section Subject RIV: BG - Nuclear, Atomic and Molecular Physics , Colliders

  17. {sup 3}He induced reactions on {sup nat}Ag and {sup 197}Au at 1.8, 3.6 and 4.8 GeV

    Energy Technology Data Exchange (ETDEWEB)

    Brzychczyk, J. [CEA Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France). Dept. d`Astrophysique, de la Physique des Particules, de la Physique Nucleaire et de l`Instrumentation Associee]|[Jagiellonian Univ., Krakow (Poland). Inst. of Physics; Pollacco, E.C.; Volant, C.; Legrain, R. [CEA Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France). Dept. d`Astrophysique, de la Physique des Particules, de la Physique Nucleaire et de l`Instrumentation Associee; Kwiatkowski, K.; Morley, K.B.; Renshaw-Foxford, E.; Bracken, D.S.; Viola, V.E.; Yoder, N.R. [Indiana Univ., Bloomington, IN (United States). Dept. of Chemistry] [and others

    1995-03-01

    The {sup 3}He induced reactions on Ag and Au are studied using a large solid angle and low energy threshold detector array. The data show consistency with intranuclear cascade and expanding emitting source description. Charge moment analysis is presented. (author). 18 refs., 8 figs.

  18. Fragment charge and energy distributions in the 1.8-4.8 GeV {sup 3}He + {sup nat}Ag, {sup 197}Au reactions

    Energy Technology Data Exchange (ETDEWEB)

    Bracken, D.S.; Foxford, E.R.; Kwiatkowski, K. [and others

    1995-10-01

    Moving source fits have been performed for IMFs as a function of observables related to collision violence in the 1.8-4.8 GeV {sup 3}He +{sup nat}Ag, {sup l97}Au reactions. The systematic behavior of the source properties and fragment charge distributions will be reviewed. The evolution of the spectral Coulomb parameters provides evidence for nuclear expansion prior to multifragmentation, suggesting a breakup density of p/p{sub o} {approximately} 1/3. The charge distributions will be examined in terms of power-law fits and moment analyses.

  19. Fragment charge and energy distributions in the 1.8-4.8 GeV 3He + natAg, 197Au reactions

    International Nuclear Information System (INIS)

    Moving source fits have been performed for IMFs as a function of observables related to collision violence in the 1.8-4.8 GeV 3He +natAg, l97Au reactions. The systematic behavior of the source properties and fragment charge distributions will be reviewed. The evolution of the spectral Coulomb parameters provides evidence for nuclear expansion prior to multifragmentation, suggesting a breakup density of p/po ∼ 1/3. The charge distributions will be examined in terms of power-law fits and moment analyses

  20. Evolution of fusion for the systems Ar40+Ag108 and Ar40+Au197 between 39 and 60 MeV/A

    International Nuclear Information System (INIS)

    In this experiment performed at GANIL, the study of the reactions mechanisms which appear in the interaction Kr+Au at 35 and 44 MeV/u, is based on the correlations analysis between the heavy fragments produced. The use of the first available modulus of XYZT and DELF multidetectors allowed the observation of a significant population of three fold coincidence events (one forward fragment in XYZT (30, 300) and two fragments in DELF (±450, ±1100)). The velocity characteristics of the forward fragment enable one to separate two classes of events: First, coincidences between a projectile residue detected in XYZT and two target fragments in DELF. For these events, a study of incomplete linear momentum transfer leads to a transfer rate smaller than 20%. The different kinetic observables are then correctly reproduced by an abrasion-ablation model. Then, coincidences between three fragments that appear to come from only one source. The fragment's characteristics are compatible with a cracking mechanism of the target. The reaction mechanisms observed do not seem to be directly dependent on the projectile velocity but rather on the projectile energy

  1. Supplement to 'ASDEX Upgrade, definition of a tokamak experiment with a reactor-compatible poloidal divertor' (IPP-report 1/197, March 1982)

    International Nuclear Information System (INIS)

    Since March 1982 the better understanding of the divertor physics, both by theory and experiments, and the development of the ASDEX Upgrade concept have considerably improved and simplified the ASDEX Upgrade design. Single null poloidal divertor configurations were calculated, which can well compete with elongated limiter configurations in reduced poloidal field effort. The role of recycling and its limitation set by the available energy flux, observed experimentally and explained by a plasma boundary flow model, led to a refined formulation of the line density requirements. Finally, a discussion of the attainable temperature and densities allowed clearly to distinguish between ASDEX and ASDEX Upgrade and pointed out the dominant role of the plasma current. The ASDEX Upgrade basic data are summarized as presented to the EURATOM advisory board. (orig.)

  2. Coulomb fission of 238U in the interaction of 24.3 MeV/nucleon 238U with 197Au

    International Nuclear Information System (INIS)

    Coulomb fission of 238U has been studied in the interaction of a 24.3 MeV/nucleon U beam with an Au target. A novel experimental approach is followed, allowing to isolate the Coulomb fission from the nuclear fission on an event by event basis. The Z distribution of the fragments is studied for both fission processes. (author)

  3. Development of Optical Fiber Technology in Poland, International Journal of Electronics and Telecommunication, vol. 57, no 2, pp.191-197, July 2011

    CERN Document Server

    Dorosz, J

    2011-01-01

    In this paper, the authors, chairmen of the 13th Conference on Optical Fibers and Their Applications OFA2011, and editors of the conference proceedings summarize the development of optical fiber technology in Poland (during the period of 2009- 2011) on the basis of papers presented there and consecutively published in this volume. The digest is thus not full but covers the periodically presented material every 18 months during the meetings on optical fibers in Białystok-Białowie˙za and Lublin- Krasnobród. OFC systems are developed for HEP experiments and accelerators. OFC systems are also developed for virtual atomic clocks. EuCARD information presentation was organized during this meeting. Keywords— optical fibers, optical communication systems, photonic sources and detectors, photonic sensors, integrated optics, photonics applications, photonic materials.

  4. Fission of spin-aligned projectile-like nuclei in the interactions of 29 MeV/nucleon 208Pb with 197Au

    International Nuclear Information System (INIS)

    Binary fission of projectile-like nuclei was investigated in the interaction of 29 MeV/nucleon Pb on Au, together with the associated neutron multiplicity. Fission is only observed in rather peripheral collisions and represents approximately 20% of the total reaction cross-section. The fission process occurs after collisions in which up to 550 MeV have been dissipated. The angular and energy distribution of the fragments can be accounted for by assuming a noticeable spin alignment of the fissioning nuclei. (author) 18 refs.; 3 figs

  5. Study of hadronic event shape in flavour tagged events in $e^{+} e^{-}$ annihilation at $<\\sqrt{S}>$ = 197 GeV

    CERN Document Server

    Achard, P; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, J; Aloisio, A; Alviggi, M G; Anderhub, H; Andreev, V P; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, G; Baksay, L; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biglietti, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, G J; Böhm, A; Boldizsar, L; Borgia, B; Bottai, S; Bourilkov, D; Bourquin, M; Braccini, S; Branson, J G; Brochu, F; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A; Casaus, J; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Chamizo-Llatas, M; Chang, Y H; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, L; Cindolo, F; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; de la Cruz, B; Cucciarelli, S; De Asmundis, R; Déglon, P; Debreczeni, J; Degré, A; Dehmelt, K; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Dionisi, C; Dittmar, M; Doria, A; Dova, M T; Duchesneau, D; Duda, M; Echenard, B; Eline, A; El-Hage, A; El-Mamouni, H; Engler, A; Eppling, F J; Extermann, P; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, M; Ferguson, T; Fesefeldt, H; Fiandrini, E; Field, J H; Filthaut, F; Fisher, P H; Fisher, W; Forconi, G; Freudenreich, K; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gentile, S; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hirschfelder, J; Hofer, H; Hohlmann, M; Holzner, G; Hou, S R; Jin, B N; Jindal, P; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kaur, M; Kienzle-Focacci, M N; Kim, J K; Kirkby, J; Kittel, W; Klimentov, A; König, A C; Kopal, M; Koutsenko, V; Kräber, M; Krämer, R W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Levtchenko, M; Levchenko, P M; Li, C; Likhoded, S; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Luci, C; Luminari, L; Lustermann, W; Ma, W G; Malgeri, L; Malinin, A; Maña, C; Mans, J; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Muanza, G S; Muijs, A J M; Musy, M; Nagy, S; Natale, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nisati, A; Novák, T; Nowak, H; Ofierzynski, R; Organtini, G; Pal, I; Palomares, C; Paolucci, P; Paramatti, R; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, F; Pedace, M; Pensotti, S; Perret-Gallix, D; Piccolo, D; Pierella, F; Pieri, M; Pioppi, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Pothier, J; Prokofiev, D; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A; Razis, P; Rembeczki, S; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Roe, B P; Romero, L; Rosca, A; Rosemann, C; Rosenbleck, C; Rosier-Lees, S; Roth, S; Rubio, J A; Ruggiero, G; Rykaczewski, H; Sakharov, A; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Schäfer, C; Schegelsky, V; Schopper, H; Schotanus, D J; Sciacca, C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A; Son, D; Souga, C; Spillantini, P; Steuer, M; Stickland, D P; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tarjan, P; Tauscher, L; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Ulbricht, J; Valente, E; Van de Walle, R T; Vásquez, R; Vesztergombi, G; Vetlitskii, I; Viertel, G; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Wadhwa, M; Wang, Q; Wang, X L; Wang, Z M; Weber, M; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhao, J; Zhu, G Y; Zhu, R Y; Zhuang, H L; Zichichi, A; Zimmermann, B; Zöller, M

    2008-01-01

    Results are presented from a study of the structure of hadronic events in highenergy (e^+)(e^-) interactions detected by the L3 detector at LEP. Various event shape distributions and their moments are measured at several energy points at and above the Z-boson mass. The event avour is tagged by using the decay characteristics of b-hadrons. Measurements of distributions of event shape variables for all hadronic events, for light (u, d, s, c) and heavy (b) quark avours are compared to several QCD models with improved leading log approximation: Jetset, Herwig and Ariadne. A good description of the data is provided by the models.

  6. 40 CFR 197.15 - How must DOE take into account the changes that will occur during the period of geologic stability?

    Science.gov (United States)

    2010-07-01

    ... Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) RADIATION PROTECTION PROGRAMS PUBLIC HEALTH AND ENVIRONMENTAL RADIATION PROTECTION STANDARDS FOR YUCCA MOUNTAIN, NEVADA Public Health and Environmental... related to the geology, hydrology, and climate based upon cautious, but reasonable assumptions of...

  7. Rapidity density distributions in 16O, 28Si, 32S, 197Au, and 208Pb induced heavy-ion interactions at 4A--200A GeV

    International Nuclear Information System (INIS)

    The mass, energy, and centrality dependence of rapidity density distributions of relativistic, charged particles, produced in heavy-ion interactions in the energy range 4A--200A GeV, are investigated. The results indicate that the rapidity density distributions show systematic variations, which are used to predict distributions for Au+Au and Pb+Pb interactions in a model-independent way

  8. 3He induced reactions on natAg and 197Au at 1.8, 3.6 and 4.8 GeV

    International Nuclear Information System (INIS)

    The 3He induced reactions on Ag and Au are studied using a large solid angle and low energy threshold detector array. The data show consistency with intranuclear cascade and expanding emitting source description. Charge moment analysis is presented. (author). 18 refs., 8 figs

  9. Production of neutron-rich isotopes by cold fragmentation in the reaction {sup 197}Au + Be at 950 A MeV

    Energy Technology Data Exchange (ETDEWEB)

    Benlliure, J.; Pereira, J. [Universidad de Santiago de Compostela (Spain)]|[Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany); Schmidt, K.H.; Cortina-Gil, D.; Enqvist, T.; Heinz, A.; Junghans, A.R. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany); Farget, F. [Institut de Physique Nucleaire, 91 - Orsay (France); Taieb, J. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany)]|[Institut de Physique Nucleaire, 91 - Orsay (France)

    1999-09-01

    The production cross sections and longitudinal-momentum distributions of very neutron-rich isotopes have been investigated in the fragmentation of a 950 A MeV {sup 179}Au beam in a beryllium target. Seven new isotopes ({sup 193}Re, {sup 194}Re, {sup 191}W, {sup 192}W, {sup 189}Ta, {sup 187}Hf and {sup 188}Hf) and the five-proton-removal channel were observed for the first time. The reaction mechanism leading to the formation of these very neutron-rich isotopes is explained in terms of the cold-fragmentation process. An analytical model describing this reaction mechanism is presented. (orig.)

  10. Measure of thermal neutron flux in the IPEN/MB-01 reactor using {sup 197} Au wire activation detectors; Medida do fluxo de neutrons termicos do reator IPEN/MB-01 com detectores de ativacao de fios de {sup 197} Au

    Energy Technology Data Exchange (ETDEWEB)

    Marques, Andre Luis Ferreira

    1995-12-31

    This dissertation has aimed at developing a neutron flux measurement technique by means of detectors activation analysis. The main task of this work was the implementation of this thermal neutron flux measurement technique, using gold wires as activation detectors in the IPEN/MB-01 reactor core. The neutron thermal flux spatial distribution was obtained by gold wire activation technique, with wire diameters of 0.125 mm and 0.250 mm in seven selected reactor experimental channels. The values of thermal flux were about 10{sup 9} neutrons/cm{sup 2}.s. This experiment has been the first one conducted with gold wires in the IPEN/MB-01 reactor, being this technique implemented for use by experiments in flux mapping of the core 73 refs., 60 figs., 31 tabs.

  11. « The Sasanian Relashionship with South Arabia: Literary, Epigraphic and Oral Historical Perspectives ». Arabian Archaeology and Epigraphy 37, fasc. 2, 2008, p. 197-213.

    OpenAIRE

    Cuny, Julien

    2013-01-01

    L’A. offre un compendium de trois types de sources différentes concernant l’histoire de l’intervention, de la présence ou de l’impact du pouvoir sassanide en Arabie : les sources littéraires (essentiellement arabo-persanes mais aussi romano-byzantines) ; les quelques inscriptions disponibles, une lapidaire himyarite, et une documentationsigillographique mais qui ne se réfère pas explicitement à l’Arabie; ainsi que la tradition orale omanaise. Néanmoins, le propos de l’A. ne se limite pas à l’...

  12. Multibeam collection for KN197-03: Multibeam data collected aboard Knorr from 2010-01-24 to 2010-02-14, departing from Bridgetown, Barbados and returning to Bridgetown, Barbados

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  13. The expression profile of Dopamine D2 receptor, MGMT and VEGF in different histological subtypes of pituitary adenomas: a study of 197 cases and indications for the medical therapy

    OpenAIRE

    Wang, Youwei; Li, Junyang; TOHTI, MAMATEMIN; Hu, Yuebing; Wang, Sheng; Li, Wanchun; LU, ZHENFENG; Ma, Chiyuan

    2014-01-01

    Background To study the expression of D2R, MGMT and VEGF for clinical significance in pituitary adenomas, and to predict the potential curative medical therapy of dopamine agonists, temozolomide and bevacizumab on pituitary adenomas. Methods Immunohistochemistry and western blot were performed to detect the expression of expression of D2R, MGMT and VEGF in pituitary adenoma tissue samples. The ratio of high expression of D2R, MGMT or VEGF in different subtypes of PA was compared by the use of...

  14. Fission Cross-Sections of Ta181, Re, Pt, Au197, Pb, Bi, Th, And U235 For Protons With An Energy Of 150-660 MeV

    International Nuclear Information System (INIS)

    The measurements were carried out on the synchrocyclotron of the Joint Institute for Nuclear Research, wirha maximum proton energy of 660 MeV. The fission events were recorded by visual observation of the fission-fragment tracks left on glass after treating. The absolute recording efficiency was determined by (he number of U2'35 and Pu239 fissions in a known thermal-neutron flux, and the number of U235 fissions in a neutron fluxfroma Ra-α-Be standard source. The proton flux was determined by measuring the absolute number of β-disintegrations of Na24 occurring in the Al27 (p. 3pn) Na24 reaction (whose cross-section is known with an accuracy of ± 5%), using a scintillation gamma-spectrometer. Samples were irradiated both in an external proton beam and within the chamber of the synchrocyclotron. The fission cross-sections were measured in rhe proton energy range 150-660 MeV. The corrections applied are discussed. The results of the measurements are compared with earlier figures, and the dependence of fissility of the nuclei investigated Dn the parameter Z2/A is determined. (author)

  15. Resolution 197/012. It replaces the wording of Annex III of the Regulation of Technical Specifications for Quality of Liquid Fuels, approved by Resolution of the URSEA 150/008

    International Nuclear Information System (INIS)

    This resolution is about modifications made in the regulation of technical specifications in the quality of liquid fuels, approved by Resolution of the URSEA 150/008. These modifications concern to the Especial Oil gas

  16. Search for the ring-like structures in the emission of secondary particles in central 197Au collisions with emulsion nuclei at 11.6A GeV/c

    International Nuclear Information System (INIS)

    Angular spectra of the relativistic secondary particles produced in Au+Em nuclear collisions at 11.6A GeV/c are analyzed by the method of continuous wavelet transform in order to search for the ring-like structures which could indicate either the production of Cherenkov gluons or the occurrence of Mach shock waves in excited nuclear matter. The analysis is based on the assumption that the presence of the above-mentioned effects would be manifested by excess of particles at some characteristic pseudorapidities. In addition, the involved particles are expected to be azimuthally uniformly distributed. The irregularities are revealed in the wavelet pseudorapidity spectra in the scale pseudorapidity region up to 0.5. These irregularities are interpreted as the preferred pseudorapidities of groups of emitted particles. The performed study of the azimuthal structure of the above-mentioned pseudorapidity irregularities suggests that they are not related to the sought ring-like structures

  17. Multibeam collection for KN197-05: Multibeam data collected aboard Knorr from 2010-03-14 to 2010-03-28, departing from Fortaleza, Brazil and returning to Cape Town, South Africa

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  18. Multibeam collection for KN197-06: Multibeam data collected aboard Knorr from 2010-04-04 to 2010-04-23, departing from Cape Town, South Africa and returning to Cape Town, South Africa

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  19. Multibeam collection for KN197-10: Multibeam data collected aboard Knorr from 2010-07-10 to 2010-08-01, departing from Ponta Delgada, Azores and returning to Woods Hole, MA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  20. 197荞麦多酚对谷氨酸和红藻氨酸诱导的海马神经元死亡的抑制作用

    Institute of Scientific and Technical Information of China (English)

    喻剑华

    2005-01-01

    @@ 荞麦Fagopyrum esculentum Moench多酚(BWP)具有改善大鼠空间记忆损害和反复脑缺血造成的细胞凋亡等作用,但作用机理不明.作者研究了BWP对谷氨酸和红藻氨酸致原代培养海马神经元死亡的作用.

  1. CORRIGENDUM to J Exp Integr Med 2013; 3(3: 191-197 - ETB receptor activation as a mechanism of modulation of inflammatory pain and neurogenic inflammation in the temporomandibular joint of capsaicin-treated rats

    Directory of Open Access Journals (Sweden)

    Thiago E. V. Lemos

    2014-02-01

    Full Text Available The Publisher and the Editorial Board regrets to declare an obligatory modification in the author list of the above manuscript originally published in the July 2013 issue (Volume 3, Issue 3 of the Journal. Three months after publication in both print and online forms, the author in the third order of the first published version contacted the Editorial Board and declared that he did not participate to this work and requested his name to be removed from the author list. During submission, the Journal of Experimental and Integrative Medicine requests a clear statement that all authors are aware of the work, as was done for this particular article; thus, neither the Publisher nor the editors are responsible for this unwanted condition. This one-page publication corrects and updates the author list for the above-mentioned paper. The same correction was also done in the web page of the Journal (www.jeim.org/?mno=34844, however, the PDF-document remained unchanged as the same in the print version of the Journal. [J Exp Integr Med 2014; 4(1.000: 74-74

  2. A randomized, placebo-controlled, phase 1/2 study of tivantinib (ARQ 197) in combination with irinotecan and cetuximab in patients with metastatic colorectal cancer with wild-type KRAS who have received first-line systemic therapy.

    Science.gov (United States)

    Eng, Cathy; Bessudo, Alberto; Hart, Lowell L; Severtsev, Aleksey; Gladkov, Oleg; Müller, Lothar; Kopp, Mikhail V; Vladimirov, Vladimir; Langdon, Robert; Kotiv, Bogdan; Barni, Sandro; Hsu, Ching; Bolotin, Ellen; von Roemeling, Reinhard; Schwartz, Brian; Bendell, Johanna C

    2016-07-01

    Cetuximab in combination with an irinotecan-containing regimen is a standard treatment in patients with KRAS wild-type (KRAS WT), metastatic colorectal cancer (mCRC). We investigated the addition of the oral MET inhibitor tivantinib to cetuximab + irinotecan (CETIRI) based on preclinical evidence that activation of the MET pathway may confer resistance to anti-EGFR therapy. Previously treated patients with KRAS WT advanced or mCRC were enrolled. The phase 1, open-label 3 + 3, dose-escalation study evaluated the safety and maximally tolerated dose of tivantinib plus CETIRI. The phase 2, randomized, double-blinded, placebo-controlled study of biweekly CETIRI plus tivantinib or placebo was restricted to patients who had received only one prior line of chemotherapy. The phase 2 primary endpoint was progression-free survival (PFS). The recommended phase 2 dose was tivantinib (360 mg/m(2) twice daily) with biweekly cetuximab (500 mg/m(2) ) and irinotecan (180 mg/m(2) ). Among 117 patients evaluable for phase 2 analysis, no statistically significant PFS difference was observed: 8.3 months on tivantinib vs. 7.3 months on placebo (HR, 0.85; 95% confidence interval, 0.55-1.33; P = 0.38). Subgroup analyses trended in favor of tivantinib in patients with MET-High tumors by immunohistochemistry, PTEN-Low tumors, or those pretreated with oxaliplatin, but subgroups were too small to draw conclusions. Neutropenia, diarrhea, nausea and rash were the most frequent severe adverse events in tivantinib-treated patients. The combination of tivantinib and CETIRI was well tolerated but did not significantly improve PFS in previously treated KRAS WT mCRC. Tivantinib may be more active in specific subgroups. PMID:26891420

  3. Results from two years of Matricaria inodora L. and Matricaria chamomilla L. monitoring (2012 + 2013) – greenhouse efficacy trials with Tribenuron and Florasulam and ALS target site resistance test at Pro 197 and Thr 574

    OpenAIRE

    Tiede, Anke; Dzikowski, Marcin; Becker, Jörg; Wittrock, Arndt

    2014-01-01

    The first ALS resistant Matricaria chamomilla (MATCH) biotype was found in 2006 in Schleswig Holstein in Witzwort (SCHLEICH-SAIDFAR et al., 2011). Since 2006 ALS resistant Matricaria chamomilla and Matricaria inodora (MATIN) were found at other locations near the North Sea coastline in Schleswig-Holstein and Lower Saxony (ULBER et al., 2012). As there were more and more cases of reduced efficacy of sulfonylureas on mayweed, Dow AgroSciences decided in 2012 and 2013 to test MATCH and MATIN sam...

  4. Cédric Lomba et Julian Mischi, « Usines. Ouvriers, militants, intellectuels », Actes de la recherche en sciences sociales, n° 196-197, mars 2013

    OpenAIRE

    Quijoux, Maxime

    2013-01-01

    Dans un contexte social marqué par la multiplication des restructurations et la destruction massive d’emplois industriels, la dernière parution des Actes constitue non seulement une livraison bienvenue sur le monde ouvrier, mais judicieuse au regard de l’approche choisie. Bienvenue, car, si les mobilisations ouvrières suscitent aujourd’hui une intense couverture médiatique, l’usine et ses acteurs ont connu une relégation importante en tant qu’objet d’étude dans les sciences sociales. Pertinen...

  5. Shelf-life of ɛ-lysyl-3-(trimethylstannyl)benzamide immunoconjugates, precursors for 211At labeling of antibodies

    DEFF Research Database (Denmark)

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per;

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity ...

  6. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  7. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    International Nuclear Information System (INIS)

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons

  8. Separation of 211At from irradiated bismuth target and labelling of a model protein

    International Nuclear Information System (INIS)

    Astatine-211 is a promising radionuclide for therapeutic use in nuclear medicine. An efficient method (70%) for radiochemical separation from the irradiated Bi-target has been described. The level of Bi contamination in the purified 2'11At-solution was estimated. Finally labelling of a model protein has been tried. (author). 14 refs

  9. Protein (Cyanobacteria): 348661 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available C7001_197 Cyanobium sp. PCC 7001 MSPGADLPDLNVWLALASSQHIHHRQALHYWEQLAAEQVLFCTVTALGLVRLVSQPRLMGDAVKNAAEASELLAAFCRQPGVALAPAEHDGWDVFHRLMRKGELPPRLCTDAHLAALAMTHGWRLVSFDRDFKRFEGLHWLALS ...

  10. Hurdles for a Broader Use of 211At and for the Synthesis of 211At-Labelled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    One of the key impediments to the use of 211At is the very well known deleterious effect of high radiation fields caused by its alpha particles on the synthesis of 211At-labelled radiopharmaceuticals. This is problematic because radiolysis-mediated effects can produce diminishing efficiency of electrophilic astatination reactions due to increasing deposition of radiation dose with increasing activities and with the passage of the time. Astatine-211 has chemical properties that permit complex labelling strategies and a longer half-life than 213Bi that makes it more suitable when the targeting molecule does not gain immediate access to the tumour cells. The first clinical evaluation was published in 2001 [2] in patients with brain tumour. Although this study circumvents many of the challenges to entering clinical studies with 211At and many obstacles had to be surmounted before clinical studies could be initiated, several problems were encountered in maintaining efficient labelling with escalating radiation dose of α-particle even with fresh 211At elution [3]. Astatine-211 also has an additional hurdle to overcome before to its clinical application in labelled radiopharmaceuticals related with its production and distribution. Among the potential group of promising α- emitter it is the only one produced by cyclotrons, but due to the scarcity of cyclotrons equipped with 25−30 MeV α-particle beams, it will of necessity be utilized in distant locations from the site of production. It presents a major chemical challenge because the diminishing efficiency of electrophilic astatination reactions with the passage of the time is well known, a problem likely related to the radiolysis produced by the high LET (linear energy transfer) meaning that large amounts of energy are deposited in a highly localized manner. This problem has been most comprehensively investigated to understand and evaluate the role of the radiolysis effects of astatine alpha particles in the synthesis

  11. Evolution and diversity of the mechanisms endowing resistance to herbicides inhibiting acetolactate-synthase (ALS) in corn poppy (Papaver rhoeas L.)

    OpenAIRE

    Delye, Christophe; Pernin, Fanny; Scarabel, Laura

    2011-01-01

    We investigated the diversity of mechanisms conferring resistance to herbicides inhibiting acetolactate synthase (ALS) in corn poppy (Papaver rhoeas L.) and the processes underlying the selection for resistance. Six mutant ALS alleles, Arg197, His197, Leu197, Ser197, Thr197 and Leu574 were identified in five Italian populations. Different alleles were found in a same population or a same plant. Comparison of individual plant phenotype (herbicide sensitivity) and genotype (amino-acid substitu...

  12. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  13. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  14. New data on cross-sections of deuteron induced nuclear reactions on gold up to 50 MeV and comparison of production routes of medically relevant Au and Hg radioisotopes

    CERN Document Server

    Tárkányi, F; Ditrói, F; Takács, S; Adam-Rebeles, R

    2016-01-01

    Investigations of cross-sections of deuteron induced nuclear reactions on gold were extended up to 50 MeV by using the standard stacked foil irradiation technique and high resolution gamma-ray spectrometry. New cross-sections are reported for the $^{197}$Au(d,xn)$^{197m,197g,195m,195g,193m,193g}$Hg and $^{197}$Au(d,x)$^{198m,198g,196m,196g,195,194}$Au nuclear reactions. The application for production of the medically relevant isotopes $^{198}$Au and $^{195m,195g,197m,197g}$Hg is discussed, including the comparison with other charged particle induced production routes. The possible use of the $^{197}$Au(d,x)$^{197m,197g,195m,193m}$Hg and $^{196m,196g}$Au reactions for monitoring deuteron beam parameters is also investigated.

  15. Radiopharmaceutical Chemistry of Targeted Radiopharmaceutics. Synthesis of 211At-Labeled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    Targeted α-particle radiotherapy is an appealing approach to cancer treatment because of the potential for delivering curative doses of radiation to tumor with minimal damage to normal tissue due to a range equivalent to only a few cell diameters. Compared with β-emitters they have significant advantages from a radiobiological perspective. The LET of 211At α-particles is more than 400 times higher than the β-particles emitted by 90Y, in addition the distance between ionizing events is almost the same as that between the two strands of DNA, yielding a high probability of creating non-repairable DNA damage. It gives the ability to kill cancer cells not compromised by hypoxia, dose rate effects or cell cycle position, enhancing their attractiveness for targeted radiotherapy. However, translation of the concept to the clinic has been slow, many obstacles had to be surmounted before clinical studies could be initiated, the first clinical evaluation of a 211At- labeled mAb was made in 2001. This study circumvents many of the challenges to entering clinical studies with 211At. But several problems were encountered in maintaining efficient labeling with escalating radiation dose of alpha-particle likely related to radiolysis. The impact of the radiolysis produced by the α-particle over the labeling chemistry is much higher in comparison with typical β-emitters due to a deposition of energy in the solvent in a highly localized manner two orders of magnitude per unit volume higher than 90Y or 131I. Due to these difficulties a comprehensive basic science study about the radiolytic effects of astatine alpha-particles over the synthesis of 211At-labeled radiopharmaceuticals was carried out. Its main goal was overcoming the problem of the synthesis of 211At-labeled radiopharmaceuticals at the high activities necessaries for therapy and also to extend the shelf life of astatine elutions. Briefly this study held several steps, the first one was to study the role of solvent

  16. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    International Nuclear Information System (INIS)

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211At and 124I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[211At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[211At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [124I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[124I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of macromolecules

  17. 211At production and recovery: first results of a new start

    International Nuclear Information System (INIS)

    Full text: 211At is the only alpha-emitting isotope which can be introduced into organic molecular structures by covalent chemical binding and possesses superior decay characteristics for therapeutic applications when compared with other alpha emitters. However, its production requires a minimum of 27,5 MeV alpha-particles, which are relatively rarely available. In view of the revival of alpha-therapy approaches a production of 211At has been set up at the MHH cyclotron (MC-35). The first aim of this project was to establish a target- and work-up-system for the reliable production of several ten MBq-quantities of 211At for animal- and cell-research. An aluminum-target-system holds a 1.3 cm diameter Bi-disc of 0.25 mm thickness. The disk is pressed onto a the aluminum backing with 2 tons/cm2. The front is covered with a 125 μm Al foil, cooled by a He jet which is separated from the vacuum by a 250 μm Ti foil. Starting with 27.5 MeV alpha-particles the resulting target-energy is 25 MeV. This relatively low energy is chosen to avoid any contamination with 210At and 210Po in the first experimental period. A beam current of 10 μA for 15 min (9 mCoulomb) yields 16.4 MBq 211At theoretically. Astatine is recovered from the target by a dry distillation technique, using various gases as a transport support-medium. The small all-quartz distillation-apparatus is heated up to 900 oC. Astatine is recovered in a small cool able vessel containing various trapping media. Distillation and trapping can be monitored with small radioactivity monitors. The whole system fits in a cubical 0.5 m glove box. Continuous monitoring of the distillation process allowed to optimize the heating rate, the transport support-medium and its flow-rate. Various trapping solutions were tested for their efficiency. Different beam dispersion in the target seems to influence the release and distillation of astatine from the molten bismuth-target. Two different release patterns were observed. The first

  18. Dicty_cDB: Contig-U11757-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fi*KNCKFINIVLFKMEPPLELPTQRKRVIPSKFGILKRNAEI EAEKNRENLQQSSCFSHINEIGKEIGLEIWKIIDDST...i*KNCKFINIVLFKMEPPLELPTQRKRVIPSKFGILKRNAEI EAEKNRENLQQSSCFSHINEIGKEIGLEIWKIIDDSTI...NEIGKEIGLEIWKI 276 MEPPLELPTQRKRVIPSKFGILKRNAEIEAEKNRENLQQSSCFSHINEIGKEIGLEIWKI Sbj...ct: 1 MEPPLELPTQRKRVIPSKFGILKRNAEIEAEKNRENLQQSSCFSHINEIGKEIGLEIWKI 60 Query: 277 IDDSTIQKVPKVNHSTFETNKSYLLLM...6/197 (94%), Positives = 186/197 (94%) Frame = +1 Query: 97 MEPPLELPTQRKRVIPSKFGILKRNAEIEAEKNRENLQQSSCFSHI

  19. 46 CFR Appendix C to Subpart C to... - Medical Surveillance Guidelines for Benzene

    Science.gov (United States)

    2010-10-01

    ... principal effects of benzene exposure addressed in 46 CFR part 197, subpart C, appendix A, are pathological... specified in 46 CFR 197.560 is designed to observe, on a regular basis, blood indices for early signs of... required in 46 CFR 197.560. There are special provisions for medical tests in the event of...

  20. 46 CFR Appendix A to Subpart C to... - Sample Substance Safety Data Sheet, Benzene

    Science.gov (United States)

    2010-10-01

    .... (See 46 CFR 197.570(c).) VIII. Precautions for Safe Use, Handling, and Storage Benzene liquid is highly... in the past while employed by your current employer, your employer may be required by 46 CFR 197.560... protective clothing and equipment (See 46 CFR 197.575.) VII. Access to Records You or your representative...

  1. Vespignani, Giorgio, Iппoδρoμoς. Il circo di Costantinopoli nuova Roma dalla realtà alla storiografia, Fondazione Centro Italiano di Studi sull"Alto Medioevo, Spoleto, 2010, 303 páginas. ISBN: 978 88-7988-197-5

    OpenAIRE

    Jiménez Sánchez, Juan Antonio

    2010-01-01

    "El Circo Máximo es su templo, su hogar, su asamblea y la esperanza de todos sus deseos" (AmmiAnvs mArc., Res gest., XXVIII, 4, 29: eisque templum et habitaculum et contio et cupitorum spes omnis Circus est maximus). De este modo describió el historiador Amiano Marcelino, hacia el 382/397, la pasión que la plebe de Roma sentía hacia los espectáculos, especialmente hacia los ludi circenses. Se trata de una afición que se fue incrementando a lo largo de toda la historia del Imperio Romano, hast...

  2. Inclusive measurement of (p,πsup(-)xn) double charge exchange reactions on bismuth from threshold to 800 MeV

    International Nuclear Information System (INIS)

    The energy dependence of the total angle-integrated cross section for the production of astatine isotopes from (p,πsup(-)xn) double charge exchange reactions on bismuth (sup(209)Bi) was measured from 120 to 800 MeV using activation and radiochemical techniques. Chemical yields were estimated by direct radioassaying of sup(211)At activity in thin (approximately 1 mg/cmsup(2)), irradiated bismuth targets. Calculations of the contributions of secondary (2-step) reactions to these measured astatine yields were performed, based partially upon the observed sup(211)At activity although even at the highest energies, the contribution to products lighter than sup(207)At was negligible. These data for products with as many as 7 neutrons removed from the doubly coherent product (sup(210)At) display nearby gaussian shapes for the mass distributions of the astatine residues with the maximum occurring for about sup(204)At. The most probable momentum transfer deduced from these distributions for the initial πsup(-) production step was 335 MeV/c. The observed excitation functions display a behaviour similar to that observed for the yield of sup(210)Po from a (p,πsup(O)) reaction on sup(209)Bi, but radically different from that observed for inclusive πsup(-) reactions on a heavy nucleus. These data are discussed in terms of recent theoretical approaches to negative pion production from bismuth. In addition, a simple, schematic model is developed to treat the rapidly decreasing percentage of the total inclusive πsup(-) emission which is observed for this double charge exchange reaction. This model reflects the capacity of a nucleus to a source of internal energetic protons

  3. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    OpenAIRE

    BAYRAM, Ali

    1998-01-01

    In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 1...

  4. Human radiation studies: Remembering the early years: Oral history of Dr. Patricia Wallace Durbin, Ph.D., conducted November 11, 1994

    International Nuclear Information System (INIS)

    This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches

  5. Nuclear isomer separation

    International Nuclear Information System (INIS)

    Pure specimens of nuclear isomers are required for gamma-ray lasers. The author has selectively photoionized atoms containing isomeric nuclei of 197Hg. The isomers were produced by the 197Au(d, 2n)197Hg reaction and distilled. Three pulsed dye lasers were used to selectively ionize mercury atoms by double resonant three-step photoionization. Other isomer separation techniques and their limitations are discussed. (author)

  6. AcEST: DK961292 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0009_L13 623 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0009_L13. 5' end seq ... VMGKGGVGKSSTVNSVIGEKAAAVS 67 Query: 197 AFQSETMRTVLCSR VRAGFTLNIIDTPGLVEGLFVNDHALDTIRRSLLNKTIDVMIYVDR 376 ... VMGKGGVGKSSTVNSIIGERVVSIS 68 Query: 197 AFQSETMRTVLCSR VRAGFTLNIIDTPGLVEGLFVNDHALDTIRRSLLNKTIDVMIYVDR 376 ... VLGKGGVGKSSTVNSLIGEQVVRVS 65 Query: 197 AFQSETMRTVLCSR VRAGFTLNIIDTPGLVEGLFVNDHALDTIRRSLLNKTIDVMIYVDR 376 ... (5%) Frame = +2 Query: 161 NSLVGERVAVVSAFQSETMRTVLCSR VRAGFTLNIIDTPGLVEGLF---VNDHALDTIRR 331 NS++G ++A + ...

  7. Microscopic studies of radioactive Hg implanted in YBa2Cu3O6+x superconducting thin films

    International Nuclear Information System (INIS)

    YBa2Cu3O6+x (YBCO) superconducting thin films implanted with low doses of radioactive 197mHg and 199mHg isotopes were studied with a combination of nuclear and non-nuclear characterization techniques. We show that after implantation Hg lies on a unique site in the YBCO lattice and the critical temperature increases slightly with the increase of the 197Au concentration from the nuclear transmutation of 197Hg. (orig.)

  8. 绿花椰菜片剂中莱菔硫烷含量测定及对急性酒精性肝损伤的保护作用%Quantitative determination of sulforaphane from broccoli extract tablets and its role in the protection of acute liver injury induced by ethanol . Journal of Zhejiang University (Agric . & Life Sci .), 2013,39(2):197-202

    Institute of Scientific and Technical Information of China (English)

    李宝龙; 田思聪; 谭洁; 李冰; 陈镜羽; 单毓娟

    2013-01-01

    Summary Sulforaphane ( SFN) is an isothiocyanate ( ITC) which exists as a precursor of glucosinolate ( GS) in various cruciferous vegetables especially in broccoli . Sulforaphane has been regarded as a potential of anti‐cancer agent derived from diet , mostly because of its powerful induction of phase Ⅱ enzymes , and it is also acted as an antagonist of injury factors including lipopolysaccharide ( LPS) and homocysteine ( HCY) . The present study aims to explore whether broccoli extract , rich in sulforaphane , can protect the acute liver injury induced by ethanol in mice or not . The quantity of sulforaphane in broccoli extract was detected by high performance liquid chromatography ( HPLC) . Hematoxylin‐eosin ( HE) staining was used to determine the pathological changes in C 57BL/6 mice model with the acute liver injury induced by ethanol . The activities of alanine aminotransferase ( ALT) , aspartate aminotransferase ( AST) and alkaline phosphatase ( ALP) in serum of mice were measured using semi‐automatic biochemical analyzer . The results showed that the quantity of sulforaphane in the broccoli extract was 1 .26 mg/tablet . Liver masses in all sulforaphane treatment groups were obviously reduced which were presented as the sharply decreased ratio of liver mass/body mass . The seriously pathological evidence was observed in ethanol treatment group , while less changes were seen in the sulforaphane treatment groups . Sulforaphane could dramatically inhibit the activities of ALT , AST and ALP in serum of mice induced by ethanol , with more obvious suppression in the moderate ( 40 mg/kg) and high‐dose (80 mg/kg) groups , respectively . The result above indicates that the sulforaphane from broccoli extract tablets is able to protect the liver injury induced by ethanol .%  采用高效液相色谱法测定绿花椰菜水提物中莱菔硫烷的含量;以C57BL/6小鼠建立急性酒精性肝损伤模型,用苏木精‐伊红染色法( hematoxylin‐eosin staining , HE )检测莱菔硫烷对小鼠肝脏病理学的影响;采用半自动生化分析仪测定莱菔硫烷对肝脏丙氨酸氨基转移酶( alanine aminotransferase , ALT )、天门冬氨酸氨基转移酶( aspartate aminotransferase , AST)和碱性磷酸酶( alkaline phosphatase , ALP)活性的影响,以探讨绿花椰菜中的活性成分莱菔硫烷对急性酒精性肝损伤的保护作用畅结果表明:绿花椰菜水提物中莱菔硫烷的含量为1.26 mg/片;莱菔硫烷各剂量组均可明显降低酒精所致的肝质量增加,肝/体比值较酒精模型组明显下降( P<0.01);莱菔硫烷各剂量组均能减轻酒精对肝脏的病理学损伤,其中,高剂量莱菔硫烷组(80 mg/kg)的作用尤为明显;莱菔硫烷能明显抑制酒精对肝脏ALT、AST和ALP等特征性酶的诱导作用,其中40和80 mg/kg中、高剂量莱菔硫烷的保护作用更明显畅说明莱菔硫烷能保护酒精对肝脏的损伤.

  9. Molecular mechanism of ion transfer across the polarized liquid/liquid interface

    Czech Academy of Sciences Publication Activity Database

    Samec, Zdeněk; Trojánek, Antonín; Mareček, Vladimír

    2015-01-01

    Roč. 61, č. 3 (2015), s. 197-197. ISSN 0034-6691. [Annual Meeting of the Polarographic Society of Japan /61./. 24.11.2015-25.11.2015, Himeji] R&D Projects: GA ČR GA13-04630S Institutional support: RVO:61388955 Keywords : electrochemistry * electrochemical impedance spectroscopy Subject RIV: CG - Electrochemistry

  10. Identification of the two sex pheromone components of sugarcane borer, Diatraea flavipennella (Lepidoptera: Crambidae)

    Czech Academy of Sciences Publication Activity Database

    Mendonca, A. D. L.; Nascimento, R. R.; Kalinová, Blanka; Hoskovec, Michal; Silva, E. L. D.; Freitas, M. D. R. T. D.; Cabral Jr, C. R.; Silva, C. E. D.; Correia, A. M. D. O.; Santana, A. E. G.; Svatoš, Aleš

    Tours : International Society of Chemical Ecology, 2010. s. 197-197. [International Society of Chemical Ecology. Annual Meeting /26./. 31.07.2010-04.08.2010, Tours] Institutional research plan: CEZ:AV0Z40550506 Keywords : GC-EAD * GCxGC-TOFMS) * (Z)-11-hexadecenal Subject RIV: CC - Organic Chemistry

  11. Dicty_cDB: Contig-U12119-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available R380951_196( CR380951 |pid:none) Candida glabrata strain CBS138 c... 45 0.003 CP000592_300( CP000592 |pid:none) Ostreococcus lucima...kekv*kkkkmklkrlikclnli*elimfsfhcivnvliwll kstltvfvhmkkhhkvilv*vnsnhlvimvk*cylkmvnnvgvvqnvhlkslwnvvkimn ymmyk...atattgttgaacaaccagaaattcaaacatntgaacttttanatgcaatt 197 |||||||||||||||||||||||||||||||||||||||||||||||||||||...||||||| Sbjct: 138 aatggtgaaaatattgttgaacaaccagaaattcaaacatntgaacttttanatgcaatt 197 Query: 198 tctaaagatcttg...Sbjct: 187 gcttaaatntgatttaggagttaanaatgntttcattccnttgnanagtaaangntttga 246 Query

  12. Drug: D02106 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D02106 Drug Arsenic ... trioxide (JP16/USAN); Trisenox (TN) As2O3 197.8279 197.8414 Treatment of acu ... ics 429 Miscellaneous 4291 Other Antitumors D02106 Arsenic ... trioxide (JP16/USAN) Anatomical Therapeutic Chemic ... C AGENTS L01XX Other antineoplastic agents L01XX27 Arsenic ... trioxide D02106 Arsenic ... trioxide (JP16/USAN) Antin ...

  13. Intermittency in the heavy ion collisions at intermediate and high energies

    International Nuclear Information System (INIS)

    The method of scaled factorial moments is used to study fluctuations of the fragment-size distribution based on the quantum molecular dynamics model. From the calculation of 197Au (200 MeV/u) + 197Au central collision system, an intermittent pattern of fluctuations is found. In particular, the critical behavior is preliminarily discussed

  14. Toward Regular Arrays of Artificial Surface-Mounted Dipolar Molecular Rotors on Monolayer Covered Surfaces

    Czech Academy of Sciences Publication Activity Database

    Younes, Ali; Michl, Josef

    Praha: -, 2013. s. 197-197. [ESOR 2013. European Symposium on Organic Reactivity /14./. 01.09.2013-06.09.2013, Praha] EU Projects: European Commission(XE) 227756 - DIPOLAR ROTOR ARRAY Institutional support: RVO:61388963 Keywords : dipolar molecular rotors * axle-carrying connectors Subject RIV: CC - Organic Chemistry

  15. AMD study of multifragmentation

    International Nuclear Information System (INIS)

    197Au+197Au collisions at 150 and 250 MeV/u are analyzed with AMD-V model which takes into account the quantum branching due to wave packet splitting in addition to the two-nucleon collision process. The effect of coalescence is discussed. The reproduction of the data by the theory is good. (orig.)

  16. Scenedesmus quadricauda - a promising microorganism for selenium-enriched algal biomass production

    Czech Academy of Sciences Publication Activity Database

    Doušková, Irena; Umysová, Dáša; Vítová, Milada; Doucha, Jiří; Zachleder, Vilém

    Palermo : European Federation for Freshwater Sciences, 2007, s. 197-197. [Symposium for European Freshwater Sciences /5./. Palermo (IT), 08.07.2007-13.07.2007] R&D Projects: GA MŠk OE 221; GA AV ČR IAA600200701 Institutional research plan: CEZ:AV0Z50200510 Keywords : scenedesmus quadricauda Subject RIV: EE - Microbiology, Virology

  17. A hybrid model for the investigation of heavy ion collisions at intermediate energies

    International Nuclear Information System (INIS)

    The following topics were dealt with: The coupling of the Botzmann-Uehling-Uhlenbeck (BUU) model with Kopenhagen multifragmentation model realising a new hybrid model, application on 197Au+197Au reactions between 100 and 250 A.MeV, calculation of the chracteristics of the fragmentation system including mass number, excitation energy, angular momenta, two-particle correlation function

  18. 46 CFR Appendix D to Subpart C to... - Sampling and Analytical Methods for Benzene Monitoring-Measurement Procedures

    Science.gov (United States)

    2010-10-01

    ... CFR part 197, subpart C. There are a number of methods available for monitoring employee exposures to... accuracy and precision requirements of 46 CFR 197.540(a)(6) for the weather conditions expected. Section... portion of urethane foam. The activated charcoal is prepared from coconut shells and is fired at 600...

  19. Drug: D00059 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D00059 Drug Levodopa (JP16/USP/INN); Dopar (TN) C9H11NO4 197.0688 197.1879 D00059.gif Antiparkinson...4728(1812+1813+1814+1815+1816) Dopaminergic synapse map07057 Antiparkinsonian age... 11 Agents affecting central nervous system 116 Antiparkinsonian agents 1164 Levodopas D00059 Levodopa (JP16

  20. Stability of excited nuclei in a dynamical simulation

    International Nuclear Information System (INIS)

    We investigate the stability of excited 197Au nuclei with respect to multifragmentation using a dynamical simulation based on molecular dynamics and restructured aggregation. We focus attention on 3 kinds of excitations: heat, compression and rotation. We also study the influence of a geometrical perturbation created when a projectile drills a hole in a 197Au nucleus

  1. Střednědobá makroekonomická predikce: makroekonomické modely v analytickém systému ČNB

    Czech Academy of Sciences Publication Activity Database

    Beneš, J.; Vávra, David; Vlček, J.

    2002-01-01

    Roč. 52, č. 4 (2002), s. 197-231. ISSN 0015-1920 Keywords : monetary policy * central bank * medium-term macroeconomic modeling Subject RIV: AH - Economics Impact factor: 0.222, year: 2002 http://journal.fsv.cuni.cz/storage/287_197_231.pdf

  2. EST Table: CN211900 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CN211900 rzhswab0_002080 10/09/28 88 %/197 aa ref|NP_001093316.1| adiponectin recep...tor [Bombyx mori] gb|ABK57116.2| adiponectin receptor [Bombyx mori] 10/09/01 73 %/197 aa FBpp0151302|DgriGH1

  3. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  4. A route for polonium 210 production from alpha-particle irradiated bismuth-209 target

    International Nuclear Information System (INIS)

    A method is proposed for production of polonium-210 via the 209Bi(α,3n)210 At nuclear reaction. Bombardment of a bismuth-209 target was performed with a 37 MeV alpha-particle beam that leads to the production of astatine-210 (T1/2 = 8.1 h), which decays to polonium-210. It is purified from the bismuth target matrix by employing liquid-liquid extraction using tributyl phosphate (TBP) in para-xylene from 7 M hydrochloric acid. Back extraction of polonium-210 was performed by 9 M nitric acid. This method allows to purify a tracer amount of Po-210 (2.6 x 10-13 mol) from macroscopic amount of Bi (2.8 x 10-2 mol).

  5. Effective bond orders from two-step spin–orbit coupling approaches: The I{sub 2}, At{sub 2}, IO{sup +}, and AtO{sup +} case studies

    Energy Technology Data Exchange (ETDEWEB)

    Maurice, Rémi, E-mail: remi.maurice@subatech.in2p3.fr; Montavon, Gilles [SUBATECH, CNRS UMR 6457, IN2P3/EMN Nantes/Université de Nantes, 4 rue Alfred Kastler, BP 20722, 44307 Nantes Cedex 3 (France); Réal, Florent; Gomes, André Severo Pereira; Vallet, Valérie [Laboratoire PhLAM, CNRS UMR 8523, Université de Lille, 59655 Villeneuve d’Ascq Cedex (France); Galland, Nicolas [CEISAM, UMR CNRS 6230, Université de Nantes, 2 rue de la Houssinière, BP 92208, 44322 Nantes Cedex 3 (France)

    2015-03-07

    The nature of chemical bonds in heavy main-group diatomics is discussed from the viewpoint of effective bond orders, which are computed from spin–orbit wave functions resulting from spin–orbit configuration interaction calculations. The reliability of the relativistic correlated wave functions obtained in such two-step spin–orbit coupling frameworks is assessed by benchmark studies of the spectroscopic constants with respect to either experimental data, or state-of-the-art fully relativistic correlated calculations. The I{sub 2}, At{sub 2}, IO{sup +}, and AtO{sup +} species are considered, and differences and similarities between the astatine and iodine elements are highlighted. In particular, we demonstrate that spin–orbit coupling weakens the covalent character of the bond in At{sub 2} even more than electron correlation, making the consideration of spin–orbit coupling compulsory for discussing chemical bonding in heavy (6p) main group element systems.

  6. Effective bond orders from two-step spin–orbit coupling approaches: The I2, At2, IO+, and AtO+ case studies

    International Nuclear Information System (INIS)

    The nature of chemical bonds in heavy main-group diatomics is discussed from the viewpoint of effective bond orders, which are computed from spin–orbit wave functions resulting from spin–orbit configuration interaction calculations. The reliability of the relativistic correlated wave functions obtained in such two-step spin–orbit coupling frameworks is assessed by benchmark studies of the spectroscopic constants with respect to either experimental data, or state-of-the-art fully relativistic correlated calculations. The I2, At2, IO+, and AtO+ species are considered, and differences and similarities between the astatine and iodine elements are highlighted. In particular, we demonstrate that spin–orbit coupling weakens the covalent character of the bond in At2 even more than electron correlation, making the consideration of spin–orbit coupling compulsory for discussing chemical bonding in heavy (6p) main group element systems

  7. Different ways to improve the clinical effectiveness of radioimmunotherapy in solid tumors

    Directory of Open Access Journals (Sweden)

    Chatal Jean-Francois

    2009-09-01

    Full Text Available Radioimmunotherapy (RIT has been proven effective in the treatment of radiosensitive non-Hodgkin lymphoma but, for radioresistant solid tumors, new approaches are necessary to improve the clinical effectiveness. A real improvement has been the introduction of the pretargeting technology which appeared to be able to significantly increase tumor-to-normal organ uptake ratios.Another very promising approach consists in associating RIT with other treatment modalities. Finally the use of alpha particle-emitting radionuclides such as astatin-211 or bismuth-213 (alpha-RIT should allow to efficiently eradicate disseminated microscopic clusters of tumor cells or isolated tumor cells which fit well with the short path length of alpha particles.

  8. Sequential radioimmunotherapy with 177Lu- and 211At-labeled monoclonal antibody BR96 in a syngeneic rat colon carcinoma model

    DEFF Research Database (Denmark)

    Eriksson, Sophie E; Elgström, Erika; Bäck, Tom;

    2014-01-01

    UNLABELLED: Alpha-particle emitters, such as astatine-211 (211At), are generally considered suitable for the treatment of small cell clusters due to their short path length, while beta-particle emitters, for example, Lutetium-177 (177Lu), have a longer path length and are considered better for...... small, established tumors. A combination of such radionuclides may be successful in regimens of radioimmunotherapy. In this study, rats were treated by sequential administration of first a 177Lu-labeled antibody, followed by a 211At-labeled antibody 25 days later. METHODS: Rats bearing solid colon...... carcinoma tumors were treated with 400 MBq/kg body weight 177Lu-BR96. After 25 days, three groups of animals were given either 5 or 10 MBq/kg body weight of 211At-BR96 simultaneously with or without a blocking agent reducing halogen uptake in normal tissues. Control animals were not given any 211At-BR96...

  9. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  10. Development of 211At Chemistry for Labelling Biomolecules

    International Nuclear Information System (INIS)

    Our studies have demonstrated that high recovery of 211At can be obtained using a “wet chemistry” approach to isolation from the bismuth target. We have also demonstrated that direct labelling of antibody-B10 conjugates with 211At can be performed in high yields, and that the astatinated antibodies are stable to in vivo deastatination. While these results will allow us to enter clinical studies with 211At-labelled antibodies, the chemistry associated with 211At is not fully understood. Therefore, it is important that many more basic studies to be conducted with 211At, so the optimal labelling reagent for each type of disease-targeting agent becomes apparent

  11. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena;

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... levels of γH2AX decreased during the first 24h in both cycling and stationary cultures and complete repair was seen in all cultures but cycling cells exposed to (211)At. Compared to stationary cells alpha particles were more harmful for cycling cultures, an effect also seen at the pChk2 levels...... cultures at a modest level of damage, clearly demonstrating that cell cycle status influences the relative effectiveness of alpha particles....

  12. An improved synthesis of an 125I and 211At labelled benzamide for melanoma imaging

    International Nuclear Information System (INIS)

    Recent studies have indicated that benzamides can exhibit affinity for malignant melanoma and may be exploited diagnostically in the treatment of this cancer. Radioiodinated N-(2-diethylaminoethyl)-3-[123I/131I]iodo-4-methoxybenzamide (*I-IMBA) is a benzamide with promising diagnostic properties. A new synthesis procedure was developed to obtain 125I-IMBA suitable for use in vivo. The assets of the procedure include the use of less toxic reagents and better reproducible results when radiolabelling the precursor. The procedure also facilitates the synthesis of the astatinated N-(2-diethylaminoethyl)-3-[211At]astatine-4-methoxybenzamide (211At-AMBA), a new benzamide with a therapeutic potential. The regiospecific no-carrier-added 125I- and 211At-labeling of the benzamide is performed by demetalation of an organotin precursor. Using tributylstannyl as a leaving group, the radiochemical yield obtained after 15 minutes of reaction was 70 %-90 % for both 125I-IMBA and 211At-AMBA. The labelling was performed in a solution of MeOH:AcOH with NCS as the oxidising agent. The organotin precursor N-(2-diethylaminoethyl)-3-(tri-n-butylstannyl)-4-methoxy-benzamide was synthesized from 3-bromo-4-methoxybenzoic acid, with n-BuLi (2 eq) and Bu3SnCl (1 eq) in THF, giving 3-(tri-n-butylstannyl)-4-methoxybenzoic acid. The amide function was introduced by converting the acid group into an active N-succinimidyl-ester, a good leaving group in the reaction with 2-(diethylamino)ethylamine. The overall yield of the organotin precursor was 65 %

  13. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Energy Technology Data Exchange (ETDEWEB)

    Marsh, B.A., E-mail: bruce.marsh@cern.ch [CERN, CH-1211 Geneva (Switzerland); Andel, B. [Comenius University, Bratislava (Slovakia); Andreyev, A.N. [University of York, Department of Physics, York YO10 5DD (United Kingdom); Antalic, S. [Comenius University, Bratislava (Slovakia); Atanasov, D. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Barzakh, A.E. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, 188300 Gatchina (Russian Federation); Bastin, B. [Grand Accérateur National d’Ions Lourds (GANIL), Bd Henri Becquerel, F-14076 Caen (France); Borgmann, Ch. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Capponi, L. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Cocolios, T.E.; Day Goodacre, T. [CERN, CH-1211 Geneva (Switzerland); University of Manchester, Manchester (United Kingdom); Dehairs, M. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Derkx, X. [University of the West of Scotland, School of Engineering, Paisley PA1 2BE (United Kingdom); De Witte, H. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fedorov, D.V. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, 188300 Gatchina (Russian Federation); Fedosseev, V.N.; Focker, G.J. [CERN, CH-1211 Geneva (Switzerland); Fink, D.A. [Ruprecht-Karls Universität, Seminarstr. 2, 69117 Heidelberg (Germany); CERN, CH-1211 Geneva (Switzerland); Flanagan, K.T. [University of Manchester, Manchester (United Kingdom); Franchoo, S. [CSNSM-IN2P3-CNRS, Université Paris-Sud, 91406 Orsay (France); and others

    2013-12-15

    Highlights: • Upgrade of the lasers, detectors and data acquisition for in-source resonance ionization spectroscopy at ISOLDE. • First use of the ISOLTRAP MR-ToF MS in combination with laser spectroscopy at ISOLDE. • Resonance ionization of astatine for the study of its nuclear structure. -- Abstract: At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  14. Concomitant administration of Mycobacterium bovis BCG with the meningococcal C conjugate vaccine to neonatal mice enhances antibody response and protective efficacy.

    Science.gov (United States)

    Brynjolfsson, Siggeir F; Bjarnarson, Stefania P; Mori, Elena; Del Giudice, Giuseppe; Jonsdottir, Ingileif

    2011-11-01

    Mycobacterium bovis BCG is administered to human neonates in many countries worldwide. The objective of the study was to assess if BCG could act as an adjuvant for polysaccharide-protein conjugate vaccines in newborns and thereby induce protective immunity against encapsulated bacteria in early infancy when susceptibility is high. We assessed whether BCG could enhance immune responses to a meningococcal C (MenC) conjugate vaccine, MenC-CRM(197), in mice primed as neonates, broaden the antibody response from a dominant IgG1 toward a mixed IgG1 and IgG2a/IgG2b response, and increase protective efficacy, as measured by serum bactericidal activity (SBA). Two-week-old mice were primed subcutaneously (s.c.) with MenC-CRM(197). BCG was administered concomitantly, a day or a week before MenC-CRM(197). An adjuvant effect of BCG was observed only when it was given concomitantly with MenC-CRM(197), with increased IgG response (P = 0.002) and SBA (8-fold) after a second immunization with MenC-CRM(197) without BCG, indicating increased T-cell help. In neonatal mice (1 week old) primed s.c. with MenC-CRM(197) together with BCG, MenC-polysaccharide (PS)-specific IgG was enhanced compared to MenC-CRM(197) alone (P = 0.0015). Sixteen days after the second immunization with MenC-CRM(197), increased IgG (P CRM(197) plus BCG showed affinity maturation and detectable SBA (SBA > 128). Thus, vaccination with a meningococcal conjugate vaccine (and possibly with other conjugates) may benefit from concomitant administration of BCG in the neonatal period to accelerate and enhance production of protective antibodies, compared to the current infant administration of conjugate which follows BCG vaccination at birth. PMID:21900528

  15. Vliv učitele a podíl školy na pohybovou aktivitu dětí vedoucí ke zdraví

    Czech Academy of Sciences Publication Activity Database

    Blahutková, M.; Řehulka, Evžen

    -, č. 11 (2002), s. 197-199. ISSN 1210-5481 Institutional research plan: CEZ:AV0Z7025918 Keywords : health oriented physical education * well-being system * psychomotoric Subject RIV: AN - Psychology

  16. Poslední den světa v husitských vizích. Zjevení Martinovo

    Czech Academy of Sciences Publication Activity Database

    Cermanová; Libichová, Pavlína

    Praha: Nakladatelství Lidové noviny, 2014 - (Nodl, M.; Sommer, P.), s. 197-209 ISBN 978-80-7422-356-3 Institutional support: RVO:67985955 Keywords : Hussites * prophecies * visions literature Subject RIV: AB - History

  17. Ultrasonic investigations of brain in infants with some neurological diseases

    Science.gov (United States)

    Ulezko, E. A.; Shan'ko, G. G.

    1996-05-01

    The authors have studied 197 infants (1-12 months old) with normal psychomotor development and with various neurological disturbances. Neurosonography and dopplerometry were used to investigate the blood flow pattern and structural changes in the brain.

  18. Cr1/3Zr2P3O12 with unusual tetrahedral coordination of Cr(III): peculiarities of the formation, thermal stability and application as a pigment

    Czech Academy of Sciences Publication Activity Database

    Gorodylova, N.; Kosinová, V.; Šulcová, P.; Bělina, P.; Vlček, Milan

    2014-01-01

    Roč. 43, č. 41 (2014), s. 15439-15449. ISSN 1477-9226 Institutional support: RVO:61389013 Keywords : magnetic properties * crystal structure * cation distibution Subject RIV: CA - Inorganic Chemistry Impact factor: 4.197, year: 2014

  19. Two Protons Emissions From 17Ne Excited States

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    <正>The experiment 17Ne+197Au has been finished in Heavy Ion Research Facility Radioactive Ion Beam Line at Lanzhou (RIBLL). Through the total kinematic method of silicon strip detectors and CsI(Tl)+PIN

  20. Influence of the binding of reduced NAMI-A to human serum albumin on the pharmacokinetics and biological activity

    Czech Academy of Sciences Publication Activity Database

    Novohradský, Vojtěch; Bergamo, A.; Cocchietto, M.; Zajac, J.; Brabec, Viktor; Mestroni, G.; Sava, G.

    2015-01-01

    Roč. 44, č. 4 (2015), s. 1905-1913. ISSN 1477-9226 Institutional support: RVO:68081707 Keywords : CELL-CYCLE ARREST * RUTHENIUM COMPLEX * ANTICANCER AGENT Subject RIV: BO - Biophysics Impact factor: 4.197, year: 2014

  1. The Absence of Pupylation (Prokaryotic Ubiquitin-Like Protein Modification) Affects Morphological and Physiological Differentiation in Streptomyces coelicolor

    Czech Academy of Sciences Publication Activity Database

    Boubakri, H.; Seghezzi, N.; Duchateau, M.; Gominet, M.; Kofroňová, Olga; Benada, Oldřich; Mazodier, P.; Pernodet, J.-L.

    2015-01-01

    Roč. 197, č. 21 (2015), s. 3388-3399. ISSN 0021-9193 Institutional support: RVO:61388971 Keywords : PROTEASOMAL ATPASE HOMOLOG * MYCOBACTERIUM- TUBERCULOSIS * 20S PROTEASOME Subject RIV: EE - Microbiology, Virology Impact factor: 2.808, year: 2014

  2. The contrarotational fluxionality of [3,3-(PMe2Ph)(2)-closo-3,1,2-PtC2B9H11] and related species

    Czech Academy of Sciences Publication Activity Database

    Kennedy, R. G.; Kennedy, John David

    2015-01-01

    Roč. 44, č. 20 (2015), s. 9620-9629. ISSN 1477-9226 Institutional support: RVO:61388980 Keywords : Boron hydride derivatives * Crystal-structure * Metallaborane chemistry Subject RIV: CA - Inorganic Chemistry Impact factor: 4.197, year: 2014

  3. 9 CFR 94.23 - Importation of poultry meat and other poultry products from Sinaloa and Sonora, Mexico.

    Science.gov (United States)

    2010-01-01

    ... United States in accordance with 9 CFR 381.196. (b) If processed, the poultry meat or other poultry... accompanying the poultry meat or other poultry products (required by 9 CFR 381.197) includes...

  4. False Heraclitus. Heraclitean Dubia and Their Typology

    Czech Academy of Sciences Publication Activity Database

    Vítek, Tomáš

    2012-01-01

    Roč. 67, č. 3 (2012), s. 161-197. ISSN 0031-2355 Institutional support: RVO:67985955 Keywords : Heraclitus * Pre-Socratics * authenticity of sources * Ancient Greece Subject RIV: AA - Philosophy ; Religion

  5. 78 FR 50145 - Advisory Committee on Women Veterans, Notice of Meeting

    Science.gov (United States)

    2013-08-16

    ... Veterans with respect to health care, rehabilitation, compensation, outreach, and other programs and..., the Committee will convene an open session at the in the Bobbie Vance Classroom, Room 3A-197 at...

  6. Latest Achievements on Climate Change and Forest Interactions in a Polluted Environment

    Czech Academy of Sciences Publication Activity Database

    Carriero, G.; Tuovinen, J.-P.; Clarke, N.; Matteucci, G.; Matyssek, R.; Wieser, G.; Mikkelsen, J. D.; Fischer, R.; Cudlín, Pavel; Serengil, Y.; Boscaleri, F.; Calfapietra, Carlo; Feng, Z.; Paoletti, E.

    2014-01-01

    Roč. 4, č. 3 (2014), s. 197-207. ISSN 2163-0429 Institutional support: RVO:67179843 Keywords : air pollution * climate change * forests * supersites * COST * FP0903 Action Subject RIV: EH - Ecology, Behaviour

  7. Nové velké laserové projekty Evropské unie v ČR

    Czech Academy of Sciences Publication Activity Database

    Rohlena, Karel

    2010-01-01

    Roč. 60, č. 4 (2010), 197-198. ISSN 0009-0700 Institutional research plan: CEZ:AV0Z10100523 Keywords : diode pumped solid state lasers * repetative regime * high average power Subject RIV: BH - Optics, Masers, Lasers

  8. 2. The Data Librarian: introducing the Data Librarian

    OpenAIRE

    Liscouski, Joe

    1997-01-01

    This paper provides some initial considerations into the design and function of the Data Librarian. The first part (Liscouski, J., 1997, Journal of Automatic Chemistry, 19, 193-197) described the need for the Librarian.

  9. Re-Os and Lu-Hf isotopic constraints on the formation and age of mantle pyroxenites from the Bohemian Massif

    Czech Academy of Sciences Publication Activity Database

    Ackerman, Lukáš; Bizimis, M.; Haluzová, Eva; Sláma, Jiří; Svojtka, Martin; Hirajima, T.; Erban, V.

    256/257, July (2016), s. 197-210. ISSN 0024-4937 Institutional support: RVO:67985831 Keywords : Bohemian Massif * Lu-Hf * mantle * pyroxenite * Re-Os Subject RIV: DB - Geology ; Mineralogy Impact factor: 4.482, year: 2014

  10. Ladislav Holý a zkoumání českého národního charakteru

    Czech Academy of Sciences Publication Activity Database

    Uherek, Zdeněk

    Praha : Sociologické nakladatelství, 2001, s. 187-197 ISBN 80-85850-97-4 Institutional research plan: CEZ:AV0Z9058907 Keywords : social anthropology Subject RIV: AC - Archeology, Anthropology, Ethnology

  11. Using Emotional Intelligence in Personalized Adaptation

    NARCIS (Netherlands)

    Damjanovic, Violeta; Kravcik, Milos

    2008-01-01

    Damjanovic, V. & Kravcik, M. (2007). Using Emotional Intelligence in Personalized Adaptation. In M. D. Lytras & A. Naeve (Eds.), Ubiquitous and Pervasive Knowledge and Learning Management (pp. 158-197). IGI Publishing.

  12. Layered inorganic solids

    Czech Academy of Sciences Publication Activity Database

    Čejka, Jiří; Morris, R. E.; Nachtigall, P.; Roth, Wieslaw Jerzy

    2014-01-01

    Roč. 43, č. 27 (2014), s. 10274-10275. ISSN 1477-9226 Institutional support: RVO:61388955 Keywords : layered inorganic solids * physical chemistry * catalysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.197, year: 2014

  13. Městečko Rajhrad v letech 1848-1918: Spolkový a společenský život

    Czech Academy of Sciences Publication Activity Database

    Altman, Karel

    1. Rajhrad: Město Rajhrad, 2014, s. 197-229. ISBN 978-80-260-5803-8 Institutional support: RVO:68378076 Keywords : town * Rajhrad * 1848-1918 * social life * fellowship Subject RIV: AC - Archeology, Anthropology, Ethnology

  14. 76 FR 60130 - Unblocking of Specially Designated Nationals and Blocked Persons Pursuant to Executive Order 12978

    Science.gov (United States)

    2011-09-28

    ... de Jesus, Avenida 6N No. 47-197 17, Cali, Colombia; c/o INDUSTRIA MADERERA ARCA LTDA., Cali, Colombia..., Freddy Orlando (a.k.a. DOMINGUEZ GARIVELLO, Freddy Orlando), c/o INDUSTRIA AVICOLA PALMASECA S.A.,...

  15. Pedagogical Implications of Contrastive Studies

    Science.gov (United States)

    Marton, Waldemar

    1972-01-01

    Pessimism regarding pedagogical applications of contrastive studies, and reasons therefore, are described. Several misunderstandings believed to contribute to this pessimism, and several areas of controversy concerning uses of contrastive studies, are discussed. See FL 508 197 for availability. (RM)

  16. Complications of the post-chemotherapy resection of retroperitoneal residual tumour mass in patients with non-seminomatous testicular germ cell tumours

    NARCIS (Netherlands)

    Gels, ME; Nijboer, AP; Hoekstra, HJ; Sleijfer, DT; Molenaar, WM; Plukker, JT; Droste, JHJ; Schraffordt Koops, H.

    1997-01-01

    Objective To evaluate the resection of the retroperitoneal residual tumour mass (RRTM) for histological examination after chemotherapy in patients with disseminated non-seminomatous testicular germ cell tumours (NSTGCTs), with particular attention to surgical morbidity. Patients and methods From 197

  17. Černá vlajka pirátů znovu nahání strach? Opatření proti pirátství a ozbrojenému lupičství na moři na začátku 21. století

    Czech Academy of Sciences Publication Activity Database

    Šturma, Pavel

    2009-01-01

    Roč. 8, č. 7 (2009), s. 193-197. ISSN 1213-5313 Institutional research plan: CEZ:AV0Z70680506 Keywords : maritime law * public international law * fight against piracy Subject RIV: AG - Legal Sciences

  18. Measurement of neutron-induced activation cross-sections using spallation source at JINR and neutronic validation of the Dubna code

    Indian Academy of Sciences (India)

    Manish Sharma; V Kumar; H Kumawat; J Adam; V S Barashenkov; S Ganesan; S Golovatiouk; S K Gupta; S Kailas; M I Krivopustov; H S Palsania; V Pronskikh; V M Tsoupko-Sitnikov; N Vladimirova; H Westmeier; W Westmeier

    2007-02-01

    A beam of 1 GeV proton coming from Dubna Nuclotron colliding with a lead target surrounded by 6 cm paraffin produces spallation neutrons. A Th-foil was kept on lead target (neutron spallation source) in a direct stream of neutrons for activation and other samples of 197Au, 209Bi, 59Co, 115In and 181Ta were irradiated by moderated beam of neutrons passing through 6 cm paraffin moderator. The gamma spectra of irradiated samples were analyzed using gamma spectrometry and DEIMOS software to measure the neutron cross-section. For this purpose neutron fluence at the positions of samples is also estimated using PREPRO software. The results of cross-sections for reactions 232Th(, ), 232Th(, 2), 197Au(, ), 197Au(, ), 197Au(, ), 59Co(, ), 59Co(, ), 181Ta(, ) and 181Ta(, ) are given in this paper. Neutronics validation of the Dubna Cascade Code is also done using cross-section data by other experiments.

  19. A comparison of biologically active elements in geese in relation to avian cholera

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Avian cholera caused an estimated mortality of between 166,000 to 197,000 migrating waterfowl in the Rainwater Basin of Nebraska in the 10-year period 1975 through...

  20. Die Benennungen und Klassifikation der Hautkrankheiten im Mittelalter

    Czech Academy of Sciences Publication Activity Database

    Florianová, Hana

    -, č. 71 (2013), s. 197-207. ISSN 1376-7453 R&D Projects: GA MŠk(CZ) LD13043 Institutional support: RVO:67985955 Keywords : medieval medicine * medieval medical terminology * medieval Latin lexicography Subject RIV: AI - Linguistics

  1. EST data: 5872 [RED

    Lifescience Database Archive (English)

    Full Text Available RA0286 D23831 AU164531 DPlate 061 H02 TCGTGCACGCCGACGCGGTC TTGGTGAGGAAGTTGGCCTC >AC002329_18(AC0 ... nucleotide-disulphide oxidoreductases located from residues ... 197 to 219 [CAVCD...IGGGD]. ...

  2. EST data: 5857 [RED

    Lifescience Database Archive (English)

    Full Text Available RA0132 D23778 DPlate 061 A01 GCCGACCTCATGGACCGCTG GGTTCCAGAATGCGTCGGAG >AC002329_18(AC002329|pid ... nucleotide-disulphide oxidoreductases located from residues ... 197 to 219 [CAVCD...IGGGD]. ...

  3. 2010 U.S. Geological Survey (USGS) Topographic Lidar: Channel Islands, California

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Terrapoint collected LiDAR for 197 square miles covering five islands off the coast of Los Angeles, California. These islands are part of the Channel Islands...

  4. The Influence of Immunization Route, Tissue Microenvironment, and Cytokine Cell Milieu on HIV-Specific CD8+ T Cells Measured Using Fluidigm Dynamic Arrays

    OpenAIRE

    Trivedi, Shubhanshi; Ranasinghe, Charani

    2015-01-01

    Thirty different genes including cytokines, chemokines, granzymes, perforin and specifically integrins were evaluated in Peyer's patch-KdGag197–205-specific CD8+ T cells (pools of 100 cells) using Fluidigm 48.48 Dynamic arrays following three different prime-boost immunization strategies. Data revealed that the route of prime or the booster immunization differentially influenced the integrin expression profile on gut KdGag197–205-specific CD8+ T cells. Specifically, elevated numbers of integr...

  5. AcEST: DK959907 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0005_P10 703 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0005_P10. 5' end seq ... GKGQGKSFQCELVFAKMGINPIMMSAGELES 196 Query: 683 GNAGEPA ... 703 GNAGEPA ... Sbjct: 197 GNAGEPA ... 203 >sp|Q7X9A0|RCA1 ... GKGQGKSFQCELVFAKMGINPIMMSAGELES 196 Query: 683 GNAGEPA ... 703 GNAGEPA ... Sbjct: 197 GNAGEPA ... 203 >sp|Q40281|RCA_ ...

  6. New mammalian fossil records refining a view on Early/Late Pliocene faunal turnover in Central Europe

    Czech Academy of Sciences Publication Activity Database

    Wagner, Jan; Čermák, Stanislav

    2009-01-01

    Roč. 29, Supplement to 3 (2009), 197A-197A. ISSN 0272-4634. [Annual Meeting of the Society of Vertebrate Paleontology /69./. 23.09.2009-26.09.2009, Bristol] R&D Projects: GA ČR GA205/09/0184 Institutional research plan: CEZ:AV0Z30130516 Keywords : Pliocene * mammals * paleobiogeography Subject RIV: DB - Geology ; Mineralogy http://www.vertpaleo.org/publications/documents/abstractsbook2009.pdf

  7. New mammalian fossil records refining a view on Early/Late Pliocene faunal turnover in Central Europe

    Czech Academy of Sciences Publication Activity Database

    Wagner, Jan; Čermák, Stanislav; Horáček, I.; Fejfar, O.; Mihevc, A.

    2009-01-01

    Roč. 29, Supplement to number 3 (2009), 197A-197A. ISSN 0272-4634. [Annual Meeting Society of Vertebrate palaeontology and Comparative Anatomy (SVPCA) /69./ and Symposium of Vertebrate Palaeontology and Comparative Anatomy (SVPCA) /57./. 23.09.2009-26.09.2009, Bristol] R&D Projects: GA ČR GA205/09/0184 Institutional research plan: CEZ:AV0Z30130516 Keywords : Pliocene * mammals * paleobiogeography * biostratigraphy * biostratigraphy (Central Europe) * paleobiogeography (Central Europe) Subject RIV: EG - Zoology

  8. AcEST: DK948124 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0002_H19 617 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0002_H19. 5' end seq ... GMPHKFYHGR 60 Query: 197 TGVVWNVTKRAIGVEMNKQVNTRIVRKRI HVRIEHVQPSRCREDFIERVKKNDXXXXXXX 376 TG +WNVTKRA+GVE ... +NKQ+ RI+RKRI HVR+EHVQ SRC E+F R KKND Sbjct: 61 TGRIWNVTKRAVGVEVN ... KQIGNRIIRKRI HVRVEHVQQSRCAEEFKLRKKKNDELKAAAK 120 Query: 377 XXXX ... GMPHKFYHGR 60 Query: 197 TGVVWNVTKRAIGVEMNKQVNTRIVRKRI HVRIEHVQPSRCREDFIERVKKNDXXXXXXX 376 TG +WNVTKRA+GVE ...

  9. AcEST: DK963125 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0015_L03 614 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_L03. 5' end seq ... 197 (84%) Frame = +2 Query: 23 QVMLGVDRLDMIKGIPQKLLAFE KFLDENVEWRDKVQLVQIAVPTRTDVHDYQRLTSQVH 202 +VMLGVDRL ... DMIKGIPQK+LAFE KFL+EN WRDKV L+QIAVPTRTDV +YQ+LTSQVH Sbjct: 362 KVM ... LGVDRLDMIKGIPQKILAFE KFLEENANWRDKVVLLQIAVPTRTDVPEYQKLTSQVH 421 Query: 20 ... 197 (79%) Frame = +2 Query: 23 QVMLGVDRLDMIKGIPQKLLAFE KFLDENVEWRDKVQLVQIAVPTRTDVHDYQRLTSQVH 202 +V+LGVDRL ...

  10. Disassembly of hot nuclear matter formed in Au-induced reactions near the Fermi energy

    International Nuclear Information System (INIS)

    Complex fragment emission has been studied in the 60 MeV/A 197Au + 12C, 27Al, 51V, natCu, and 197Au reactions. Velocity spectra, angular distributions and cross sections have been constructed for each target from the inclusive data. Coincidence data including 2-, 3-, 4-, and 5-fold events have also been examined. Furthermore neutron multiplicity distributions have been obtained for the above reactions by utilizing a novel neutron calorimetric approach

  11. Investigation of nuclear multifragmentation using molecular dynamics and restructured aggregation

    International Nuclear Information System (INIS)

    We study the stability of excited 197 Au nuclei with respect to multifragmentation. For that we use a dynamical simulation based on molecular dynamics and restructured aggregation. A particular attention is paid to check the stability of the ground state nuclei generated by the simulation. Four kinds of excitations are considered: heat, compression, rotation and a geometrical instability created when a projectile drills a hole in a 197 Au nucleus

  12. Disassembly of hot nuclear matter formed in Au-induced reactions near the Fermi energy

    Energy Technology Data Exchange (ETDEWEB)

    Delis, D.N.

    1993-09-01

    Complex fragment emission has been studied in the 60 MeV/A {sup 197}Au + {sup 12}C, {sup 27}Al, {sup 51}V, {sup nat}Cu, and {sup 197}Au reactions. Velocity spectra, angular distributions and cross sections have been constructed for each target from the inclusive data. Coincidence data including 2-, 3-, 4-, and 5-fold events have also been examined. Furthermore neutron multiplicity distributions have been obtained for the above reactions by utilizing a novel neutron calorimetric approach.

  13. Target fragmentation at intermediate energies

    International Nuclear Information System (INIS)

    We report the results of measurements of the average target fragment momenta and energies in the interaction of 12.0 and 18.4 MeV/u 160, and 45.4 and 83.8 MeV/u 12C with 197Au. We compare these data with previously published studies of the interaction of 380 MeV/u 20Ne and 400 and 2100 MeV/u 12C with 197Au

  14. Improving the neutral phytase activity from Bacillus amyloliquefaciens DSM 1061 by site-directed mutagenesis.

    Science.gov (United States)

    Xu, Wei; Shao, Rong; Wang, Zupeng; Yan, Xiuhua

    2015-03-01

    Neutral phytase is used as a feed additive for degradation of anti-nutritional phytate in aquatic feed industry. Site-directed mutagenesis of Bacillus amyloliquefaciens DSM 1061 phytase was performed with an aim to increase its activity. Mutation residues were chosen based on multiple sequence alignments and structure analysis of neutral phytsaes from different microorganisms. The mutation sites on surface (D148E, S197E and N156E) and around the active site (D52E) of phytase were selected. Analysis of the phytase variants showed that the specific activities of mutants D148E and S197E remarkably increased by about 35 and 13% over a temperature range of 40-75 °C at pH 7.0, respectively. The k cat of mutants D148E and S197E were 1.50 and 1.25 times than that of the wild-type phytase, respectively. Both D148E and S197E showed much higher thermostability than that of the wild-type phytase. However, mutants N156E and D52E led to significant loss of specific activity of the enzyme. Structural analysis revealed that these mutations may affect conformation of the active site of phytase. The present mutant phytases D148E and S197E with increased activities and thermostabilities have application potential as additives in aquaculture feed. PMID:25613522

  15. Evaluation of the non-toxic mutant of the diphtheria toxin K51E/E148K as carrier protein for meningococcal vaccines.

    Science.gov (United States)

    Pecetta, S; Vijayakrishnan, B; Romano, M R; Proietti, D; Surdo, P Lo; Balocchi, C; Mori, E; Davis, B G; Berti, F

    2016-03-01

    Diphtheria toxin mutant CRM197 is a common carrier protein for glycoconjugate vaccines, which has been proven an effective protein vector for, among others, meningococcal carbohydrates. The wide-range use of this protein in massive vaccine production requires constant increase of production yields and adaptability to an ever-growing market. Here we compare CRM197 with the alternative diphtheria non-toxic variant DT-K51E/E148K, an inactive mutant that can be produced in the periplasm of Escherichia coli. Biophysical characterization of DT-K51E/E148K suggested high similarity with CRM197, with main differences in their alpha-helical content, and a suitable purity for conjugation and vaccine preparation. Meningococcal serogroup A (MenA) glycoconjugates were synthesized using CRM197 and DT-K51E/E148K as carrier proteins, obtaining the same conjugation yields and comparable biophysical profiles. Mice were then immunized with these CRM197 and DT-K51E/E148K conjugates, and essentially identical immunogenic and protective effects were observed. Overall, our data indicate that DT-K51E/E148K is a readily produced protein that now allows the added flexibility of E. coli production in vaccine development and that can be effectively used as protein carrier for a meningococcal conjugate vaccine. PMID:26845738

  16. Modal Decomposition of Synthetic Jet Flow Based on CFD Computation

    Directory of Open Access Journals (Sweden)

    Hyhlík Tomáš

    2015-01-01

    Full Text Available The article analyzes results of numerical simulation of synthetic jet flow using modal decomposition. The analyzes are based on the numerical simulation of axisymmetric unsteady laminar flow obtained using ANSYS Fluent CFD code. Three typical laminar regimes are compared from the point of view of modal decomposition. The first regime is without synthetic jet creation with Reynolds number Re = 76 and Stokes number S = 19.7. The second studied regime is defined by Re = 145 and S = 19.7. The third regime of synthetic jet work is regime with Re = 329 and S = 19.7. Modal decomposition of obtained flow fields is done using proper orthogonal decomposition (POD where energetically most important modes are identified. The structure of POD modes is discussed together with classical approach based on phase averaged velocities.

  17. Study of some properties of bound levels and virtual levels excited with resonance neutrons

    International Nuclear Information System (INIS)

    Many neutron resonance parameters of some nuclei with a spin value I 3/2 (35Cl, 37Cl, 63Cu, 65Cu, 197Au) are determined to find the strength function S0 with accuracy. For those nuclei, the S0 value seems not to depend on the spin value J=1 or 2 but could be depend on neutron energy for 197Au. Total radiative width variation against mass number A and spacing distributions between resonances (for 197Au) are studied and discussed. Analysis methods of neutron capture experiments are described in detail and level schemes of Cl, Mn, Fe, Co, Cu, Tm, Hg are presented sometimes with the spin value. Intensities of E1 and M1 transitions with direct capture and interference effects are discussed in view of experimental results. (author)

  18. Transmission measurements for heavy ion beams through the Rochester MP Tandem

    International Nuclear Information System (INIS)

    The transmission efficiency for heavy ions through the MP Tandem Van de Graaff at the University of Rochester was measured for 16O, 32S, 58Ni, and 197Au at terminal voltages of 8 MV, 10 MV, and 10.5 MV using gas stripping and high-speed cryogenic terminal pumping. For oxygen the transmission was close to 100%; for 197Au the transmission over the range of terminal voltage 8 to 10 MV was between 25 and 50%. No significant beam loading was measured when 4 μA of 197Au were injected, and there was no indication of a current limit at this intensity level. A comparison of the data with theoretical charge state distributions shows that multiple scattering losses in the terminal were not significant and that the vacuum in the high energy acceleration tubes was adequate

  19. The biokinetics of alpha-particle emitting radiopharmaceuticals

    International Nuclear Information System (INIS)

    The past two decades have seen wide interest in the application of alpha-particle emitting radionuclides for targeted endoradiotherapy and a large number of compounds labeled with 211At (T1/2 7.21 h), 212Bi (T1/2 1 h) or 213Bi (T1/2 0.78 h) have been studied. Knowledge of the biokinetic behaviour of such agents is important both for their optimal clinical exploitation and for general radiological protection purposes. Animal studies of the distribution and retention of 211At compounds, including ionic astatide, substituted aromatic compounds and labelled monoclonal antibodies, have provided new information on the biochemistry of astatine. With respect the thyroid gland the uptake of the astatide ion has been shown to be very much lower than that of the iodide ion. Less information is available for 212Bi-labelled radiopharmaceuticals. The available data for both 211At and 212Bi radiopharmaceuticals are reviewed. Cautious generic biokinetic models for inorganic and simple organic compounds of 211At and 212Bi; for [211At]-, and [212Bi]-biphosphonates and for [211At]-, and [212Bi]-monoclonal antibodies, are proposed for use in general radiological protection when compound-specific data are not available. (orig.)

  20. The radiolabeled monoclonal antibodies in immunoscintigraphy and radioimmunotherapy: current state and perspectives

    International Nuclear Information System (INIS)

    The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)

  1. Biological toxicity of intracellular radionuclide decay. Part of a coordinated programme on radiation biology of Auger emitters and their therapeutic applications

    International Nuclear Information System (INIS)

    Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125I-labelled Synkavit would be desirable for clinical application

  2. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  3. The biokinetics of alpha-particle emitting radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, D.M. [School of Chemistry, Cardiff Univ., Cardiff (United Kingdom); Duffield, J.R. [Faculty of Applied Sciences, Univ. of the West of England, Bristol (United Kingdom)

    2005-07-01

    The past two decades have seen wide interest in the application of alpha-particle emitting radionuclides for targeted endoradiotherapy and a large number of compounds labeled with {sup 211}At (T{sup 1}/{sub 2} 7.21 h), {sup 212}Bi (T{sup 1}/{sub 2} 1 h) or {sup 213}Bi (T{sup 1}/{sub 2} 0.78 h) have been studied. Knowledge of the biokinetic behaviour of such agents is important both for their optimal clinical exploitation and for general radiological protection purposes. Animal studies of the distribution and retention of {sup 211}At compounds, including ionic astatide, substituted aromatic compounds and labelled monoclonal antibodies, have provided new information on the biochemistry of astatine. With respect the thyroid gland the uptake of the astatide ion has been shown to be very much lower than that of the iodide ion. Less information is available for {sup 212}Bi-labelled radiopharmaceuticals. The available data for both {sup 211}At and {sup 212}Bi radiopharmaceuticals are reviewed. Cautious generic biokinetic models for inorganic and simple organic compounds of {sup 211}At and {sup 212}Bi; for [{sup 211}At]-, and [{sup 212}Bi]-biphosphonates and for [{sup 211}At]-, and [{sup 212}Bi]-monoclonal antibodies, are proposed for use in general radiological protection when compound-specific data are not available. (orig.)

  4. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    International Nuclear Information System (INIS)

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 (211At-cMAb U36). Effects on 211At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  5. Tumor immunotargeting using innovative radionuclides.

    Science.gov (United States)

    Kraeber-Bodéré, Françoise; Rousseau, Caroline; Bodet-Milin, Caroline; Mathieu, Cédric; Guérard, François; Frampas, Eric; Carlier, Thomas; Chouin, Nicolas; Haddad, Ferid; Chatal, Jean-François; Faivre-Chauvet, Alain; Chérel, Michel; Barbet, Jacques

    2015-01-01

    This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality. PMID:25679452

  6. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  7. Proceedings of transuranium elements

    International Nuclear Information System (INIS)

    The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium

  8. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  9. Development and radiotherapeutic application of 211At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    International Nuclear Information System (INIS)

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated

  10. Nuclear and chemical data for life sciences

    International Nuclear Information System (INIS)

    Use of reactor produced radionuclides is popular in life sciences. However, cyclotron production of proton rich radionuclides are being more focused in recent times. These radionuclides have already gained attention in various fields, including life sciences, provided they are obtained in pure form. This article is a representative brief of our contributions in generating nuclear data for the production of proton rich radionuclides of terbium, astatine, technetium, ruthenium, cadmium, niobium, zirconium, rhenium, etc., which may have application in clinical, biological, agriculture studies or in basic research. The chemical data required to separate the product isotopes from the corresponding target matrix have been presented along with a few propositions of radiopharmaceuticals. It also emphasizes on the development of simple empirical technique, based on the nuclear reaction model analysis, to generate reliable nuclear data for the estimation of yield and angular distribution of emitted neutrons and light charged particles from light as well as heavy ion induced reactions on thick stopping targets. These data bear utmost important in radiation dosimetry. (author)

  11. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  12. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    Energy Technology Data Exchange (ETDEWEB)

    Nestor, Marika, E-mail: marika.nestor@bms.uu.s [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden); Sundstroem, Magnus [Unit of Molecular Pathology, Department of Genetics and Pathology, Uppsala University (Sweden); Anniko, Matti [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden)

    2011-01-15

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ({sup 211}At-cMAb U36). Effects on {sup 211}At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with {sup 211}At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced {sup 211}At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  13. Alpha particle emitters in medicine

    International Nuclear Information System (INIS)

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 (211At) and natural bismuth-212 (212Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 (223Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs

  14. Preparation of 211At-labeled humanized anti-Tac using 211At produced in disposable internal and external bismuth targets

    International Nuclear Information System (INIS)

    These studies describe the production and purification of 211At as well as the procedure for labeling humanized anti-Tac, the antibody to the α-chain of the IL-2 receptor (IL-2Rα), which has been shown to be a useful target for immunotherapy. The optimized protocol combines the advantages of the two-stage dry distillation procedure with the astatination of trialkylstannyl substances as labeling compounds for proteins. The 211At was produced by bombarding either an external or a recently developed disposable internal bismuth target with α-particles from a Cyclotron Corporation CS-30 cyclotron. The 211At was found to contain less than 0.01% 210At. The production rate for the external target was 0.15 mCi ± 0.056 μA-1 h-1 (n = 9) (5.55 MBq μA-1 h-1). The production rate for the internal target was 0.44 ± 0.14 mCi μA-1 h-1 (n = 16) (16.28 MBq μA-1 h-1)

  15. Study of some properties of bound levels and virtual levels excited with resonance neutrons; Etude de quelques proprietes de niveaux lies et de niveaux virtuels excites a l'aide de neutrons de resonance

    Energy Technology Data Exchange (ETDEWEB)

    Alves, R.N. [Commissariat a l' Energie Atomique, 91 - Saclay (France). Centre d' Etudes Nucleaires

    1968-05-01

    Many neutron resonance parameters of some nuclei with a spin value I 3/2 ({sup 35}Cl, {sup 37}Cl, {sup 63}Cu, {sup 65}Cu, {sup 197}Au) are determined to find the strength function S{sub 0} with accuracy. For those nuclei, the S{sub 0} value seems not to depend on the spin value J=1 or 2 but could be depend on neutron energy for {sup 197}Au. Total radiative width variation against mass number A and spacing distributions between resonances (for {sup 197}Au) are studied and discussed. Analysis methods of neutron capture experiments are described in detail and level schemes of Cl, Mn, Fe, Co, Cu, Tm, Hg are presented sometimes with the spin value. Intensities of E{sub 1} and M{sub 1} transitions with direct capture and interference effects are discussed in view of experimental results. (author) [French] On determine les parametres des resonances de quelques noyaux de spin I 3/2 ({sup 35}Cl, {sup 37}Cl, {sup 63}Cu, {sup 65}Cu, {sup 197}Au) en nombre suffisant pour obtenir la fonction densite S{sub 0} avec precision. Cette valeur S{sub 0} apparat pour ces noyaux etre independante de la valeur du spin J=1 ou 2 mais para?t, dans le cas de {sup 197}Au, dependre de l'energie. On etudie et on essaie d'interpreter la variation de la largeur radiative totale {gamma}{sub {gamma}} en fonction du nombre de masse A et les distributions des espacements entre resonances pour {sup 197}Au. On expose en detail les methodes d'analyse des experiences de capture et on presente les schemas des niveaux des noyaux: Cl, Mn, Fe, Co, Cu, Tm, Hg. Les intensites des transitions de type E{sub 1} et M{sub 1} ainsi que les effets d'interference et de capture directe sont discutes. (auteur)

  16. Antibacterial activity of synthesized 2,4,5-trisubstituted imidazole derivatives

    Digital Repository Service at National Institute of Oceanography (India)

    Khan, M.S.; Siddiqui, S.A.; Siddiqui, M.S.R.A.; Goswami, U.; Srinivasan, K.V.; Khan, M.I.

    activity, aryl aldehydes, a-hydroxyketone Received 15 February 2008, revised 28 June 2008 and accepted for publication 29 June 2008 Different imidazoles have been reported to show biological activities such as anti-inflammatory activity inhibiting cytokine... of this work 197 Chem Biol Drug Des 2008; 72: 197–204 Research Article ª 2008 The Authors Journal compilation ª 2008 Blackwell Munksgaard doi: 10.1111/j.1747-0285.2008.00691.x and screen them for antibacterial and antifungal activity with respect...

  17. ENDF/B-5 Standards Data Library (including modifications made in 1986). Summary of contents and documentation

    International Nuclear Information System (INIS)

    This document summarizes the contents and documentation of the ENDF/B-5 Standards Data Library (EN5-ST) released in September 1979. The library contains complete evaluations for all significant neutron reactions in the energy range 10-5eV to 20 MeV for H-1, He-3, Li-6, B-10, C-12, Au-197 and U-235 isotopes. In 1986 the files for C-12, Au-197 and U-235 were slightly modified. The entire library or selective retrievals from it can be obtained free of charge from the IAEA Nuclear Data Section. (author)

  18. Azimutal anisotropic particle emission in relativistic heavy-ion collisions

    International Nuclear Information System (INIS)

    This thesis deals with the evaluation of one of the first experiments perforemd at the kaon spectrometer. In this experiment the 197Au+197Au reactions were measured at a beam energy of 1 GeV per nucleon. The essential results of the evaluation can be summarized as following: The widths of the measured distributions of the transverse momenta per nucleon of projectile spectators of different charge cannot be explained solely by Fermi-gas models. For particles of different fragment charge the mean transverse-momentum transfers per nucleon into the reaction plane at projectile rapidity were determined. (HSI)

  19. Particle identification by measurement of track cone length as a function of the residual range of heavy ions in CR-39 and lexan polycarbonate

    International Nuclear Information System (INIS)

    The maximum etchable ranges of heavy ions such as 238U, 208Pb, 197Au, 132Xe and 93Nb in CR-39 and 238U, 197Au and 132Xe in Lexan polycarbonate have been determined. An attempt has been made to examine the suitability of the single-sheet particle identification technique in CR-39 and Lexan polycarbonate by plotting track cone length vs residual range for different heavy ions. A comparison has been made between experimental and theoretical values of ranges for different heavy ions in these detectors. A reasonably good agreement has been observed between the experimental and the theoretically computed values. (author)

  20. Pseudoexfoliation syndrome and secondary cataract

    OpenAIRE

    Kuchle, M.; A. Amberg; Martus, P.; Nguyen, N.; NAUMANN, G.

    1997-01-01

    AIM/BACKGROUND—The pseudoexfoliation (PEX) syndrome is frequently associated with impairment of the blood-aqueous barrier. This study analysed if this might stimulate secondary cataract following cataract extraction.
METHODS—This historical cohort study included 197 eyes of 197 patients (99 with and 98 without PEX) that underwent extracapsular cataract extraction with posterior chamber lens implantation (PMMA optic) between 1985 and 1991. Secondary cataract was defined as opacification of the...

  1. Superdeformation in the bismuth nuclei

    International Nuclear Information System (INIS)

    High angular-momentum states in 196,197Bi were populated in the reaction 183W (19F,xn) at a beam energy of 108 MeV, and γ rays were detected with the Gammasphere array. Two weakly populated rotational bands, with energy spacings characteristic of superdeformation have been found. Both cascades can be assigned unambiguously to the Bi nuclei; however, their isotopic assignment to 197Bi is tentative. The properties of the bands and their possible structures are discussed. Our results represent the first identification of superdeformed bands in a nucleus of the A∼190 mass region with Z>82

  2. Dicty_cDB: Contig-U10443-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available E010300 |pid:none) Leptospira interrogans serovar ... 198 2e-49 CP000143_2577( CP000143 |pid:none) Rhodobacter sphaeroides... 2.4.1 c... 198 3e-49 CP000577_2604( CP000577 |pid:none) Rhodobacter sphaeroides... ATCC 17... 197 4e-49 CP001150_2354( CP001150 |pid:none) Rhodobacter sphaeroides KD131 c... 197...4 CP000492_703( CP000492 |pid:none) Chlorobium phaeobacteroides DSM ... 182 2e-44 CP000285_1209( CP000285 |p...3e-40 CP000557_916( CP000557 |pid:none) Geobacillus thermodenitrificans ... 168 3

  3. The importance of four histidine residues in isocitrate lyase from Escherichia coli.

    OpenAIRE

    Diehl, P; McFadden, B A

    1994-01-01

    By site-directed mutagenesis, substitutions were made for His-184 (H-184), H-197, H-266, and H-306 in Escherichia coli isocitrate lyase. Of these changes, only mutations of H-184 and H-197 appreciably reduced enzyme activity. Mutation of H-184 to Lys, Arg, or Leu resulted in an inactive isocitrate lyase, and mutation of H-184 to Gln resulted in an enzyme with 0.28% activity. Nondenaturing polyacrylamide gel electrophoresis demonstrated that isocitrate lyase containing the Lys, Arg, Gln, and L...

  4. Absorption cross section measurements for 252Cf spontaneous fission neutrons (LWBR development program)

    International Nuclear Information System (INIS)

    Absolute absorption cross sections have been measured for 232Th and 197Au for 252Cf spontaneous fission neutrons. Irradiations were performed in an exceptionally low mass source-foil arrangement, providing a ''pure'' spectrum with few corrections. Calibration of the activation detector was achieved by irradiating identical foils in the National Bureau of Standards (NBS) Standard Thermal Flux. A simple ratio technique was also used to obtain an independent estimate of the relative 232Th to 197Au integral cross sections, yielding a value in good agreement with that above. This technique was extended to 181Ta, 98Mo, and 63Cu. (5 tables, 3 figures) (U.S.)

  5. AcEST: DK963005 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0015_G01 614 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_G01. 5' end seq ... 8 GAIWQYVVPFGIKSLMQYIRTNYKNIPIFITENGYADASHGLTEALQDDKRI HYHQEYLA 197 G+ W Y VP+G + L+ + +T Y + PI++ ENG + H ... 8 GAIWQYVVPFGIKSLMQYIRTNYKNIPIFITENGYADASHGLTEALQDDKRI HYHQEYLA 197 G+ W Y VP+G + L+ + +T Y + PI++TE+G H D ... ery: 48 GIKSLMQYIRTNYKNIPIFITENGYAD----ASHGLTEALQDDKRI HYHQEYLANLLEAI 215 G++ L++YI+ NY + + I ENGY + + + Q ... 27 WQYVV-PFGIKSLMQYIRTNYKNIP-IFITENGYADASHGLTEALQDDKRI HYHQEYLAN 200 W +++ P G+ + ++ +Y N I+ITENG + + DD R ...

  6. Creating a system of medical and psychological rehabilitation of extreme professions representatives (firemen-rescuers as a model)

    OpenAIRE

    Chumaeva, Julia; Golikovа, Vladislava; Nekhoroshkova, Julia; Ogulenko, Alexey; Shafran, Leonid

    2015-01-01

    Chumaeva Julia, Golikovа Vladislava, Nekhoroshkova Julia, Ogulenko Alexey, Shafran Leonid. Creating a system of medical and psychological rehabilitation of extreme professions representatives (firemen-rescuers as a model). Journal of Education, Health and Sport. 2015;5(8):197-209. ISSN 2391-8306. DOI 10.5281/zenodo.28064 http://dx.doi.org/10.5281/zenodo.28064 http://ojs.ukw.edu.pl/index.php/johs/article/view/2015%3B5%288%29%3A197-209 https://pbn.nauka.gov.pl/works/6...

  7. Photovoltage versus microprobe sheet resistance measurements on ultrashallow structures

    DEFF Research Database (Denmark)

    Clarysse, T.; Moussa, A.; Parmentier, B.;

    2010-01-01

    Earlier work [T. Clarysse , Mater. Sci. Eng., B 114-115, 166 (2004); T. Clarysse , Mater. Res. Soc. Symp. Proc. 912, 197 (2006)] has shown that only few contemporary tools are able to measure reliably (within the international technology roadmap for semiconductors specifications) sheet resistances...... on ultrashallow (sub-50-nm) chemical-vapor-deposited layers [T. Clarysse , Mater. Res. Soc. Symp. Proc. 912, 197 (2006)], especially in the presence of medium/highly doped underlying layers (representative for well/halo implants). Here the authors examine more closely the sheet resistance anomalies...

  8. Status of the experiment ASYEOS

    Energy Technology Data Exchange (ETDEWEB)

    Kupny, Sebastian [GSI Helmholtzzentrum GmbH Darmstadt (Germany); Collaboration: ASYEOS-Collaboration

    2012-07-01

    Neutron-proton squeeze-out is predicted to provide quantitative information on the symmetry term of the nuclear Equation of State at supra-saturation densities. Hence we designed an experiment consisting out of the CHIMERA charged particle detector for impact parameter determination and reaction plane reconstruction, the LAND neutron detector to measure neutron and proton squeeze-out and a Triple Telescope Array to identify light fragments. Measurements of 197Au+197Au, 96Ru+96Ru and 96Zr+96Zr collisions at 400 A MeV have been accomplished in May 2011 at the GSI facility. Current status of the analysis, first results and future plans are presented.

  9. On the momentum distribution of particles participating in nuclear stopping

    Indian Academy of Sciences (India)

    Mandeep Kaur; Suneel Kumar

    2015-01-01

    Nuclear stopping is studied as a function of incident energy and charge of the fragment produced in central heavy-ion collisions (HIC) of $^{197}_{79}$Au+$^{197}_{79}$Au and $^{58}_{28}$Ni+$^{58}_{28}$Ni using stopping parameter VARXZ. Various momentum constraints were imposed to get better insight into the stopping. The comparison of measured and calculated values of stopping for protons reveals the significance of these constraints. Maximum stopping is obtained for the particles lying in the lowest range of the momentum distribution at all incident energies.

  10. Passive neutron dosemeter with activation detector

    Energy Technology Data Exchange (ETDEWEB)

    Valero L, C.; Banuelos F, A.; Guzman G, K. A.; Borja H, C. G.; Hernandez D, V. M.; Vega C, H. R., E-mail: fermineutron@yahoo.com [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Calle Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas (Mexico)

    2011-10-15

    A passive neutron dosemeter with {sup 197}Au activation detector has been developed. The area dosemeter was made as a 20.5 {phi} x 20.5 cm{sup 2} polyethylene moderator, with a polyethylene pug where a {sup 197}Au foil can be located either parallel or perpendicular to moderator axis. Using Monte Carlo methods, with the MCNP5 code. With the fluence response and the fluence-to-equivalent dose conversion coefficients from ICRP-74, responses to H*(10) were also calculated, these were compared against responses of commercially available neutron area monitors and dosemeters. (Author)

  11. Formation of fragments in heavy-ion collisions using modified clusterization method

    CERN Document Server

    Goyal, Supriya

    2011-01-01

    We study the formation of fragments by extending the minimum spanning tree method (MST) for clusterization. In this extension, each fragment is subjected to a binding-energy check calculated using the modified Bethe-Weizsacker formula. Earlier, a constant binding-energy cut of 4 MeV/nucleon was imposed. Our results for 197Au +197 Au collisions are compared with ALADiN data and also with the calculations based on the simulated annealing technique. We shall show that the present modified version improves the agreement compared to the MST method.

  12. Microscopic analysis of p^{10}B scattering at the intermediate energies

    CERN Document Server

    Dzhazairov-Kahramanov, Albert; Krassovitskiy, Pavel

    2016-01-01

    The differential cross sections of the p^{10}B scattering at energies of 197, 600 and 1000 MeV have been calculated within the framework of the Glauber theory. The operator of multiple scattering takes into account the contributions of single and double collisions. The contributions from protons scattering on the nucleons of different shells have been estimated in the single-scattering cross-section. The comparison with the experiment at 197 MeV and with DWBA calculation showed the adequate description of cross-sections in the region of the front angles.

  13. Infection of Tomicus piniperda (Col., Scolytidae) with Canningia tomici sp n. (Microsporidia, Unikaryonidae)

    Czech Academy of Sciences Publication Activity Database

    Kohlmayr, B.; Weiser, Jaroslav; Wegensteiner, R.; Händel, U.; Žižka, Zdeněk

    2003-01-01

    Roč. 76, - (2003), s. 65-73. ISSN 1436-5693 Institutional research plan: CEZ:AV0Z5020903; CEZ:AV0Z5007907 Keywords : Spruce bark beetle-protista Subject RIV: EE - Microbiology, Virology Impact factor: 0.197, year: 2003

  14. TOWARD A THEORY OF SUSTAINABLE SYSTEMS. FLUID PHASE EQUILIBRIA: JOURNAL ARTICLE

    Science.gov (United States)

    NRMRL/STD JOURNAL NRMRL-CIN-1364 Cabezas*, H., and Fath**, B.D. Toward a Theory of Sustainable Systems. Fluid Phase Equilibria (Nakanishi, K., Yasukiko, A., Miyano, Y. (Ed.), Elsevier Science B.V.) 194-197:3-14 (2002). EPA/600/J-02/186, www.elsevier.com/locate/fluid. 03/2...

  15. Preliminary observation on breeding three spotted seahorse, Hippocampus trimaculatus (Leach, 1814), solely fed with wild caught amphipods under ex-situ condition

    Digital Repository Service at National Institute of Oceanography (India)

    Murugan, A.; Dhanya, S.; Pawar, H.; Sreepada, R.A.; Rajagopal, S.; Balasubramanian, T.

    . Water Resources Management 97: 97–102. Emlen S T and Oring L W. 1977. Ecology, sexual selection and the evolution of mating systems, Science 197: 215–23. Foster S J and Vincent A C J. 2004. Life history of seahorses : implications for conservation...

  16. Integration and inequality in the EU accession countries

    Czech Academy of Sciences Publication Activity Database

    Švejnar, Jan

    Washington, D.C : The World Bank, 2006 - (Kochendorfer-Lucius, G.; Pleskovic, B.), s. 197-201 ISBN 0821361066. [Development Policy Forum. Berlin (DE), 06.09.2004-08.09.2004] Institutional research plan: CEZ:AV0Z70850503 Keywords : accession countries * European Union * inequality Subject RIV: AH - Economics

  17. Transformation of the Czech Entrepreneurial Elite and the Conditions for Economic Development

    Czech Academy of Sciences Publication Activity Database

    Benáček, Vladimír

    Praha: MATFYZPRESS, 2008 - (Mejstřík, M.), s. 197-224 ISBN 978-80-7378-074-6 R&D Projects: GA ČR GA403/08/1369 Institutional research plan: CEZ:AV0Z70280505 Keywords : Entrepreneurship * social capital * transition Subject RIV: AO - Sociology, Demography

  18. Nie je len jedna lyrika

    Czech Academy of Sciences Publication Activity Database

    Jareš, Michal

    Bratislava: Literárne informačné centrum, 2014 - (Passia, R.; Taranenková, I.), s. 179-197 ISBN 978-80-8119-085-8 Institutional support: RVO:68378068 Keywords : Slovak poetry * 21st century Subject RIV: AJ - Letters, Mass-media, Audiovision

  19. Cryptic intercontinental colonization in water fleas Daphnia pulicaria inferred from phylogenetic analysis of mitochondrial DNA variation

    Czech Academy of Sciences Publication Activity Database

    Marková, Silvia; Dufresne, F.; Rees, D. J.; Černý, M.; Kotlík, Petr

    2007-01-01

    Roč. 44, - (2007), s. 42-52. ISSN 1055-7903 Grant ostatní: Grant Agency of Charles University(CZ) 197/2004-2005 Institutional research plan: CEZ:AV0Z50450515 Keywords : arctic * colonization * Daphnia pulex complex Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.994, year: 2007

  20. Dynamic response as a tool for damage identification

    Czech Academy of Sciences Publication Activity Database

    Pirner, Miroš; Urushadze, Shota

    Kiev: National Academy of Sciences of Ukraine, Timoshenko institute of Mechanics, 2009 - (Guz, A.), s. 197-202 ISBN 978-966-2032-46-8 R&D Projects: GA AV ČR(CZ) KJB2071303 Institutional research plan: CEZ:AV0Z20710524 Keywords : damage * identification of imperfections * dynamics response Subject RIV: JM - Building Engineering

  1. Workplace Learning and Generation X.

    Science.gov (United States)

    Bova, Breda; Kroth, Michael

    2001-01-01

    A survey of the learning preferences of 197 Generation X workers found that they value incidental and action learning. They recognized the need for formal training, but suggested improvements. They preferred learning by doing, visual stimuli, and self-directed learning. (Contains 26 references.) (SK)

  2. Neutron scattering studies in the actinide region

    International Nuclear Information System (INIS)

    This report discusses the following topics: Prompt fission neutron energy spectra for 235U and 239Pu; Two-parameter measurement of nuclear lifetimes; ''Black'' neutron detector; Data reduction techniques for neutron scattering experiments; Inelastic neutron scattering studies in 197Au; Elastic and inelastic scattering studies in 239Pu; and neutron induced defects in silicon dioxide MOS structures

  3. Light-ion-induced multifragmentation. A fast, evolutionary process

    International Nuclear Information System (INIS)

    GeV light-ion-induced reactions offer a unique tool for preparing hot, dilute nuclear matter. Time evolution of nuclear multifragmentation in 3He + natAg and 3He + 197Au reactions are investigated. Fragment-fragment correlations are studied in order to gain information on multifragmentation mechanism. (K.A.)

  4. Disease: H00460 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H00460 Hand-foot -genital syndrome Hand-foot -genital syndrome is very rare dominantly inherited c ... XA13 mutations and the phenotypic spectrum of hand-foot -genital syndrome. Am J Hum Genet 67:197-202 (2000) ...

  5. Původ, složení a stabilita měďnatých pigmentů v nástěnné malbě

    Czech Academy of Sciences Publication Activity Database

    Švarcová, Silvie; Bezdička, Petr; Hradil, David

    PRAHA : Akademie výtvarných umění v Praze, 2012, s. 197-212. ISBN 978-80-87108-33-8. [Interdisciplinary Conference of ALMA /4./. Praha (CZ), 21.11.2012-23.11.2012] Institutional support: RVO:61388980 Keywords : copper pigment s * wall paintings * origin * corrosion Subject RIV: CA - Inorganic Chemistry

  6. Assessment of menstrual characteristics among nulliparous female consumers of carbonated soft drinks

    Directory of Open Access Journals (Sweden)

    Ologhaguo M. Adienbo

    2016-01-01

    Conclusions: This study has shown that consumption of soft drinks during menstruation could alter menstrual characteristics in nulliparous females by increasing the menstrual flow, menstrual pain and menstrual duration. [Int J Reprod Contracept Obstet Gynecol 2016; 5(1.000: 194-197

  7. 46 CFR 30.25-3 - Benzene.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Benzene. 30.25-3 Section 30.25-3 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY TANK VESSELS GENERAL PROVISIONS Commodities Regulated § 30.25-3 Benzene. The provisions contained in 46 CFR part 197, subpart C, apply to liquid cargoes containing 0.5% or more...

  8. Selective synthesis of linear alkylbenzene by alkylation of benzene with 1-dodecene over desilicated zeolites

    Czech Academy of Sciences Publication Activity Database

    Aslam, W.; Siddiqui, M. A. B.; Jermy, B. R.; Aitani, A.; Čejka, Jiří; Al-Khattaf, S.

    2014-01-01

    Roč. 227, MAY 2014 (2014), s. 187-197. ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : zeolites * benzene alkylation * long-chain olefin Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.893, year: 2014

  9. Rozbor textilních fragmentů z meče a šavle z pohřebiště Olomouc-Nemilany

    Czech Academy of Sciences Publication Activity Database

    Březinová, Helena

    Brno : Masarykova univerzita, 2014 - (Přichystalová, R.; Kalábek, M.), s. 191-197 ISBN 978-80-210-7521-4. - (Spisy Masarykovy univerzity v Brně, Filozofická fakulta. 424) Institutional support: RVO:67985912 Keywords : Olomouc - Nemilany * textile fragments * textile -technological research Subject RIV: AC - Archeology, Anthropology, Ethnology

  10. Response of channel x blue hybrid catfish to chronic diurnal hypoxia

    Science.gov (United States)

    Performance traits and metabolic responses of the channel x blue hybrid catfish (Ictalurus punctatus female x I. furcatus male) in response to chronic diurnal hypoxia were evaluated in this 197-d study. Sixteen 0.1-ha earthen ponds were stocked with 15,169 hybrid catfish/ha (47 g/fish) and managed t...

  11. Motivation and Transfer in Professional Training: A Meta-Analysis of the Moderating Effects of Knowledge Type, Instruction, and Assessment Conditions

    Science.gov (United States)

    Gegenfurtner, Andreas

    2011-01-01

    This meta-analysis (148 studies, k = 197, N = 31,718) examined the relationship between motivation and transfer in professional training. For this purpose, motivation was conceptualized in the following nine dimensions: motivation to learn, motivation to transfer, pre- and post-training self-efficacy, mastery orientation, performance orientation,…

  12. Interaction of phonons with intraband electronic excitations and crystal field transitions in Raman spectra of (Nd,Eu,Gd)Ba.sub.2./sub.Cu.sub.3./sub.O.sub.y./sub. crystals

    Czech Academy of Sciences Publication Activity Database

    Rameš, Michal; Železný, Vladimír; Gregora, Ivan; Wolf, T.; Jirsa, Miloš

    2015-01-01

    Roč. 197, Jul (2015), 10-17. ISSN 0921-5107 R&D Projects: GA MŠk(CZ) ME10069 Institutional support: RVO:68378271 Keywords : cuprate superconductors * phonons * crystal field * vortex pinning Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.169, year: 2014

  13. Materiální kultura vědy

    Czech Academy of Sciences Publication Activity Database

    Dvořák, Tomáš

    Praha: Filosofia, 2013, s. 197-223. ISBN 978-80-7007-414-5 R&D Projects: GA ČR(CZ) GAP401/11/2338 Institutional support: RVO:67985955 Keywords : historical epistemology * material culture of science * scientific instruments Subject RIV: AA - Philosophy ; Religion

  14. Anti-Semitism on Campus.

    Science.gov (United States)

    Malaney, Gary D.; Williams, Elizabeth A.

    1994-01-01

    Investigated and compared Jewish (n=219) and non-Jewish (n=197) students' perceptions of the anti-Semitic atmosphere at University of Massachusetts at Amherst. Jewish students were significantly more likely to perceive anti-Semitic environment than were non-Jewish students. Nonetheless, 71.4% of non-Jewish students believed Jewish students were…

  15. Peculiar behavior of MWW materials in aldol condensation of furfural and acetone

    Czech Academy of Sciences Publication Activity Database

    Kikhtyanin, O.; Eliášová, Pavla; Jindrová, T.; Kubička, D.

    2014-01-01

    Roč. 43, č. 27 (2014), s. 10628-10641. ISSN 1477-9226 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : acetone * aldehydes * batch reactors Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.197, year: 2014

  16. Hard photon interferometry at intermediate energies

    International Nuclear Information System (INIS)

    Two hard photons, emitted in 86Kr and 181Ta ion beams collision with 64Ni and 197Au targets, respectively, correlation function has been measured. The source of gamma emission size was determined to be 12 fm. To explain why the measured source size is much larger than size of total system (7 fm) the model with two gamma emitting sources was developed

  17. Otázky vztahu stylu zvládání zátěže mladšími adolescenty a jejich sociální pozice ve školní třídě

    Czech Academy of Sciences Publication Activity Database

    Kohoutek, Tomáš; Ježek, S.; Mareš, J.

    Brno: Psychologický ústav AV ČR, 2006, s. 185-197. ISBN 80-86174-09-3. [Sociální procesy a osobnost 2005. Brno (CZ), 22.09.2005-23.09.2005] Institutional research plan: CEZ:AV0Z70250504 Keywords : coping * coping strategies * clasroom Subject RIV: AN - Psychology

  18. Svatováclavský cyklus a další obrazy pro klášter na Zderaze. [Úvodní studie a katalogová hesla

    Czech Academy of Sciences Publication Activity Database

    Dobalová, Sylva

    Praha : Národní galerie, 2010 - (Stolárová, L.; Vlnas, V.), s. 156-159, 160-177, 183-193, 196-197 ISBN 978-80-7035-458-2 Institutional research plan: CEZ:AV0Z80330511 Keywords : baroque painting * St Wenceslas * Antonio Tempesta * Discalced Augustinians Subject RIV: AL - Art, Architecture, Cultural Heritage

  19. Diesel exhaust emissions (citations from the American Petroleum Institute Data Base). Report for 1974-Dec 1980

    Energy Technology Data Exchange (ETDEWEB)

    Cavagnaro, D.M.

    1980-02-01

    This bibliography cites research reports concerning exhaust emissions from diesel motor vehicles. Topics include engine design, techniques of measuring gases, pollution control, and fuel additives. (This updated bibliography contains 197 abstracts, 42 of which are new entries to the previous edition.)

  20. High efficiency, low magnetic field gyroklystron amplifiers

    International Nuclear Information System (INIS)

    The possibility of operating a gyroklystron amplifier at high efficiency and low magnetic field is considered. Two devices are discussed: A two cavity second harmonic TE02 gyroklystron amplifier operating at 19.7 GHz with subharmonic bunching, and a fundamental mode TE01 gyrotwistron at 16 GHz. The nonlinear efficiency is given for both devices

  1. Three tetracoordinate Co(II) complexes [Co(biq)X.sub.2./sub.] (X = Cl, Br, I) with easy-plane magnetic anisotropy as field-induced single-molecule magnets

    Czech Academy of Sciences Publication Activity Database

    Smolko, I.; Černák, J.; Dušek, Michal; Miklovič, C.; Titiš, J.; Boča, R.

    2015-01-01

    Roč. 44, č. 40 (2015), s. 17565-17571. ISSN 1477-9226 Institutional support: RVO:68378271 Keywords : crystal structure * cobalt * superparamagnetism * magnetic properties * biquinoline Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.197, year: 2014

  2. [Fast neutron cross section measurements

    International Nuclear Information System (INIS)

    This paper discusses the following topics: 14 MeV pulsed neutron facility; detection and measurement system; 238U capture cross sections at 23 and 964 keV using photon neutron sources; capture cross sections of Au-197 at 23 and 964 keV; and yttrium nuclear cross section measurement

  3. Comparison of single and boosted protease inhibitor versus nonnucleoside reverse transcriptase inhibitor-containing cART regimens in antiretroviral-naïve patients starting cART after January 1, 2000

    DEFF Research Database (Denmark)

    Mocroft, A; Horban, A; Clumeck, N;

    2006-01-01

    increase) response in antiretroviral-naïve patients starting either a single protease inhibitor (PI; n = 183), a ritonavir-boosted PI regimen (n = 197), or a nonnucleoside reverse transcriptase inhibitor (NNRTI)-based cART regimen (n = 447) after January 1, 2000, and the odds of lack of virologic or...

  4. Religiosity, Values, and Acculturation: A Study of Turkish, Turkish-Belgian, and Belgian Adolescents

    Science.gov (United States)

    Gungor, Derya; Bornstein, Marc H.; Phalet, Karen

    2012-01-01

    We address the understudied religious dimension of acculturation in acculturating adolescents who combine a religious Islamic heritage with a secularized Christian mainstream culture. The religiosity of 197 Turkish-Belgian adolescents was compared with that of 366 age-mates in Turkey (the heritage culture) and 203 in Belgium (the mainstream…

  5. 33 CFR 154.820 - Fire, explosion, and detonation protection.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Fire, explosion, and detonation... Systems § 154.820 Fire, explosion, and detonation protection. (a) A vapor control system with a single...: (1) Have a detonation arrester located not more than 6 meters (19.7 ft.) from the facility...

  6. 76 FR 7824 - Marine Mammals; File No. 978-1791

    Science.gov (United States)

    2011-02-11

    ... importing of marine mammals (50 CFR part 216). The original permit, issued on February 9, 2006 (71 FR 8279...D, Marine Mammal Research Program Hawaii Institute of Marine Biology, P.O. Box 1106, Kailua, Hawaii... National Oceanic and Atmospheric Administration RIN 0648-XA197 Marine Mammals; File No. 978-1791...

  7. 46 CFR Table 1 to Part 153 - Summary of Minimum Requirements

    Science.gov (United States)

    2010-10-01

    ... system Ventheight Vent Gauge Fire protection system Special requirements in46 CFR Part 153 Electrical..., .908(a), (b), .1020 NA 1- or 2-Nitropropane 7 D S III 4m PV Restr 7A, C .409, .526 I-C Nitropropane (60... 46 CFR part 197, subpart C, apply to liquid cargoes containing 0.5% or more benzene by volume....

  8. S3EPY: a Sparky extension for determination of small scalar couplings from spin-state-selective excitation NMR experiments

    Czech Academy of Sciences Publication Activity Database

    Novák, P.; Žídek, L.; Motáčková, V.; Padrta, P.; Švenková, Alžběta; Nuzillard, J.-M.; Krásný, Libor; Sklenář, V.

    2010-01-01

    Roč. 46, č. 2 (2010), s. 191-197. ISSN 0925-2738 R&D Projects: GA ČR GA204/09/0583 Institutional research plan: CEZ:AV0Z50200510 Keywords : Software * Sparky * Residual dipolar couplings Subject RIV: EE - Microbiology, Virology Impact factor: 3.047, year: 2010

  9. Beyond Situational Ambiguity in Peer Conflict: Unique and Combined Effects of Cues from an Antagonist and a Best Friend

    Science.gov (United States)

    Smith-Schrandt, Heather L.; Ojanen, Tiina; Gesten, Ellis; Feldman, Marissa A.; Calhoun, Casey D.

    2011-01-01

    In accord with increasing recognition of the situation specificity of childhood social behaviors, individual and contextual differences in children's responses to potential peer conflict were examined (hostile attribution, behavioral strategies, and affective reactions; N = 367, 9-2 years, 197 girls). Situational cues from 2 sources, the…

  10. Collaborating with Front-Line Teachers to Incorporate Self-Regulated Learning in Chinese Language Classes

    Science.gov (United States)

    Lau, Kit-ling

    2011-01-01

    This study aimed to initially explore the possibility of helping front-line teachers to integrate the principles of self-regulated learning (SRL) into Chinese reading instruction in a 1-year collaborative project. A total of 197 Secondary 3 students and 6 Chinese language teachers from a secondary school in Hong Kong participated in the study. The…

  11. Psychometric Evaluation of the Beck Anxiety Inventory with Older Medical Patients.

    Science.gov (United States)

    Wetherell, Julie Loebach; Arean, Patricia A.

    1997-01-01

    When 197 disadvantaged older medical patients completed the Beck Anxiety Inventory, the instrument demonstrated high internal consistency and no significant differences by sex or race, suggesting that it is appropriate for use with diverse populations. Total instrument scores correlated negatively with age. (SLD)

  12. Dicty_cDB: Contig-U10794-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 53_1( AY497653 |pid:none) Metschnikowia pulcherrima strain C... 149 1e-48 AY305505_1( AY305505 |pid:none) Le...pas anserifera voucher Lean elon... 197 1e-48 CU633900_457( CU633900 |pid:none) Podospora anserina genomic D

  13. Occurrence of pathogens in associated living bark beetles (Col., Scolytidae) from different spruce stands in Austria

    Czech Academy of Sciences Publication Activity Database

    Händel, U.; Wegensteiner, R.; Weiser, Jaroslav; Žižka, Zdeněk

    2003-01-01

    Roč. 76, - (2003), s. 22-32. ISSN 1436-5693 Institutional research plan: CEZ:AV0Z5020903; CEZ:AV0Z5007907 Keywords : Ips-typographus Coleoptera- mickrospora Subject RIV: EE - Microbiology, Virology Impact factor: 0.197, year: 2003

  14. Partner relationships in the Netherlands: new manifestations of the Second Demographic Transition

    NARCIS (Netherlands)

    J.J. Latten; C.H. Mulder

    2013-01-01

    Partnership formation has rapidly and profoundly changed in theNetherlandssince the 1960s.Several scholars have placed these changes in the context of the Second Demographic Transition. We describe the main trends in the formation and dissolution of partnerships in theNetherlandsbetween the 1960/197

  15. Partner relationships in the Netherlands : New manifestations of the Second Demographic Transition

    NARCIS (Netherlands)

    Latten, Jan J.; Mulder, Clara H.

    2013-01-01

    Partnership formation has rapidly and profoundly changed in theNetherlandssince the 1960s.Several scholars have placed these changes in the context of the Second Demographic Transition. We describe the main trends in the formation and dissolution of partnerships in theNetherlandsbetween the 1960/197

  16. Modeling of Contaminant Migration through Porous Media after Underground Coal Gasification in Shallow Coal Seam

    Czech Academy of Sciences Publication Activity Database

    Soukup, Karel; Hejtmánek, Vladimír; Čapek, P.; Stanczyk, K.; Šolcová, Olga

    2015-01-01

    Roč. 140, DEC (2015), s. 188-197. ISSN 0378-3820 Grant ostatní: RFCS(XE) RFCR-CT-2011-00002 Institutional support: RVO:67985858 Keywords : underground coal gasification * transport phenomena modeling * transport parameters Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 3.352, year: 2014

  17. Dicty_cDB: Contig-U07069-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ase; EC=3.6... 40 0.064 CU694389_26( CU694389 |pid:none) Ralstonia solanacearum strain Mol... 40 0.064 (A1AX...tntaaaaagaaaactgctgttggaaaatggcaatt 137 Query: 138 tccncaaggtggagtagaagttnaaaanaatnaagattattatgtagcagnacaaana...atnaagattattatgtagcagnacaaanaga 197 Query: 198 gattaaagaggaagttggattagagccatca...attganacattaaaanacgtttcaaagct 257 |||||||||||||||||||||||||||||||||||||||||||||||||||||...||||||| Sbjct: 198 gattaaagaggaagttggattagagccatcaattganacattaaaanacgtttcaaagct 257 Query: 258 tcaaaanccattatcttacatttatgaagattcncca

  18. Gamma-activation analyses of 187 Os in molybdenite

    International Nuclear Information System (INIS)

    197Os and 187Re are used in cosmological studies. Common registration of gamma and X-ray irradiation in compositions containing these radioisotopes permits to increase the accuracy in determination of their content. The results of 187Os gamma-activation analysis in molybdenite are presented

  19. NCBI nr-aa BLAST: CBRC-TTRU-01-1305 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1305 ref|NP_858288.2| Spa29, component of the Mxi-Spa secretion machinery [Shigella ... Sd197] sp|P0A1M7|SPAR_SHISO RecName: Full=Surface presentation ... of antigens protein spaR; AltName: Full=Spa29 prot ...

  20. Maine Bouguer Gravity Grid

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A 2 kilometer Bouguer anomaly grid for the state of Maine. Number of columns is 197 and number of rows is 292. The order of the data is from the lower left to the...