International Nuclear Information System (INIS)
Ruth, T.J.; Dombsky, M.; D'Auria, J.M.; Ward, T.E.
1988-01-01
This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs
Formation and decomposition of astatine molecules
International Nuclear Information System (INIS)
Takahashi, Naruto; Ishikuro, Mituhiro; Baba Hiroshi
1989-01-01
A method determining the boiling points of elementary astatine and astatine iodide has been developed (K. Otozai and N. Takahashi, Radio. Chim. Acta 31, (1982) 201). Further, it was concluded from the simple rule among the boiling point of elementary halogens and interhalogen compounds that elementary astatine might exist in diatomic molecules as the other halogens. In the present work the reaction mechanisms of elementary astatine with radioactive iodine and organic solvents were studied by means of radiogaschromatography in order to obtain further experimental evidences for diatomic astaine molecules. The following conclusions were obtained by the analysis of reaction kinetics. Two astatine atoms are lost from the elementary astatine fraction per each radioactive decay of astatine. The astatine radical or hot atom liberated by the decay of the complementary astatine atom immediately reacts with iodine or organic solvents. Thus formed astatine compounds decompose in turn due to the decay of astatine
Organic astatine compounds, their preparation and properties
Energy Technology Data Exchange (ETDEWEB)
Vasaros, L; Berei, K
1985-01-01
Aromatic astatine compounds of possible medical application were prepared by high energy substitutions, by astatine-halogen, and by electrophil astatine-hydrogen substitutions at the Joint Institute of Nuclear Researches, Dubna. Physico-chemical properties of organic astatine compounds such as boiling point and evaporation heat, and the refraction and dissociation energy of carbon-astatine bonds were determined experimentally by gas chromatography. The results are compared with extrapolated data. (V.N.). 41 refs.; 7 figs.; 5 tables.
Recent advances in the organic chemistry of astatine
International Nuclear Information System (INIS)
Berei, K.; Vasaros, L.
1994-03-01
Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211 At species, 211 At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs
Experimental and computational evidence of halogen bonds involving astatine
Guo, Ning; Maurice, Rémi; Teze, David; Graton, Jérôme; Champion, Julie; Montavon, Gilles; Galland, Nicolas
2018-03-01
The importance of halogen bonds—highly directional interactions between an electron-deficient σ-hole moiety in a halogenated compound and an acceptor such as a Lewis base—is being increasingly recognized in a wide variety of fields from biomedicinal chemistry to materials science. The heaviest halogens are known to form stronger halogen bonds, implying that if this trend continues down the periodic table, astatine should exhibit the highest halogen-bond donating ability. This may be mitigated, however, by the relativistic effects undergone by heavy elements, as illustrated by the metallic character of astatine. Here, the occurrence of halogen-bonding interactions involving astatine is experimentally evidenced. The complexation constants of astatine monoiodide with a series of organic ligands in cyclohexane solution were derived from distribution coefficient measurements and supported by relativistic quantum mechanical calculations. Taken together, the results show that astatine indeed behaves as a halogen-bond donor—a stronger one than iodine—owing to its much more electrophilic σ-hole.
Bibliography of astatine chemistry and biomedical applications
International Nuclear Information System (INIS)
Berei, K.; Vasaros, L.
1992-02-01
An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211 At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)
Measurement of the first ionization potential of astatine by laser ionization spectroscopy
Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Köster, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjödin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.
2013-01-01
The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine. PMID:23673620
Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials
DEFF Research Database (Denmark)
Aneheim, Emma; Albertsson, Per; Bäck, Tom
2015-01-01
To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...... vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....
DEFF Research Database (Denmark)
Aneheim, Emma; Gustafsson, Anna; Albertsson, Per
2016-01-01
Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single...... to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3......-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison...
The reaction of astatine with aromatic diazonium compounds
International Nuclear Information System (INIS)
Visser, G.W.M.; Diemer, E.L.
1982-01-01
Astatine reacts prefrentially with that type of aromatic diazonium salt that decomposes via a radical reaction channel (homolytic breakage of the C-N bond). The dediazonation with p-aminobenzoic acid and p-toluidine as model compounds was investigated through estatin produced in the 209 Bi(α,2n) 211 At reaction. (author)
International Nuclear Information System (INIS)
Sjoestroem, A.; Carlsson, J.; Lundqvist, H.; Koziorowski, J.
2003-01-01
A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)
Some aspects of the organic, biological and inorganic chemistry of astatine
International Nuclear Information System (INIS)
Visser, G.W.M.
1982-01-01
Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments ( 209 At, 210 At, 211 At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)
International Nuclear Information System (INIS)
Nestor, M.; Anniko, M.; Persson, M.; Dongen, G.A.M.S. van; Jensen, H.J.; Lundqvist, H.; Tolmachev, V.
2005-01-01
The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with 211 At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with 125 I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with 131 I-labelled cMAb U36 (directly labelled). Comparisons between 211 At-cMAb U36 and 125 I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31±2% vs 42.6±1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for 211 At-cMAb U36, with about 10% cell survival at 50 decays per cell. The 131 I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Nestor, M.; Anniko, M. [Uppsala University, Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala (Sweden); Persson, M. [Uppsala University, Unit of Urology, Department of Surgical Sciences, Uppsala (Sweden); Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden); Dongen, G.A.M.S. van [Vrije Universiteit Medical Center, Department of Otolaryngology/Head and Neck Surgery, Amsterdam (Netherlands); Jensen, H.J. [Righshospitalet, PET and Cyclotron Unit, Department of Clinical Physiology and Nuclear Medicine, Copenhagen (Denmark); Lundqvist, H.; Tolmachev, V. [Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden)
2005-11-01
The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with {sup 211}At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with {sup 125}I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with {sup 131}I-labelled cMAb U36 (directly labelled). Comparisons between {sup 211}At-cMAb U36 and {sup 125}I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31{+-}2% vs 42.6{+-}1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for {sup 211}At-cMAb U36, with about 10% cell survival at 50 decays per cell. The {sup 131}I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)
International Nuclear Information System (INIS)
Lindegren, S.; Andersson, H.; Baeck, T.; Jacobsson, L.; Karlsson, B.; Skarnemark, G.
2001-01-01
Monoclonal antibodies C215, reactive with colorectal carcinomas, and MOv18, reactive with most of the ovarian carcinomas, were radiohalogenated with [ 211 At]astatine. The radiohalogen was conjugate coupled to antibodies via the intermediate labelling reagent N-succinimidyl-3-(trimethylstannyl)benzoate (m-MeATE) in a two-step, single-pot reaction. Optimisation of the labelling of the reagent was achieved using N-iodosuccinimide, NIS, as the oxidising agent. The yields ranged from 69-95% in the labelling of 0.1-1.0 nmole of the m-MeATE precursor. Subsequent conjugation to antibodies resulted in yields of 58±7%. In vitro binding to tumour cells showed that the immunoreactivity of both antibodies was retained after astatine labelling
211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals
International Nuclear Information System (INIS)
Pruszynski, M.; Bilewicz, A.
2006-01-01
211 At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211 At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At - to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh 3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At - anions, but first of all because of the kinetic inertness of low spin rhodium(III) d 6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh 3+ . The experiments related to optimization of the reaction conditions were performed with the 131 I, basing on a chemical similarity of I - to At - . The experiments with 211 At were then carried out under the conditions found optimal for I - . The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211 At-Rh(16-S4-diol) complex
Czech Academy of Sciences Publication Activity Database
Sjostrom, A.; Tolmachev, V.; Lebeda, Ondřej; Koziorowski, J.; Carlsson, J.; Lundqvist, H.
2003-01-01
Roč. 256, č. 7 (2003), s. 191-197 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Keywords : neutron-capture therapy * astatine-211 Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.472, year: 2003
International Nuclear Information System (INIS)
Rothe, Sebastian
2012-01-01
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Rothe, Sebastian; Nörtershäuser, W
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Energy Technology Data Exchange (ETDEWEB)
Rothe, Sebastian
2012-09-24
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Determination of the electron affinity of astatine and polonium by laser photodetachment
We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.
International Nuclear Information System (INIS)
Eichler, B.; Son Chun, K.
1985-01-01
In order to investigate the adsorption of astatine and radon on a palladium surface some on- and off-line thermochromatographic experiments were carried out with 210 At and 220 Rn tracers. The partial molar adsorption enthalpy for zero covering was found to be ΔH/sub a//sup 0, loc./(At) = -(15S +- 10) kJ mole -1 and ΔH/sub a//sup 0, mob./(Rn) = -(37 +- 4) kJ mole -1 . The results are compared with theoretical and experimental values for other elements of the sixth period. The adsorption behaviour of At is in conformity with that of the p-metals on a palladium surface. (author)
International Nuclear Information System (INIS)
Otozai, K.; Takahashi, N.
1982-01-01
After astatine (0) was mixed with 131 I 2 containing carrier I 2 , the sample was analyzed by means of radiogaschromatography and the peaks due to I 2 , AtI and At 2 were observed. Further, the boiling points were estimated from the retention volume in terms of the semi-empirical theory on gas chromatography. The boiling points of I 2 , AtI and At 2 were 457 +- 2,486 +- 2 and 503 +- 3K, respectively. The boiling point of At 2 obtained in the present work is far smaller than that expected by the extrapolation of lighter halogens. (orig.)
Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag
2017-01-01
Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.
Andreyev, Andrei
2013-01-01
Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy
Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical
Energy Technology Data Exchange (ETDEWEB)
Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)
2008-12-15
No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.
Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical
International Nuclear Information System (INIS)
Lahiri, Susanta; Roy, Kamalika; Sen, Souvik
2008-01-01
No-carrier-added astatine radionuclides produced in the 7 Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about ∼12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h
Improved /sup 195m/Hg→/sup 195m/Au generator
International Nuclear Information System (INIS)
Panek, K.J.; Lindeyer, J.; van der Vlugt, H.C.
1985-01-01
The most recent state-of-the-art version of the /sup 195m/Hg→/sup 195m/Au generator is briefly discussed. Improvement of generator performance, particularly of elution yield, has been achieved by the introduction of columns containing a gradient-packed sorbent, by terminal sterilization of the columns in buffered sodium thiosulfate eluant, and by temperature variations during elutions. High loading of the generations (up to 450 mCi of /sup 195m/Hg) makes this generator usable for at least 3 days, even after longer (<24-hr) transportation times
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Scope. 195.48 Section 195.48 Transportation Other... Annual, Accident, and Safety-Related Condition Reporting § 195.48 Scope. This subpart prescribes... 7000-1.1) required by § 195.49 or to provide the estimate of total miles that could affect high...
Preparation and characteristics of a Hg-195m/Au-195m generator for first-pass angiography
International Nuclear Information System (INIS)
Bett, R.; Cuninghame, J.G.; Dymond, D.S.; Elliott, A.T.; Flatman, W.; Sims, H.E.; Stone, D.L.; Wills, H.H.
1984-01-01
A Hg-195m/Au-195m generator has been developed for medical use in first pass heart angiography. The mercury parent is bound to a thiol-containing column material from which Au-195m is eluted in dilute sodium cyanide solution. Such generators may have large quantities of activity adsorbed on the column and this can result in radiolytic reactions which cause a decrease of elution efficiency with time. Careful timing of the various operations involved in preparing these generators can help to stop this deterioration. Gold-195m decays to Au-195 which has a half-life of 183 days and it is important to operate the generator in such way as to keep the amount of Au-195 injected into the patient to a minimum. The method of production of these generators is presented. Effects of radiolytic reactions on generator use, and implications of the mass 195 decay chain to ultimate purity of the product are discussed
Energy Technology Data Exchange (ETDEWEB)
Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)
2011-12-14
The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and
49 CFR 195.50 - Reporting accidents.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Reporting accidents. 195.50 Section 195.50 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... PIPELINE Annual, Accident, and Safety-Related Condition Reporting § 195.50 Reporting accidents. An accident...
49 CFR 195.224 - Welding: Weather.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Welding: Weather. 195.224 Section 195.224 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... PIPELINE Construction § 195.224 Welding: Weather. Welding must be protected from weather conditions that...
49 CFR 195.210 - Pipeline location.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Pipeline location. 195.210 Section 195.210 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... PIPELINE Construction § 195.210 Pipeline location. (a) Pipeline right-of-way must be selected to avoid, as...
46 CFR 195.07-1 - Application.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Application. 195.07-1 Section 195.07-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS VESSEL CONTROL AND MISCELLANEOUS SYSTEMS AND EQUIPMENT Anchors, Chains, and Hawsers § 195.07-1 Application. (a) The provisions of...
49 CFR 195.424 - Pipe movement.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Pipe movement. 195.424 Section 195.424... PIPELINE Operation and Maintenance § 195.424 Pipe movement. (a) No operator may move any line pipe, unless... in the line section involved are joined by welding unless— (1) Movement when the pipeline does not...
49 CFR 195.214 - Welding procedures.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Welding procedures. 195.214 Section 195.214... PIPELINE Construction § 195.214 Welding procedures. (a) Welding must be performed by a qualified welder in accordance with welding procedures qualified under Section 5 of API 1104 or Section IX of the ASME Boiler and...
49 CFR 195.260 - Valves: Location.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Valves: Location. 195.260 Section 195.260... PIPELINE Construction § 195.260 Valves: Location. A valve must be installed at each of the following locations: (a) On the suction end and the discharge end of a pump station in a manner that permits isolation...
21 CFR 137.195 - Crushed wheat.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Crushed wheat. 137.195 Section 137.195 Food and... Related Products § 137.195 Crushed wheat. Crushed wheat, coarse ground wheat, is the food prepared by so crushing cleaned wheat other than durum wheat and red durum wheat that, when tested by the method...
49 CFR 195.406 - Maximum operating pressure.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Maximum operating pressure. 195.406 Section 195.406 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS... HAZARDOUS LIQUIDS BY PIPELINE Operation and Maintenance § 195.406 Maximum operating pressure. (a) Except for...
49 CFR 195.444 - CPM leak detection.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false CPM leak detection. 195.444 Section 195.444... PIPELINE Operation and Maintenance § 195.444 CPM leak detection. Each computational pipeline monitoring (CPM) leak detection system installed on a hazardous liquid pipeline transporting liquid in single...
49 CFR 195.134 - CPM leak detection.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false CPM leak detection. 195.134 Section 195.134... PIPELINE Design Requirements § 195.134 CPM leak detection. This section applies to each hazardous liquid... computational pipeline monitoring (CPM) leak detection system and each replaced component of an existing CPM...
49 CFR 195.226 - Welding: Arc burns.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Welding: Arc burns. 195.226 Section 195.226 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... PIPELINE Construction § 195.226 Welding: Arc burns. (a) Each arc burn must be repaired. (b) An arc burn may...
49 CFR 195.234 - Welds: Nondestructive testing.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Welds: Nondestructive testing. 195.234 Section 195... HAZARDOUS LIQUIDS BY PIPELINE Construction § 195.234 Welds: Nondestructive testing. (a) A weld may be... weld. (b) Any nondestructive testing of welds must be performed— (1) In accordance with a written set...
Spectroscopic Studies of the Nucleus GOLD-195
Fischer, Susan Marie
The nucleus ^{195}Au has been studied via in-beam gamma -ray and electron spectroscopy with the reactions ^{196}Pt(p,2n)^ {195}Au at beam energies of 12 and 16 MeV, and the reaction ^{rm nat }Ir(alpha,2n) ^{195}Au at a beam energy of 26 MeV. All experiments were performed at the University of Notre Dame tandem accelerator facility and utilized elements of the University of Pittsburgh multi-detector gamma-array and ICEBall mini-orange electron spectrometer. Fifty-five new transitions and thirty-six new energy levels have been observed. The U(6/4) supersymmetric algebra has been proposed to provide a simultaneous description for the positive parity states of the pair of nuclei ^{194 }Pt and ^{195}Au. The observed energy spectra for these nuclei show satisfactory agreement with the U(6/4) predicted spectra. The collective properties including relative B(E2) values for the Pt and Au nuclei in this mass region are also consistent with theoretical predictions. However, the measured E2/M1 mixing ratios for transitions in ^{195} Au indicate that the single particle description for the odd-A nucleus is incomplete. The new data for ^{195}Au is further combined with the existing data for ^{194} Pt and ^{195}Pt within the context of the larger U_{ nu}(6/12) otimes U_{pi}(6/4) supersymmetry. A consistent fit to the energy eigenvalue equation is obtained and a modified prediction for the negative parity states in the odd-odd nucleus ^{196} Au is made. Thus, the proposal of an underlying supersymmetry for the quartet of nuclei ^ {194}Pt-^{195} Pt-^{195}Au- ^{196}Au also appears valid. New transitions and levels involved in the negative parity h_{11/2} decoupled band in ^{195}Au have also been observed. The band appears to be much more fragmented at high spins than the analogous structures in the lighter odd-A Au nuclei, but it is unclear what the source of this difference is. It is, however, proposed that a consistent description for both the positive and negative parity
49 CFR 195.222 - Welders: Qualification of welders.
2010-10-01
... be qualified in accordance with section 6 of API 1104 (incorporated by reference, see § 195.3) or... and found acceptable under section 9 of API 1104 (incorporated by reference, see § 195.3). [Amdt. 195...
Preparation and use of 195m Au-containing liquid
International Nuclear Information System (INIS)
Panek, K.J.
1983-01-01
A 195m Au-containing liquid is prepared by adsorbing 195m-Hg on an adsorption agent and then eluting the daughter radioisotope 195m-Au. A radioisotope generator and the adsorption agent to be used in preparation of 195m Au-containing liquids are also claimed
46 CFR 195.40-1 - Pilot boarding equipment.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Pilot boarding equipment. 195.40-1 Section 195.40-1... CONTROL AND MISCELLANEOUS SYSTEMS AND EQUIPMENT Pilot Boarding Equipment § 195.40-1 Pilot boarding... boat or other vessel. (b) Each vessel must have suitable pilot boarding equipment available for use on...
Platinum-195 nuclear magnetic resonance of organometallic compounds
Ursini, Cleber Vinicius
1997-01-01
A brief review of 195Pt NMR is presented, focusing organometallic compounds. This article gives initially basic information of NMR processes involving 195Pt nucleus. It is followed by a discussion of the factors which affect the chemical shifts and coupling constants. Finally, some aspects of 195Pt NMR of solids are commented.
Astatine-211 Radiochemistry: The Development Of Methodologies For High Activity Level Radiosynthesis
International Nuclear Information System (INIS)
Zalutsky, Michael R.
2012-01-01
Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for α-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the α-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At-labeled targeted
ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS
Energy Technology Data Exchange (ETDEWEB)
MICHAEL R. ZALUTSKY
2012-08-08
Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At
49 CFR 195.207 - Transportation of pipe.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Transportation of pipe. 195.207 Section 195.207 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY...
49 CFR 195.208 - Welding of supports and braces.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Welding of supports and braces. 195.208 Section 195.208 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS... HAZARDOUS LIQUIDS BY PIPELINE Construction § 195.208 Welding of supports and braces. Supports or braces may...
16 CFR 1.95 - Procedures upon election.
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Procedures upon election. 1.95 Section 1.95 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE GENERAL... the appropriate district court of the United States for an order enforcing the assessment of the civil...
Shell structure and shape coexistence in {sup 195}Pb
Energy Technology Data Exchange (ETDEWEB)
Fant, B. [Helsinki Univ. (Finland). Dept. of Physics; Cederwall, B. [Royal Inst. of Tech., Physics Dept., Stockholm (Sweden); Cederkaell, J. [Royal Inst. of Tech., Physics Dept., Stockholm (Sweden); Norlin, L.O. [Royal Inst. of Tech., Physics Dept., Stockholm (Sweden); Wyss, R. [Royal Inst. of Tech., Physics Dept., Stockholm (Sweden); Fallon, P. [Lawrence Berkeley Lab., Berkeley, CA (United States); Beausang, C.W. [Oliver Lodge Lab., Univ. of Liverpool (United Kingdom); Butler, P.A. [Oliver Lodge Lab., Univ. of Liverpool (United Kingdom); Roberts, J.W. [Oliver Lodge Lab., Univ. of Liverpool (United Kingdom); Bruce, A.M. [Dept. of Mathematical Sciences, Univ. of Brighton (United Kingdom); Cullen, D.M. [Oak Ridge National Lab., TN (United States); Mullins, S.M. [Dept. of Physics and Astronomy, McMaster Univ., Hamilton, ON (Canada); Poynter, R.J. [Dept. of Physics, Univ. of York, Heslington (United Kingdom); Wadsworth, R. [Dept. of Physics, Univ. of York, Heslington (United Kingdom); Riley, M.A. [Florida State Univ., Tallahassee, FL (United States). Dept. of Physics; Korten, W. [Bonn Univ. (Germany). Inst. fuer Strahlen- und Kernphysik; Piiparinen, M.J. [Accelerator Lab., Univ. of Jyvaeskylae (Finland)
1995-12-31
{sup 195}Pb was investigated utilizing the reactions {sup 164}Dy({sup 36}S, 5n){sup 195}Pb and {sup 164}Dy({sup 34}S, 3n){sup 195}Pb at beam energies of 170 and 160 MeV respectively. Two new dipole bands which feed into the yrast 25/2{sup +} state, were found in {sup 195}Pb. The connection between the bands and the spherical states was established and thus spins and energies of the involved collective states were determined. The deformation is understood as mainly due to excitations of protons across the Z = 82 shell gap. The observed backbends are interpreted as alignment of i{sub 13/2} neutrons. (orig.).
40 CFR 159.195 - Reporting of other information.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Reporting of other information. 159.195 Section 159.195 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE... reported to the Agency. (4) Use of a pesticide promotes or creates secondary pest infestations. (5) Any...
2010-04-01
... industrial use, unless such distilled spirits are shipped or delivered directly to the industrial user... of Distilled Spirits Sales of Distilled Spirits for Industrial Use § 1.95 General. Distillers...
34 CFR 668.195 - Participation rate index appeals.
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false Participation rate index appeals. 668.195 Section 668... Rates § 668.195 Participation rate index appeals. (a) Eligibility. (1) You may appeal a notice of a loss... participation rate index for that cohort's fiscal year is equal to or less than 0.06015. (2) You may appeal a...
2010-07-01
... PROFICIENCY PROGRAMS General Provisions § 195.2 Definitions. Definitions in 15 U.S.C. 2602 and 2662 apply to... exam means the exam which evaluates individuals who provide radon measurement services in a residential...
46 CFR 195.06-1 - Lifesaving appliances and arrangements.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Lifesaving appliances and arrangements. 195.06-1 Section... VESSELS VESSEL CONTROL AND MISCELLANEOUS SYSTEMS AND EQUIPMENT Lifesaving Appliances and Arrangements § 195.06-1 Lifesaving appliances and arrangements. All lifesaving appliances and arrangements shall be...
49 CFR 195.52 - Telephonic notice of certain accidents.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Telephonic notice of certain accidents. 195.52... TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Annual, Accident, and Safety-Related Condition Reporting § 195.52 Telephonic notice of certain accidents. (a) At the earliest practicable moment following discovery of a...
International Nuclear Information System (INIS)
Griffin, J.C.; Braga, R.A.; Fink, R.W.; Bingham, C.R.; Coenen, E.; Huyse, M.; Duppen, P. van
1991-01-01
The radioactive decay of mass-separated 3.0 m 195g Bi to 195 Pb has been studied with the UNISOR and LISOL facilities. Time-sequenced spectra of γ-rays, X-rays, and conversion electrons have been obtained, together with γγt, γXt, eγt, and eXt coincidence data. From this information, a decay scheme has been constructed consisting of 23 excited states and 34 transitions in 195 Pb. Transitions with E0 multipole admixtures, indicative of shape coexistence, have been found to de-excite positive-parity levels at 1093, 1329, and 1380 keV. The beta-decay energy of the 195 Bi ground state is deduced to be Q EC =4800 +600 -550 keV based on the measurement of γ-ray-gated K/β + ratios. The excitation energy of the i 13/2 isomer in 195 Pb has been determined to be 203±4 keV from the α-decays of 199m,g Po. (orig.)
46 CFR 154.195 - Aluminum cargo tank: Steel enclosure.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Aluminum cargo tank: Steel enclosure. 154.195 Section... Equipment Hull Structure § 154.195 Aluminum cargo tank: Steel enclosure. (a) An aluminum cargo tank and its... the aluminum cargo tank must meet the steel structural standards of the American Bureau of Shipping...
Preclinical imaging characteristics and quantification of Platinum-195m SPECT
Energy Technology Data Exchange (ETDEWEB)
Aalbersberg, E.A.; Wit-van der Veen, B.J. de; Vegt, E.; Vogel, Wouter V. [The Netherlands Cancer Institute (NKI-AVL), Department of Nuclear Medicine, Amsterdam (Netherlands); Zwaagstra, O.; Codee-van der Schilden, K. [Nuclear Research and Consultancy Group (NRG), Petten (Netherlands)
2017-08-15
In vivo biodistribution imaging of platinum-based compounds may allow better patient selection for treatment with chemo(radio)therapy. Radiolabeling with Platinum-195m ({sup 195m}Pt) allows SPECT imaging, without altering the chemical structure or biological activity of the compound. We have assessed the feasibility of {sup 195m}Pt SPECT imaging in mice, with the aim to determine the image quality and accuracy of quantification for current preclinical imaging equipment. Enriched (>96%) {sup 194}Pt was irradiated in the High Flux Reactor (HFR) in Petten, The Netherlands (NRG). A 0.05 M HCl {sup 195m}Pt-solution with a specific activity of 33 MBq/mg was obtained. Image quality was assessed for the NanoSPECT/CT (Bioscan Inc., Washington DC, USA) and U-SPECT{sup +}/CT (MILabs BV, Utrecht, the Netherlands) scanners. A radioactivity-filled rod phantom (rod diameter 0.85-1.7 mm) filled with 1 MBq {sup 195m}Pt was scanned with different acquisition durations (10-120 min). Four healthy mice were injected intravenously with 3-4 MBq {sup 195m}Pt. Mouse images were acquired with the NanoSPECT for 120 min at 0, 2, 4, or 24 h after injection. Organs were delineated to quantify {sup 195m}Pt concentrations. Immediately after scanning, the mice were sacrificed, and the platinum concentration was determined in organs using a gamma counter and graphite furnace - atomic absorption spectroscopy (GF-AAS) as reference standards. A 30-min acquisition of the phantom provided visually adequate image quality for both scanners. The smallest visible rods were 0.95 mm in diameter on the NanoSPECT and 0.85 mm in diameter on the U-SPECT{sup +}. The image quality in mice was visually adequate. Uptake was seen in the kidneys with excretion to the bladder, and in the liver, blood, and intestine. No uptake was seen in the brain. The Spearman correlation between SPECT and gamma counter was 0.92, between SPECT and GF-AAS it was 0.84, and between GF-AAS and gamma counter it was0.97 (all p < 0
International Nuclear Information System (INIS)
1980-01-01
A procedure is described for the preparation of an Ausup(195m) containing fluid by adsorbing the parent isotope Hgsup(195m) onto an adsorption material and then eluting the radioactive daughter isotope Ausup(195m). The packing materials for the chromatographic column are silica gel, porous and massive glass beads. The adsorption materials for Hg 195 are hydrated manganese dioxide, silver, and zinc, cadmium, silver or zirconium sulfides. The procedure for depositing these materials in the packing material is outlined and the most suitable eluting fluid for each adsorption material is presented. The procedure has applications in the execution of a radiodiagnostic examination using an Ausup(195m) labelled fluid. (C.F.)
A new high-spin isomer in {sup 195}Bi
Energy Technology Data Exchange (ETDEWEB)
Roy, T.; Mukherjee, G.; Rana, T.K.; Bhattacharya, Soumik; Asgar, Md.A.; Bhattacharya, C.; Bhattacharya, S.; Bhattacharyya, S.; Pai, H. [Variable Energy Cyclotron Centre, Kolkata (India); Madhavan, N.; Bala, I.; Gehlot, J.; Gurjar, R.K.; Jhingan, A.; Kumar, R.; Muralithar, S.; Nath, S.; Singh, R.P.; Varughese, T. [Inter University Acclerator Centre, New Delhi (India); Basu, K.; Bhattacharjee, S.S.; Ghugre, S.S.; Raut, R.; Sinha, A.K. [UGC-DAE-CSR Kolkata Centre, Kolkata (India); Palit, R. [Tata Institute of Fundamental Research, Department of Nuclear and Atomic Physics, Mumbai (India)
2015-11-15
A new high-spin isomer has been identified in {sup 195}Bi at the focal plane of the HYbrid Recoil mass Analyser (HYRA) used in the gas-filled mode. The fusion evaporation reactions {sup 169}Tm ({sup 30}Si, x n) {sup 193,} {sup 195}Bi were used with the beam energies on targets of 168 and 146MeV for 6n and 4n channels, respectively. The evaporation residues, separated from the fission fragments, and their decays were detected at the focal plane of HYRA using MWPC, Si-Pad and clover HPGe detectors. The half-life of the new isomer in {sup 195}Bi has been measured to be 1.6(1) μs. The configuration of the new isomer has been proposed and compared with the other isomers in this region. The Total Routhian Surface (TRS) calculations for the three-quasiparticle configurations corresponding to the new isomer suggest an oblate deformation for this isomeric state. The same calculations for different configurations in {sup 195}Bi and for the even-even {sup 194}Pb core indicate that the proton i{sub 13/2} orbital has a large shape driving effect towards oblate shape in these nuclei. (orig.)
Recovery of carrier-free gold-195
International Nuclear Information System (INIS)
Iofa, B.Z.; Ivanova, N.A.
1995-01-01
It is known that gold(III) is readily extracted from nitric acid solutions with ethers. The authors have studied extraction of trace amounts of gold(III) from nitric acid solutions with diethyl and diisopropyl ethers in the presence of significant excess of Pt(IV). Distribution coefficients of gold(III) were measured radiometrically using carrier-free gold-195 or spectrophotometrically in the presence of platinum(IV). Very high coefficients of gold separation from platinum may be achieved. Preliminary experiments have shown that zinc-65 was not extracted with ethers from nitric acid solutions. As an extraction system, the authors have chosen the system 10 M HNO 3 -diisopropyl ether. After model experiments, the authors have performed recovery of carrier-free gold-195 from a real platinum target irradiated with protons in a cyclotron
Biodistribution and dosimetry of 195mPt-cisplatin in normal volunteers
Sathekge, M.; Wagener, J.; Smith, S.V.; Soni, N.; Zeevaart, J.R.
2013-01-01
195mPt-cisplatin is regarded as a promising imaging agent for optimizing dosage in patients receiving cisplatin chemotherapy. We investigated the whole-body distribution and radiation dosimetry of 195mPt-cisplatin in humans. Methods: Whole-body scans were obtained up to 144 h after intravenous injection of 112.4 MBq 195mPt-cisplatin in each of five subjects. Blood samples were taken at various times up to 144 h after injection. Urine was collected up to 114 h aft...
Gold-195m short-lived single-photon emitter for cardiovascular studies
International Nuclear Information System (INIS)
Mena, I.; de Jong, R.; Mena, F.J.; Narahara, K.A.
1985-01-01
Ultrashort-lived radionuclides offer many advantages for clinical nuclear medicine. These radionuclide are generator-produced at bedside, with markedly diminished radiation exposure to the patient; larger doses of radionuclides can therefore be administered, and rapid, sequential, background-free studies can be performed. Gold-195m is an example of an ultrashort-lived radionuclide with a half-life of 30.4 sec. It is generated from /sup 195m/Hg (T/sub 1/2/, 40.6 hr). The quality of imaging and radiation exposure to patients is a function of the percentage breakthrough of /sup 195m/Hg owing to high-energy gamma radiation and longer half-life. Percentage breakthrough of /sup 195m/Hg was measured. The performance of the generator was assessed by determining the coefficient of variation of subsequent measurements
2010-04-01
... juice to which wine spirits have been added may be used in the production of special natural wine... TREASURY LIQUORS WINE Production of Special Natural Wine § 24.195 General. Special natural wine is a flavored wine made on bonded wine premises from a base of natural wine. The flavoring added may include...
49 CFR 195.573 - What must I do to monitor external corrosion control?
2010-10-01
... SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Corrosion Control § 195.573 What must I do to... 49 Transportation 3 2010-10-01 2010-10-01 false What must I do to monitor external corrosion control? 195.573 Section 195.573 Transportation Other Regulations Relating to Transportation (Continued...
49 CFR 195.583 - What must I do to monitor atmospheric corrosion control?
2010-10-01
... SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Corrosion Control § 195.583 What must I do to... 49 Transportation 3 2010-10-01 2010-10-01 false What must I do to monitor atmospheric corrosion control? 195.583 Section 195.583 Transportation Other Regulations Relating to Transportation (Continued...
49 CFR 195.559 - What coating material may I use for external corrosion control?
2010-10-01
...) PIPELINE SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Corrosion Control § 195.559 What coating... 49 Transportation 3 2010-10-01 2010-10-01 false What coating material may I use for external corrosion control? 195.559 Section 195.559 Transportation Other Regulations Relating to Transportation...
Bai, R; Zhao, A-Q; Zhao, Z-Q; Liu, W-L; Jian, D-M
2015-02-01
The chondrocytes, the resident cells of cartilage, are maintained and take effects in the whole life upon chronic hypoxic exposure, which hypoxia-inducible factor 1 alpha (HIF-1α) play pivotal roles in response to. Dysregulation of some microRNA (miRNAs) have also been identified to be involved in hypoxia-related physiologic and pathophysiologic responses in some tissues or cell lines. However, the mechanism of miRNAs reponse to hypoxia remain largely unknown in chondrocytes, including the microRNA-195 (miR-195). AIM To investigate the effects of microRNAs (miRNAs) and hypoxia-inducible factor 1 alpha (HIF-1α) on chondrocytes in physiologic environment. We compared the expression of miR-195 and HIF-1α mRNA on hypoxia with that on normoxia in ATDC 5 cells by qRT-PCR. Further experiments was performed to confirmed the relationships of miR-195 and HIF-1α by bioinformatics analysis and dual reporter gene assay. we also assessed the effect of miR-195 on apoptosis in hypoxic ATDC 5 cells by transfect with miR-195 mimics. It was found the downregulated miR-195 and upregulated HIF-1α were present in hypoxic ATDC 5 cells. miR-195 negatively regulated HIF-1α by targeting its 3'-untranslated region. Moreover, the founding indicated miR-195 greatly increased apoptosis and downregulated HIF-1α mRNA occurred simultaneously in hypoxic chondrocytes. We concluded that miR-195 induced apoptosis in hypoxic chondrocytes by directly targeting HIF-1α.
Oblate deformation and intruder configuration in 194,195Bi
International Nuclear Information System (INIS)
Mukherjee, G.; Banerjee, K.; Banerjee, S.R.; Basu, S.K.; Bhattacharya, C.; Bhattacharya, S.; Bhattacharya, Srijit; Bhattacharjee, T.; Chanda, S.; Dey, A.; Gupta, D.; Meena, J.K.; Mukhopadhyay, S.; Rana, T.K.; Bhattacharya, Sudeb; Ganguly, S.; Goswami, A.; Kshetri, R.; Pradhan, M.K.; Raut, R.; Dey, G.
2006-01-01
The experimental information on 194,195 Bi are very scarce compared to its neighbouring isotopes. Only 6 levels above the ground state band of 195 Bi, based on 9/2, are known with tentative spin parity assignments. Only two low energy gamma rays above the 10 isomeric state are known in 194 Bi. It is interesting not only to extend the presently known bands to higher spins, beyond band crossing but also to search for the intruder quasiparticle configurations to get a clear idea about the structure of these nuclei
M1 transitions between superdeformed states in 195Tl
International Nuclear Information System (INIS)
Zheng Xing; Xingqu Chen; Xiaochun Wang
1996-01-01
Using a triaxial-particle-rotor model, the quadrupole and dipole transition energies, kinematic and dynamic moments of inertia, electromagnetic transition probabilities and the relative intensity of the E2 γ-transitions are calculated for superdeformed bands in 195 Tl. A strong perturbation effect of rotation on transition energies and M1 and E2 transitions of superdeformed states is investigated. The total M1 transitions, enhanced by internal conversion, are expected to compete strongly with the E2 γ-ray at low spins in the superdeformed 195 Tl nucleus. (author)
9 CFR 381.195 - Definitions; requirements for importation into the United States.
2010-01-01
... PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION POULTRY PRODUCTS INSPECTION REGULATIONS... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Definitions; requirements for importation into the United States. 381.195 Section 381.195 Animals and Animal Products FOOD SAFETY AND...
2010-10-01
... 1014 (incorporated by reference, see § 195.01-3). (d) All lifelines shall be of steel or bronze wire rope. Steel wire rope shall be either inherently corrosion-resistant, or made so by galvanizing or... burns from scalding steam. The outer surface shall be water resistant. [CGFR 67-83, 33 FR 1156, Jan. 27...
30 CFR 250.195 - What notification does MMS require on the production status of wells?
2010-07-01
... the well in a production status. You must confirm oral notification by telefax or e-mail within those... production status of wells? 250.195 Section 250.195 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT... Information and Reporting Requirements § 250.195 What notification does MMS require on the production status...
49 CFR 195.551 - What do the regulations in this subpart cover?
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false What do the regulations in this subpart cover? 195... SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Corrosion Control § 195.551 What do the regulations in this subpart cover? This subpart prescribes minimum requirements for protecting steel pipelines...
Phenotype-gene: 195 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available uence of brassinosteroid for AT4G33430 ... decreased sensitivity toward under influence... 195 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1193i decreased sensitivity toward under infl
49 CFR 195.579 - What must I do to mitigate internal corrosion?
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false What must I do to mitigate internal corrosion? 195... SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Corrosion Control § 195.579 What must I do to mitigate internal corrosion? (a) General. If you transport any hazardous liquid or carbon dioxide that...
Regulation of cell cycle checkpoint kinase WEE1 by miR-195 in malignant melanoma.
Bhattacharya, A; Schmitz, U; Wolkenhauer, O; Schönherr, M; Raatz, Y; Kunz, M
2013-06-27
WEE1 kinase has been described as a major gate keeper at the G2 cell cycle checkpoint and to be involved in tumour progression in different malignant tumours. Here we analysed the expression levels of WEE1 in a series of melanoma patient samples and melanoma cell lines using immunoblotting, quantitative real-time PCR and immunohistochemistry. WEE1 expression was significantly downregulated in patient samples of metastatic origin as compared with primary melanomas and in melanoma cell lines of high aggressiveness as compared with cell lines of low aggressiveness. Moreover, there was an inverse correlation between the expression of WEE1 and WEE1-targeting microRNA miR-195. Further analyses showed that transfection of melanoma cell lines with miR-195 indeed reduced WEE1 mRNA and protein expression in these cells. Reporter gene analysis confirmed direct targeting of the WEE1 3' untranslated region (3'UTR) by miR-195. Overexpression of miR-195 in SK-Mel-28 melanoma cells was accompanied by WEE1 reduction and significantly reduced stress-induced G2-M cell cycle arrest, which could be restored by stable overexpression of WEE1. Moreover, miR-195 overexpression and WEE1 knockdown, respectively, increased melanoma cell proliferation. miR-195 overexpression also enhanced migration and invasiveness of melanoma cells. Taken together, the present study shows that WEE1 expression in malignant melanoma is directly regulated by miR-195. miR-195-mediated downregulation of WEE1 in metastatic lesions may help to overcome cell cycle arrest under stress conditions in the local tissue microenvironment to allow unrestricted growth of tumour cells.
49 CFR 195.3 - Incorporation by reference.
2010-10-01
...); 195.440(c). (15) API Recommended Practice 1165, “Recommended Practice for Pipeline SCADA Displays.... (PRCI): (1) AGA Pipeline Research Committee, Project PR-3-805, “A Modified Criterion for Evaluating the... Specification 6D, “Specification for Pipeline Valves” (23rd edition, April 2008, effective October 1, 2008) and...
Studies with Pt-195M platinum complexes
International Nuclear Information System (INIS)
Cole, W.; Wiza, J.; Odenheimer, B.; Wolf, W.; Hoeschele, J.D.; Butler, T.A.; Smyth, R.D.
1982-01-01
Cis-diamine-ethylmalonato 195 Pt(II) has been synthesised to investigate its chemotherapeutic potential in cancer and other diseases. It is likely to be less nephrotoxic than the established drug crisplatin. Biodistribution and clearance studies were carried out on Sprague-Dowley rats after intravenous administration of the new drug. (author)
Gold-195m for studies on regional pulmonary circulation
International Nuclear Information System (INIS)
Eriksson, L.; Andersson, L.; Jonson, B.; Westling, H.; White, T.; Wollmer, P.
1985-01-01
Six healthy controls, seven patients with coronary heart disease (CHD), and five patients with exercise-induced asthma (EIA) were studied in the sitting position at rest and during maximum exercise. The radionuclide gold-195m was used in the studies. A redistribution of activity toward the lung apex was found during exercise, the change being more pronounced in the healthy controls than in the patients with CHD. In two of the three patients in which exercise induced an asthmatic attack, gross reductions in the activity were seen in different areas of the lung. The authors conclude that gold-195m can be used for studies of rapid changes in regional pulmonary circulation
Lifetime measurement in {sup 195}Po
Energy Technology Data Exchange (ETDEWEB)
Grahn, T.; Page, R.D. [University of Liverpool, Department of Physics, Oliver Lodge Laboratory, Liverpool (United Kingdom); Dewald, A.; Jolie, J.; Melon, B.; Pissulla, T. [Universitaet zu Koeln, Institut fuer Kernphysik, Koeln (Germany); Greenlees, P.T.; Jakobsson, U.; Jones, P.; Julin, R.; Juutinen, S.; Ketelhut, S.; Leino, M.; Nyman, M.; Peura, P.; Rahkila, P.; Saren, J.; Scholey, C.; Sorri, J.; Uusitalo, J. [University of Jyvaeskylae, Department of Physics, P.O. Box 35, Jyvaeskylae (Finland); Kroell, T.; Kruecken, R.; Maierbeck, P. [TU Muenchen, Physik-Department E12, Garching (Germany)
2009-03-15
The lifetime of the 17/2{sup +} yrast state in {sup 195}Po has been measured using the recoil distance Doppler-shift technique to be {tau}=43(11) ps. The lifetime was extracted from the singles {gamma}-ray spectra obtained by using the recoil-decay tagging method. The present work provides more information of the coupling schemes, shapes and configuration mixing in neutron-deficient odd-mass Po nuclei. (orig.)
27 CFR 46.195 - Floor stocks requirements.
2010-04-01
... Tubes Held for Sale on April 1, 2009 General § 46.195 Floor stocks requirements. (a) Take inventory. The dealer must establish the quantity of articles subject to the floor stocks tax held for sale on April 1, 2009. The dealer may take a physical inventory or may use a record (book) inventory, as specified in...
49 CFR 195.4 - Compatibility necessary for transportation of hazardous liquids or carbon dioxide.
2010-10-01
... hazardous liquids or carbon dioxide. 195.4 Section 195.4 Transportation Other Regulations Relating to... necessary for transportation of hazardous liquids or carbon dioxide. No person may transport any hazardous liquid or carbon dioxide unless the hazardous liquid or carbon dioxide is chemically compatible with both...
49 CFR 195.412 - Inspection of rights-of-way and crossings under navigable waters.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Inspection of rights-of-way and crossings under navigable waters. 195.412 Section 195.412 Transportation Other Regulations Relating to Transportation... Inspection of rights-of-way and crossings under navigable waters. (a) Each operator shall, at intervals not...
28 CFR 19.5 - Report to the Office of Juvenile Justice and Delinquency Prevention.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Report to the Office of Juvenile Justice and Delinquency Prevention. 19.5 Section 19.5 Judicial Administration DEPARTMENT OF JUSTICE USE OF... Justice and Delinquency Prevention. DOJ will compile and submit to OJJDP, by June 30, 1987, a consolidated...
2010-10-01
... corrosion and what coating material may I use? 195.581 Section 195.581 Transportation Other Regulations... Corrosion Control § 195.581 Which pipelines must I protect against atmospheric corrosion and what coating... atmosphere, except pipelines under paragraph (c) of this section. (b) Coating material must be suitable for...
7 CFR 3015.195 - Subgrants and cost-type contracts.
2010-01-01
...-21 would apply to the costs incurred by the institution of higher education even though OMB Circular A-87 would apply to the costs incurred by the State. ... 7 Agriculture 15 2010-01-01 2010-01-01 false Subgrants and cost-type contracts. 3015.195 Section...
Energy Technology Data Exchange (ETDEWEB)
Men, Y.; Feil, H.; VerBerkmoes, N.C.; Shah, M.B.; Johnson, D.R.; Lee, P.K.H; West, K.A.; Zinder, S.H.; Andersen, G.L.; Alvarez-Cohen, L.
2011-03-01
Dehalococcoides ethenogenes strain 195 (DE195) was grown in a sustainable syntrophic association with Desulfovibrio vulgaris Hildenborough (DVH) as a co-culture, as well as with DVH and the hydrogenotrophic methanogen Methanobacterium congolense (MC) as a tri-culture using lactate as the sole energy and carbon source. In the co- and tri-cultures, maximum dechlorination rates of DE195 were enhanced by approximately three times (11.0±0.01 lmol per day for the co-culture and 10.1±0.3 lmol per day for the tri-culture) compared with DE195 grown alone (3.8±0.1 lmol per day). Cell yield of DE195 was enhanced in the co-culture (9.0±0.5 x 107 cells per lmol Cl{sup -} released, compared with 6.8±0.9x 107 cells per lmol Cl{sup -} released for the pure culture), whereas no further enhancement was observed in the tri-culture (7.3±1.8x 107 cells per lmol Cl{sup -} released). The transcriptome of DE195 grown in the co-culture was analyzed using a whole-genome microarray targeting DE195, which detected 102 significantly up- or down-regulated genes compared with DE195 grown in isolation, whereas no significant transcriptomic difference was observed between co- and tri-cultures. Proteomic analysis showed that 120 proteins were differentially expressed in the co-culture compared with DE195 grown in isolation. Physiological, transcriptomic and proteomic results indicate that the robust growth of DE195 in co- and tri-cultures is because of the advantages associated with the capabilities of DVH to ferment lactate to provide H2 and acetate for growth, along with potential benefits from proton translocation, cobalamin-salvaging and amino acid biosynthesis, whereas MC in the tri-culture provided no significant additional benefits beyond those of DVH.
Quantitative assessment of the brain perfusion using the short-lived isotope 195m-Au
International Nuclear Information System (INIS)
Lindner, P.; Nickel, O.
1985-01-01
The possibilities of quantitatively assessing the brain perfusion on the basis of a modified transit time theory, using the favourable properties of the ultrashort-lived isotope 195m-Au, are shown. The intravascular deposition of the isotope 195m-Au enables quantitative brain perfusion studies based on both the dorsal and lateral projection. The 195m-Au isotope has a half-life of 30 sec and is able to be eluated from the 195m-Hg 195m-Au generator (Byk-Mallinckrodt). The quantification of brain perfusion (in terms of ml/min/100 g) is based on a recently published theory for non-diffusing radio-indicators, using a first-pass technique. This method of quantification corresponds to a modification of the transit time theory from Maier and Zierler (1) and accounts for the influences of dispersion and recirculation of an intravenously injected non-diffused tracer bolus (2, 3). The energy spectrum of the eluate from the generator shows two lines of high intensity at 262 keV and 68 keV. The low-energy peak is suited for the lateral view, i.e. brain perfusion studies of one hemisphere, without a significant 'look-through-effect'. The high-energy peak is successfully used for dorsal projections of brain perfusion studies. An examination takes less time than one minute and can be repeated after three minutes. Dynamic brain perfusion studies enable parametric images of the quantitative regional brain perfusion distribution, or the reciprocal mean transit times, to be obtained by calculation. Infarcted areas are able to be visualized with high sensitivity. Quantitative perfusion patterns during activation of the visual centre are detectable. The advantages of this method are discussed. (orig.) [de
Negative Ion Source Development and Photodetachment Studies at ISOLDE
AUTHOR|(CDS)2254068; Hanstorp, Dag; Rothe, Sebastian
Astatine is one of the rarest elements on earth. The small amount of existing astatine is either created in decay chains of heavier elements or artificially. One of its longer lived isotopes, 211At, is of interest for targeted alpha therapy, a method of treating cancer by using the alpha decay of radioactive elements directly at the location of a tumor. However, its chemical properties are yet to be determined due to the short life time of astatine. A milestone towards the determination of the electronegativity of astatine was the measurement of its ionization potential (IP) at CERN-ISOLDE. However, its electron affinity (EA, the binding energy of the additional electron in a negative ion), is still to be measured. In order to determine the EA of radioisotopes by laser photodetachment spectroscopy, the Gothenburg ANion Detector for Affinity measurements by Laser Photodetachment (GANDALPH) has been built in recent years. As a proof-of-principle, the EA of the 128I negative ion, produced at the CERN-ISOLDE rad...
A new isomer in 195Bi identified at the focal plane of HYRA
International Nuclear Information System (INIS)
Roy, T.; Mukherjee, G.; Asgar, Md. A.
2014-01-01
Due to the presence of high-j (h 9/2 and i 13/2 ) orbitals near the proton and neutron Fermi levels, high spin isomers are expected to occur for neutron deficient Bismuth nuclei (Z = 83) in A = 190 region. A 750 ns isomer has been known for a long time in 195 Bi whose excitation energy and decay path have been reported recently. A rotational band has been reported in this nucleus based on 13/2 + isomer, originated from the deformation driving i 13/2 orbital. This band reported to have prompt feeding through a 457 keV γ-ray apart from a strong feeding from the 750 ns isomer. In 193 Bi, the 29/2 - state is a 3μs isomer, another isomer with half-life >10μs is also known in this nucleus but its excitation energy, spin and parity are not known. Similar isomer has not yet been observed in 195 Bi. The aim of the present work was to find isomers and their decays in 193,195 Bi
49 CFR 195.228 - Welds and welding inspection: Standards of acceptability.
2010-10-01
...) The acceptability of a weld is determined according to the standards in Section 9 of API 1104. However... Appendix A to API 1104 (incorporated by reference, see § 195.3) applies to the weld, the acceptability of...
49 CFR 195.428 - Overpressure safety devices and overfill protection systems.
2010-10-01
... reliability of operation for the service in which it is used. (b) In the case of relief valves on pressure... the operator notes in the manual required by § 195.402 why compliance with that part is not necessary...
Directory of Open Access Journals (Sweden)
Wang Hui
Full Text Available Glioma proliferation is a multistep process during which a sequence of genetic and epigenetic alterations randomly occur to affect the genes controlling cell proliferation, cell death and genetic stability. microRNAs are emerging as important epigenetic modulators of multiple target genes, leading to abnormal cellular signaling involving cellular proliferation in cancers.In the present study, we found that expression of miR-195 was markedly downregulated in glioma cell lines and human primary glioma tissues, compared to normal human astrocytes and matched non-tumor associated tissues. Upregulation of miR-195 dramatically reduced the proliferation of glioma cells. Flow cytometry analysis showed that ectopic expression of miR-195 significantly decreased the percentage of S phase cells and increased the percentage of G1/G0 phase cells. Overexpression of miR-195 dramatically reduced the anchorage-independent growth ability of glioma cells. Furthermore, overexpression of miR-195 downregulated the levels of phosphorylated retinoblastoma (pRb and proliferating cell nuclear antigen (PCNA in glioma cells. Conversely, inhibition of miR-195 promoted cell proliferation, increased the percentage of S phase cells, reduced the percentage of G1/G0 phase cells, enhanced anchorage-independent growth ability, upregulated the phosphorylation of pRb and PCNA in glioma cells. Moreover, we show that miR-195 inhibited glioma cell proliferation by downregulating expression of cyclin D1 and cyclin E1, via directly targeting the 3'-untranslated regions (3'-UTR of cyclin D1 and cyclin E1 mRNA. Taken together, our results suggest that miR-195 plays an important role to inhibit the proliferation of glioma cells, and present a novel mechanism for direct miRNA-mediated suppression of cyclin D1 and cyclin E1 in glioma.
49 CFR 195.402 - Procedural manual for operations, maintenance, and emergencies.
2010-10-01
... operating conditions by monitoring pressure, temperature, flow or other appropriate operational data and...) Minimization of public exposure to injury and probability of accidental ignition by assisting with evacuation... SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Operation and Maintenance § 195.402 Procedural...
Development and therapeutic application of internally emitting radiopharmaceuticals
International Nuclear Information System (INIS)
Adelstein, S.J.; Bloomer, W.D.
1980-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Among the available α-emitters, astatine-211 appears most promising for testing the efficacy of α-emitters for therapeutic applications because: (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides; (2) it has a half life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells; and (3) α-emission is associated with 100% of its decays. If appropriate biological carriers can be labeled with an alpha emitter such as 211 At, they could be of great utility in several areas of therapeutic medicine where elimination of specific cell populations is desired. While previous attempts to astatinate proteins using standard iodination techniques have been unsuccessful, effective labeling of proteins with astatine by first synthesizing an aryl astatide and then coupling this compound to the protein via an acylation has been achieved. Undergoing current investigation are several different aryl astatide-followed-by-acylation approaches including an astatinated Bolton-Hunter type reagent using concanavalin A (ConA) and melanocyte stimulating hormone (MSH) as model compounds
International Nuclear Information System (INIS)
Draws, J.
1989-01-01
Au-195m cerebral perfusion studies in the diagnosis of blood supply disorders of the brain have only recently leaped into currency. Au-195m is not capable of diffusing. This particular property permits first-pass times of vascular transfer to be determined for cerebral tissues that correlate with the degree of cerebral circulation. In the study described here, attempts were made to shed more light on the clinical usefulness of the method. For this purpose, the record sheets of two cohorts of patients were analysed on a retrospective basis. 1. In 23 patients, where the cerebrovascular disorders were strictly confined to the cerebral hemispheres, the blood supply of the brain was examined on the basis of both Au-195m cerebral perfusion studies and the xenon-133 inhalation method. In the evaluation of the findings based on the Au-195m study the investigator was blinded to the neurological manifestations of the disease and the results from other studies. In 82% of the patients the perfusion mapping using Au-195m was consistent with the clinical symptoms. 2. In a second group of patients, the probable results of the Au-195m perfusion study were forecasted on the basis of the medical history, clinical symptoms and preliminary diagnosis and subsequently compared to those actually obtained. Expected and actual results were found to be in agreement for 88% of cases. The results provided evidence of the suitability of Au-195m cerebral perfusion studies to examine the blood suply of the brain. In view of the fact that the examinations and measurements are relatively uncomplicated, this newly developed method is most likely to be used on a broader basis in the future. (orig./MG) [de
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false How will Commerce entities add interest, penalty charges, and administrative costs to a Commerce debt? 19.5 Section 19.5 Commerce and Foreign Trade Office of the Secretary of Commerce COMMERCE DEBT COLLECTION Procedures To Collect Commerce...
Studies of {sup 194,195,197}Po
Energy Technology Data Exchange (ETDEWEB)
Carpenter, M.P.; Ahmad, I.; Crowell, B. [and others
1995-08-01
The energy systematics of low-lying polonium states show sudden changes near N = 114. The observed drops in the low-lying levels of {sup 196,198}Po relative to the heavier isotopes indicate significant changes in the underlying structure of these nuclei. It is thought that this change is due to the onset of vibrational collectivity brought about by the quadrupole interaction between neutron and proton-pairs. In order to extend the Po systematics even further, we measured, for the first time, states in {sup 194,195,197}Po using the {sup 28}Si + {sup 170}Yb reaction at a beam energy of 142 MeV. The beam was supplied by ATLAS, and the data were taken with 10 Compton-suppressed Ge detectors placed at the target position of the Fragment Mass Analyzer. Preliminary level schemes were constructed for {sup 194,195,197}Po based on {gamma}-{gamma} and {gamma}-FMA coincidences. The results for {sup 194}Po show that the 2{sup +} - 0{sup +} transition energy decreased in energy by 140 keV relative to {sup 196}Po suggesting that this nucleus moved beyond the vibrational limit to more collective motion. An extrapolation of the systematics predicts that the 2{sup +} energy could drop another 140 keV between {sup 194}Po and {sup 192}Po which would indicate the onset of rotational motion. Currently, we have an approved experiment to investigate the decay of yrast isomers in {sup 194}Po which will allow us to (1) confirm our earlier level scheme of {sup 194}Po, and (2) assess the experimental conditions needed for a future study of {sup 192}Po.
49 CFR 195.553 - What special definitions apply to this subpart?
2010-10-01
... SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Corrosion Control § 195.553 What special definitions apply to this subpart? As used in this subpart— Active corrosion means continuing corrosion which.... Buried means covered or in contact with soil. Direct assessment means an integrity assessment method that...
14 CFR Sec. 19-5 - Air transport traffic and capacity elements.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Air transport traffic and capacity elements... AIR CARRIERS Operating Statistics Classifications Sec. 19-5 Air transport traffic and capacity... reported as applicable to specified air transport traffic and capacity elements. (b) These reported items...
Clinical use of gold-195m in evaluation of brain perfusion
International Nuclear Information System (INIS)
Bourgeois, P.; Erbsmann, F.; Hebbelinck, D.; De Maertelaere, P.; Fruehling, J.
1985-01-01
With a Byk-Mallinckrodt /sup 195m/Au generator, brain-perfusion studies in multiple incidences or in tomoscintigraphic mode were visualized in 22 patients. Of these, 17 were referred for investigation of cerebrovascular diseases and four for search for brain metastasis. One patient was normal. All these investigations were completed by a dynamic and static classic tomoscintigraphic study by using /sup 99m/Tc glucoheptonate or DTPA. Data obtained have been compared to other investigation methods, such as X-ray arteriography, Doppler echography, and X-ray computed tomography. Dynamic, as well as morphological, data concerning arteries appeared to be equivalent to those furnished by the /sup 99m/Tc classical studies. The main contribution of these /sup 195m/Au investigations, however, which appeared at the tomoscintigraphic level was the clear delineation of the main vessels involving not only the carotids but also the vertebral and, to a lesser extent, the intracerebral arteries
49 CFR 195.452 - Pipeline integrity management in high consequence areas.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Pipeline integrity management in high consequence... Management § 195.452 Pipeline integrity management in high consequence areas. (a) Which pipelines are covered... that could affect a high consequence area, including any pipeline located in a high consequence area...
Comparison of the AMDAHL 470V/6 and the IBM 370/195 using benchmarks
Energy Technology Data Exchange (ETDEWEB)
Snider, D.R.; Midlock, J.L.; Hinds, A.R.; Engert, D.E.
1976-03-01
Six groups of jobs were run on the IBM 370/195 at the Applied Mathematics Division (AMD) of Argonne National Laboratory using the current production versions of OS/MVT 21.7 and ASP 3.1. The same jobs were then run on an AMDAHL 470V/6 at the AMDAHL manufacturing facilities in Sunnyvale, California, using the identical operating systems. Performances of the two machines are compared. Differences in the configurations were minimized. The memory size on each machine was the same, all software which had an impact on run times was the same, and the I/O configurations were as similar as possible. This allowed the comparison to be based on the relative performance of the two CPU's. As part of the studies preliminary to the acquisition of the IBM 195 in 1972, two of the groups of jobs had been run on a CDC 7600 by CDC personnel in Arden Hills, Minnesota, on an IBM 360/195 by IBM personnel in Poughkeepsie, New York, and on the AMD 360/50/75 production system in June, 1971. 6 figures, 9 tables.
Chen, Lin; Wei, Xinbing; Hou, Yunfeng; Liu, Xiaoqian; Li, Senpeng; Sun, Baozhu; Liu, Xinyong; Liu, Huiqing
2014-01-01
CXC195 showed strongest protective effects among the ligustrazine derivatives in cells and prevented apoptosis induced by H2O2 injury. We recently demonstrated that CXC195 protected against cerebral ischemia/reperfusion (I/R) injury by its antioxidant activity. However, whether the anti-apoptotic action of CXC195 is involved in cerebral I/R injury is unknown. Here, we investigated the role of CXC195 in apoptotic processes induced by cerebral I/R and the possible signaling pathways. Male Wistar rats were submitted to transient middle cerebral artery occlusion for 2h, followed by 24h reperfusion. CXC195 was injected intraperitoneally at 2h and 12h after the onset of ischemia. The number of apoptotic cells was measured by TUNEL assay, apoptosis-related protein cleaved caspase-3, Bcl-2, Bax and the phosphorylation levels of Akt and GSK3β in ischemic penumbra were assayed by western blot. The results showed that administration of CXC195 at the doses of 3mg/kg and 10mg/kg significantly inhibited the apoptosis by decreasing the number of apoptotic cells, decreasing the level of cleaved caspase-3 and Bax, and increasing the level of Bcl-2 in rats subjected to I/R injury. Simultaneously, CXC195 treatment markedly increased the phosphorylation of Akt and GSK3β. Blockade of PI3K activity by wortmannin, dramatically abolished its anti-apoptotic effect and lowered both Akt and GSK3β phosphorylation levels. Our study firstly demonstrated that CXC195 protected against cerebral I/R injury by reducing apoptosis in vivo and PI3K/Akt/GSK3β pathway involved in the anti-apoptotic effect. Crown Copyright © 2014. Published by Elsevier Ltd. All rights reserved.
49 CFR 173.195 - Hydrogen cyanide, anhydrous, stabilized (hydrocyanic acid, aqueous solution).
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Hydrogen cyanide, anhydrous, stabilized... Hazardous Materials Other Than Class 1 and Class 7 § 173.195 Hydrogen cyanide, anhydrous, stabilized (hydrocyanic acid, aqueous solution). (a) Hydrogen cyanide, anhydrous, stabilized, must be packed in...
2010-10-01
... primarily in the business of transporting people. 37.195 Section 37.195 Transportation Office of the... transporting people. This section applies to all purchases or leases of new vehicles by private entities which are not primarily engaged in the business of transporting people, with respect to buses delivered to...
Quantitative cerebral blood flow patterns with the short lived isotope 195m Au
International Nuclear Information System (INIS)
Lindner, P.; Nickel, O.
1984-01-01
A previously reported theory for quantitative cerebral blood flow measurements using intravenously injected nondiffusible radiotracers has been applied on patients after stroke and on volunteers undergoing a mental stimulation exercise. Quantitative measurements of cerebral blood flow patterns (in ml/min/100g) not only in p.a. but also in lateral views of the brain are possible by using of the short-lived (30 sec) isotope Au 195m. The energy spectrum of the eluate of the generator shows two strong photon peaks, one at 68 keV and a second at 262 keV. The 68 keV peak is suitable for perfusion studies in lateral views of the hemispheres, no 'look through' effect is seen. The 262 keV peak is good for studies in p.a. positions. The studies last less than 1 minute and can be repeated after 3 minutes. Parametric images for quantitative regional cerebral blood flow can be generated. The area of occluded vessels in the case of stroke can be made visible. Quantitative activation patterns of cerebral blood flow during mental stimulation can be generated. After optical stimulation a clear increase of blood flow was seen in the visual cortex. The results prove that not only with freely diffusible (like Xenon) but also with nondiffusible indicators like 195m Au it is possible to measure quantitatively cerebral blood flow patterns. Au 195m is very advantageous for quantitative clinical investigations of cerebrovascular disease. (Author)
International Nuclear Information System (INIS)
Mena, I.; Amaral, H.; Adams, R.; Garcia, E.; de Jong, R.
1983-01-01
The purpose of this investigation is to evaluate at LAC Harbor-UCLA Medical Center dead time characteristics of the digital camera Elscint (Apex 415), designed by the manufacturer to improve the count rate performance, its resolution and clinical applications in first pass ventriculography. The Hg-195m/Au-195m generator is evaluated for Hg-195 leakage, dosimetry and clinical usefulness. The high count rate capability of the digital camera is maximally utilized in biplane ventriculography which may become the optimal modality for dynamic cardiovascular nuclear medicine studies. The resolution achieved in this high count rate modality appears perfectly adequate for high quality studies. The imaging and radiation exposure characteristics of the 30.5 sec half life Au 195m are promising of a significant clinical contribution in the field of adult and pediatric cardiology
49 CFR 195.585 - What must I do to correct corroded pipe?
2010-10-01
... TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Corrosion Control § 195.585 What must I do to correct corroded pipe? (a) General corrosion. If you find pipe so generally corroded that the remaining wall thickness...; or (2) Repair the pipe by a method that reliable engineering tests and analyses show can permanently...
Farb, Joshua N; Morrical, Scott W
2009-01-16
Recombinases of the highly conserved RecA/Rad51 family play central roles in homologous recombination and DNA double-stranded break repair. RecA/Rad51 enzymes form presynaptic filaments on single-stranded DNA (ssDNA) that are allosterically activated to catalyze ATPase and DNA strand-exchange reactions. Information is conveyed between DNA- and ATP-binding sites, in part, by a highly conserved glutamine residue (Gln194 in Escherichia coli RecA) that acts as an allosteric switch. The T4 UvsX protein is a divergent RecA ortholog and contains histidine (His195) in place of glutamine at the allosteric switch position. UvsX and RecA catalyze similar strand-exchange reactions, but differ in other properties. UvsX produces both ADP and AMP as products of its ssDNA-dependent ATPase activity--a property that is unique among characterized recombinases. Details of the kinetics of ssDNA-dependent ATP hydrolysis reactions indicate that UvsX-ssDNA presynaptic filaments are asymmetric and contain two classes of ATPase active sites: one that generates ADP, and another that generates AMP. Active-site asymmetry is reduced by mutations at the His195 position, since UvsX-H195Q and UvsX-H195A mutants both exhibit stronger ssDNA-dependent ATPase activity, with lower cooperativity and markedly higher ADP/AMP product ratios, than wild-type UvsX. Reduced active-site asymmetry correlates strongly with reduced ssDNA-binding affinity and DNA strand-exchange activity in both H195Q and H195A mutants. These and other results support a model in which allosteric switch residue His195 controls the formation of an asymmetric conformation of UvsX-ssDNA filaments that is active in DNA strand exchange. The implications of our findings for UvsX recombination functions, and for RecA functions in general, are discussed.
Intracarotid injection of 195mPt-CDDP on rat brain tumors
International Nuclear Information System (INIS)
Ikawa, Eishi; Kamitani, Hideki; Hori, Tomokatsu; Akaboshi, Mitsuhiko.
1995-01-01
We began to try intracarotid injection of 195m Pt-CDDP on transplanted rats of C6 glioma. As a control, normal rats were also treated with intracarotid injection of 195m Pt-CDDP. After injection, the tumor, the normal brain of injected site, the brain of contralateral site, and the blood were sampled for the measurement of the Pt uptake. On normal rats, the ratio of the Pt uptake of the brain to that of the blood was highest in 20 minutes after injection. The ratio of the Pt uptake of the brain of injected site to that of the blood was almost same as that of the brain of contralateral site, so it seemed that the Pt uptake was not so enhanced with intracarotid injection on the normal brain. On the other hand, the ratio of the Pt uptake of the transplanted brain tumor to that of the blood was greatly higher than that of the normal brain. So it seemed that the intracarotid injection of CDDP may have some activities against brain tumors. This study was now started, so we continue this study further more. (author)
Magnetic fluctuations in La1.95Ba0.05CuO4
DEFF Research Database (Denmark)
Hayden, S.M.; Aeppli, G.; Mook, H.
1991-01-01
Neutron-scattering and resistivity experiments on single crystals of La1.95Ba0.05CuO4 are described. On warming to as high as 250 K, the correlation length does not change, and the temperature dependence of the generalized susceptibility chi(Q, omega) is due solely to the temperature dependence o...
Predicting Pt-195 NMR chemical shift using new relativistic all-electron basis set
Paschoal, D.; Fonseca Guerra, C.; de Oliveira, M.A.L.; Ramalho, T.C.; Dos Santos, H.F.
2016-01-01
Predicting NMR properties is a valuable tool to assist the experimentalists in the characterization of molecular structure. For heavy metals, such as Pt-195, only a few computational protocols are available. In the present contribution, all-electron Gaussian basis sets, suitable to calculate the
Chao, Chen; Li, Feng; Tan, Zhiping; Zhang, Weizhi; Yang, Yifeng; Luo, Cheng
2018-01-15
Recent reports have demonstrated that RAF-1 L613V (a mutant of RAF-1) mutant mice show bone deformities similar to Noonan syndrome. It has been suggested that RAF-1 L613V might abnormally activate osteoblast differentiation of MC3T3-E1 cells. To demonstrate that RAF-1 is associated with bone deformity and that RAF-1 L613V dependent bone deformity could be inhibited by microRNA-195 (miR-195), we first investigated the amplifying influence of wild-type RAF-1 (WT) or RAF-1 L613V (L613V) on the viability and differentiation of MC3T3-E1 cells induced by bone morphogenetic protein-2 (BMP-2) via 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) assay, alkaline phosphatase (ALP) and Alizarin Red S (ARS) staining, quantitative real-time polymerase chain reaction (qRT-PCR) and western blot analysis. Subsequently, we investigated the blocking effect and its mechanism of miR-195 for abnormal activation of osteoblast differentiation of MC3T3-E1 cells via targeting RAF-1. RAF-1, especially RAF-1 L613V , abnormally activates osteoblast differentiation of MC3T3-E1 cells induced by BMP-2. Meanwhile, miR-195 could inhibit the cell viability and differentiation of MC3T3-E1 cells. Transfection of miR-195 largely suppressed the L613V-induced viability and osteoblast differentiation of MC3T3-E1 cells and attenuated the accelerative effect of L613V on runt-related transcription factor-2 (Runx2), Osterix (OSX), alkaline phosphatase (ALP), osteocalcin (OCN), and distal-less homeobox 5 (DLX5) osteogenic gene expressions. In addition, miR-195 decreased the expression of RAF-1 mRNA and protein by directly targeting the 3'-untranslated regions (3'-UTR) of RAF-1 mRNA in MC3T3-E1 cells. Our findings indicated that miR-195 inhibited WT and L613V RAF-1 induced hyperactive osteoblast differentiation in MC3T3-E1 cells by targeting RAF-1. miR-195 might be a novel therapeutic agent for the treatment of L613V-induced bone deformity in Noonan syndrome. Copyright © 2017. Published by
Histidine at Position 195 is Essential for Association of Heme-b in Lcp1VH2
Oetermann, Sylvia; Vivod, Robin; Hiessl, Sebastian; Hogeback, Jens; Holtkamp, Michael; Karst, Uwe; Steinbüchel, Alexander
2018-03-01
The latex clearing protein (Lcp) is the key enzyme of polyisoprene degradation in actinomycetes (Yikmis and Steinbüchel in Appl Environ Microbiol 78:4543-4551, https://doi.org/10.1128/AEM.00001-12, 2012). In this study it was shown that Lcp from Gordonia polyisoprenivorans VH2 (Lcp1VH2) harbors a non-covalently bound heme b as cofactor, which was identified by pyridine hemochrome spectra and confirmed by LC/ESI-ToF-MS. It contains iron, most likely in the Fe3+ state. We focused on the characterization of the heme-cofactor, its accessibility with respect to the conformation of Lcp1VH2, and the identification of putative histidine residues involved in the coordination of heme. A change was detectable in UV/Vis-spectra of reduced Lcp1VH2 when imidazole was added, showing that Lcp1VH2 "as isolated" occurs in an open state, directly being accessible for external ligands. In addition, three highly conserved histidines (H195, H200 and H228), presumably acting as ligands coordinating the heme within the heme pocket, were replaced with alanines by site-directed mutagenesis. The effect of these changes on in vivo rubber-mineralization was investigated. The lcp- deletion mutant complemented with the H195A variant of lcp1 VH2 was unable to mineralize poly(cis-1,4-isoprene). In vitro analyses of purified, recombinant Lcp1VH2H195A confirmed the loss of enzyme activity, which could be ascribed to the loss of heme. Hence, H195 is essential for the association of heme-b in the central region of Lcp1VH2.
Histidine at Position 195 is Essential for Association of Heme- b in Lcp1VH2
Oetermann, Sylvia; Vivod, Robin; Hiessl, Sebastian; Hogeback, Jens; Holtkamp, Michael; Karst, Uwe; Steinbüchel, Alexander
2018-05-01
The latex clearing protein (Lcp) is the key enzyme of polyisoprene degradation in actinomycetes (Yikmis and Steinbüchel in Appl Environ Microbiol 78:4543-4551, https://doi.org/10.1128/AEM.00001-12 , 2012). In this study it was shown that Lcp from Gordonia polyisoprenivorans VH2 (Lcp1VH2) harbors a non-covalently bound heme b as cofactor, which was identified by pyridine hemochrome spectra and confirmed by LC/ESI-ToF-MS. It contains iron, most likely in the Fe3+ state. We focused on the characterization of the heme-cofactor, its accessibility with respect to the conformation of Lcp1VH2, and the identification of putative histidine residues involved in the coordination of heme. A change was detectable in UV/Vis-spectra of reduced Lcp1VH2 when imidazole was added, showing that Lcp1VH2 "as isolated" occurs in an open state, directly being accessible for external ligands. In addition, three highly conserved histidines (H195, H200 and H228), presumably acting as ligands coordinating the heme within the heme pocket, were replaced with alanines by site-directed mutagenesis. The effect of these changes on in vivo rubber-mineralization was investigated. The lcp- deletion mutant complemented with the H195A variant of lcp1 VH2 was unable to mineralize poly( cis-1,4-isoprene). In vitro analyses of purified, recombinant Lcp1VH2H195A confirmed the loss of enzyme activity, which could be ascribed to the loss of heme. Hence, H195 is essential for the association of heme- b in the central region of Lcp1VH2.
Radiobiological Effects of Alpha-Particles from Astatine-211: From DNA Damage to Cell Death
Energy Technology Data Exchange (ETDEWEB)
Claesson, Kristina
2011-05-15
In recent years, the use of high linear energy transfer (LET) radiation for radiotherapeutic applications has gained increased interest. Astatine-211 (211At) is an alpha-particle emitting radionuclide, promising for targeted radioimmunotherapy of isolated tumor cells and microscopic clusters. To improve development of safe radiotherapy using 211At it is important to increase our knowledge of the radiobiological effects in cells. During radiotherapy, both tumors and adjacent normal tissue will be irradiated and therefore, it is of importance to understand differences in the radio response between proliferating and resting cells. The aim of this thesis was to investigate effects in fibroblasts with different proliferation status after irradiation with alpha-particles from 211At or X-rays, from inflicted DNA damage, to cellular responses and biological consequences. Throughout this work, irradiation was performed with alpha-particles from 211A or X-rays. The induction and repair of double-strand breaks (DSBs) in human normal fibroblasts were investigated using pulsed-field gel electrophoresis and fragment analysis. The relative biological effectiveness (RBE) of 211At for DSB induction varied between 1.4 and 3.1. A small increase of DSBs was observed in cycling cells compared to stationary cells. The repair kinetics was slower after 211At and more residual damage was found after 24 h. Comparison between cells with different proliferation status showed that the repair was inefficient in cycling cells with more residual damage, regardless of radiation quality. Activation of cell cycle arrests was investigated using immunofluorescent labeling of the checkpoint kinase Chk2 and by measuring cell cycle distributions with flow cytometry analysis. After alpha-particle irradiation, the average number of Chk2-foci was larger and the cells had a more affected cell cycle progression for several weeks compared with X-irradiated cells, indicating a more powerful arrest after 211At
49 CFR 195.589 - What corrosion control information do I have to maintain?
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false What corrosion control information do I have to... SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Corrosion Control § 195.589 What corrosion control... sufficient detail to demonstrate the adequacy of corrosion control measures or that corrosion requiring...
Directory of Open Access Journals (Sweden)
Giacoppo F.
2015-01-01
Full Text Available An excess of strength on the low-energy tail of the giant dipole resonance recently has been observed in the γ-decay from the quasicontinuum of 195,196Pt. The nature of this phenomenon is not yet fully investigated. If this feature is present also in the γ-ray strength of the neutron-rich isotopes, it can affect the neutron-capture reactions involved in the formation of heavy-elements in stellar nucleosynthesis. The experimental level density and γ-ray strength function of 195,196Pt are presented together with preliminary calculations of the corresponding neutron-capture cross sections.
Daily snow depth measurements from 195 stations in the United States
Energy Technology Data Exchange (ETDEWEB)
Allison, L.J. [ed.] [Oak Ridge National Lab., TN (United States). Carbon Dioxide Information Analysis Center; Easterling, D.R.; Jamason, P.; Bowman, D.P.; Hughes, P.Y.; Mason, E.H. [National Oceanic and Atmospheric Administration, Asheville, NC (United States). National Climatic Data Center
1997-02-01
This document describes a database containing daily measurements of snow depth at 195 National Weather Service (NWS) first-order climatological stations in the United States. The data have been assembled and made available by the National Climatic Data Center (NCDC) in Asheville, North Carolina. The 195 stations encompass 388 unique sampling locations in 48 of the 50 states; no observations from Delaware or Hawaii are included in the database. Station selection criteria emphasized the quality and length of station records while seeking to provide a network with good geographic coverage. Snow depth at the 388 locations was measured once per day on ground open to the sky. The daily snow depth is the total depth of the snow on the ground at measurement time. The time period covered by the database is 1893--1992; however, not all station records encompass the complete period. While a station record ideally should contain daily data for at least the seven winter months (January through April and October through December), not all stations have complete records. Each logical record in the snow depth database contains one station`s daily data values for a period of one month, including data source, measurement, and quality flags.
International Nuclear Information System (INIS)
Aksakal, Ozkan; Ucun, Handan
2010-01-01
This study investigated the biosorption of Reactive Red 195 (RR 195), an azo dye, from aqueous solution by using cone biomass of Pinus sylvestris Linneo. To this end, pH, initial dye concentration, biomass dosage and contact time were studied in a batch biosorption system. Maximum pH for efficient RR 195 biosorption was found to be 1.0 and the initial RR 195 concentration increased with decreasing percentage removal. Biosorption capacity increased from 6.69 mg/g at 20 deg. C to 7.38 mg/g at 50 deg. C for 200 mg/L dye concentration. Kinetics of the interactions was tested by pseudo-first-order and pseudo-second-order kinetics, the Elovich equation and intraparticle diffusion mechanism. Pseudo-second-order kinetic model provided a better correlation for the experimental data studied in comparison to the pseudo-first-order kinetic model and intraparticle diffusion mechanism. Moreover, the Elovich equation also showed a good fit to the experimental data. Freundlich and Langmuir adsorption isotherms were used for the mathematical description of the biosorption equilibrium data. The activation energy of biosorption (Ea) was found to be 8.904 kJ/mol by using the Arrhenius equation. Using the thermodynamic equilibrium coefficients obtained at different temperatures, the study also evaluated the thermodynamic constants of biosorption (ΔG o , ΔH o and ΔS). The results indicate that cone biomass can be used as an effective and low-cost biosorbent to remove reactive dyes from aqueous solution.
International Nuclear Information System (INIS)
Yuan, Y.F.; Wu, H.M.; Guo, S.Y.; Wu, J.B.; Yang, J.L.; Wang, X.L.; Tu, J.P.
2008-01-01
The surface-modified spinel LiMn 2 O 4 by doped LiNi 0.05 Mn 1.95 O 4 was prepared by a tartaric acid gel method. Transmission electron microscope (TEM) images indicated that some small particles with 100-200 nm in diameter modified the surface of large particle LiMn 2 O 4 . Energy dispersive spectrometry (EDS) showed that the particles were LiNi 0.05 Mn 1.95 O 4 . Electrochemical properties of LiNi 0.05 Mn 1.95 O 4 -modified spinel LiMn 2 O 4 were intensively investigated by the galvanostatic charge-discharge tests, cyclic voltammetry (CV) and AC impedance measurements. The doped LiNi 0.05 Mn 1.95 O 4 -modified LiMn 2 O 4 cathode delivered the same initial discharge capacity as the unmodified LiMn 2 O 4 , but its cyclic stability was evidently improved, the capacity retention ratio reached 96% after 20 cycles, being higher than 89% of the unmodified LiMn 2 O 4 . Cyclic voltammograms of the LiNi 0.05 Mn 1.95 O 4 -modified LiMn 2 O 4 did not markedly change while the semicircle diameter of AC impedance spectra evidently decreased after 20 cycles, which showed that the surface modification with LiNi 0.05 Mn 1.95 O 4 improved the electrochemical activity and cycling stability of LiMn 2 O 4 .
International Nuclear Information System (INIS)
Koziorowski, J.
1998-01-01
Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211 At and 124 I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[ 211 At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[ 211 At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [ 124 I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[ 124 I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of
Energy Technology Data Exchange (ETDEWEB)
Lee, Patrick K. H. [University of California, Berkeley; Dill, Brian [ORNL; Louie, Tiffany S. [University of California, Berkeley; Shah, Manesh B [ORNL; Verberkmoes, Nathan C [ORNL; Andersen, Gary L. [Lawrence Berkeley National Laboratory (LBNL); Zinder, Stephen H. [Cornell University; Alvarez-Cohen, Lisa [Lawrence Berkeley National Laboratory (LBNL)
2012-01-01
Bacteria of the genus Dehalococcoides play an important role in the reductive dechlorination of chlorinated ethenes. A systems level approach was taken in this study to examine the global transcriptomic and proteomic responses of exponentially growing D. ethenogenes strain 195 to fixed nitrogen limitation (FNL) as dechlorination activity and cell yield both decrease during FNL. As expected, the nitrogen-fixing (nif) genes were differentially up-regulated in the transcriptome and proteome of strain 195 during FNL. Aside from the nif operon, a putative methylglyoxal synthase-encoding gene (DET1576), the product of which is predicted to catalyze the formation of the toxic electrophile methylglyoxal and implicated in the uncoupling of anabolism from catabolism in bacteria, was strongly up-regulated in the transcriptome and could potentially play a role in the observed growth inhibition during FNL. Carbon catabolism genes were generally down regulated in response to FNL and a number of transporters were differentially regulated in response to nitrogen limitation, with some playing apparent roles in nitrogen acquisition while others were associated with general stress responses. A number of genes related to the functions of nucleotide synthesis, replication, transcription, translation, and post-translational modifications were also differentially expressed. One gene coding for a putative reductive dehalogenase (DET1545) and a number coding for oxidoreductases, which have implications in energy generation and redox reactions, were also differentially regulated. Interestingly, most of the genes within the multiple integrated elements were not differentially expressed. Overall, this study elucidates the molecular responses of strain 195 to FNL and identifies differentially expressed genes that are potential biomarkers to evaluate environmental cellular nitrogen status.
Energy Technology Data Exchange (ETDEWEB)
Rozhdestvina, V. I., E-mail: veronika@ascnet.ru; Ivanov, A. V.; Zaremba, M. A. [Far East Division, Russian Academy of Sciences, Institute of Geology and Nature Management (Russian Federation); Antsutkin, O. N.; Forsling, W. [Lulea University of Technology (Sweden)
2008-05-15
Single-crystalline cooperite (PtS) with a nearly stoichiometric composition was characterized in detail by X-ray diffraction, electron-probe X-ray microanalysis, and high-resolution scanning electron microscopy. For the first time it was demonstrated that {sup 195}Pt static and MAS NMR spectroscopy can be used for studying natural platinum minerals. The {sup 195}Pt chemical-shift tensor of cooperite was found to be consistent with the axial symmetry and is characterized by the following principal values: {delta}{sub xx} = -5920 ppm, {delta}{sub yy} = -3734 ppm, {delta}{sub zz} = +4023 ppm, and {delta}{sub iso} = -1850 ppm. According to the ESR data, the samples of cooperite contain copper(II), which is adsorbed on the surface during the layer-by-layer crystal growth and is not involved in the crystal lattice.
International Nuclear Information System (INIS)
Wildgoose, P.; Kisiel, W.; Kazim, A.L.
1990-01-01
Previous studies indicated that human and bovine factor VII exhibit 71% amino acid sequence identity. In the present study, competition binding experiments revealed that the interaction of human factor VII with cell-surface human tissue factor was not inhibited by 100-fold molar excess of bovine factor VII. This finding indicated that bovine and human factor VII are not structurally homologous in the region(s) where human factor VII interacts with human tissue factor. On this premise, the authors synthesized three peptides corresponding to regions of human factor VII that exhibited marked structural dissimilarity to bovine factor VII; these regions of dissimilarity included residues 195-206, 263-274, and 314-326. Peptide 195-206 inhibited the interaction of factor VII with cell-surface tissue factor and the activation of factor X by a complex of factor VIIa and tissue factor half-maximally at concentrations of 1-2 mM. A structurally rearranged form of peptide 195-206 containing an aspartimide residue inhibited these reactions half-maximally at concentrations of 250-300 μM. In contrast, neither peptide 263-274 nor peptide 314-326, at 2 mM concentration, significantly affected either factor VIIa interaction with tissue factor or factor VIIa-mediated activation of factor X. The data provide presumptive evidence that residues 195-206 of human factor VII are involved in the interaction of human factor VII with the extracellular domain of human tissue factor apoprotein
Sathekge, M; Wagener, J; Smith, S V; Soni, N; Marjanovic-Painter, B; Zinn, C; Van de Wiele, C; D'Asseler, Y; Perkins, G; Zeevaart, J R
2013-12-13
195mPt-cisplatin is regarded as a promising imaging agent for optimizing dosage in patients receiving cisplatin chemotherapy. We investigated the whole-body distribution and radiation dosimetry of 195mPt-cisplatin in humans. Whole-body scans were obtained up to 144 h after intravenous injection of 112.4 MBq 195mPt-cisplatin in each of five subjects. Blood samples were taken at various times up to 144 h after injection. Urine was collected up to 114 h after injection for calculation of renal clearance and whole-body clearance. Time/activity curves were generated by fitting the organ-specific geometric mean counts, obtained from regions of interest, on the respective images as a function of the time after injection. OLINDA software package was applied to calculate the absorbed radiation dose for various organs. Most of the activity (32 ± 4%) was excreted in the urine during the first 5 h. The effective clearance half-life derived from extrapolation of the whole-body curve was 40 hours (1.7 days). On average, the highest dose was received by the kidneys (mean dose received 2.68 ± 1.5 mGy/MBq), followed by the spleen (mean dose received 1.6 ± 0.8 mGy/MBq) followed by the liver (mean dose received 1.45 ± 0.38 mGy/MBq). The estimated mean effective dose for the adult subject was 0.185 ± 0.034 mSv/MBq. 195mPt-cisplatin proved a safe radiopharmaceutical with a favourable biodistribution for early and delayed imaging of pathology above the diaphragm. The ED obtained was 0.185 ± 0.034 mSv/MBq. The highest organ dose was received by the kidneys (2.68 ± 1.5 mGy/MBq).
International Nuclear Information System (INIS)
Richardson, R.M.
1979-12-01
A suite of programs for analysing neutron scattering data from time-of-flight spectrometers has been implemented on the Rutherford Laboratory IBM 360/195 computer system. The programs are intended for near inelastic and quasielastic data and operate by convoluting the measured instrumental resolution function with a model scattering function before fitting to the measured sample scattering law. (author)
195Pt and 119Sn Knight shifts of U3Pt3Sn4
International Nuclear Information System (INIS)
Kojima, K.; Takabatake, T.; Harada, A.; Hihara, T.
1995-01-01
The 195 Pt and 119 Sn Knight shifts in U 3 Pt 3 Sn 4 have been measured in the temperature range 4.2-298K. They exhibit Curie-Weiss like behaviors above about 50K and remain constant below about 10K. This suggests that the deviation of χ(T) from the modified Curie-Weiss law is an intrinsic property of U 3 Pt 3 Sn 4 . ((orig.))
International Nuclear Information System (INIS)
Blamey, C.
1977-01-01
In order to assess the problems which might arise from monitoring a comprehensive test ban treaty by seismological methods, an experimental monitoring operation is being conducted. This work has involved the establishment of a database on the Rutherford Laboratory 360/195 system computer. The database can be accessed in the UK over the public telephone network and in the USA via ARPANET. (author)
Oxygen permeation in thin, dense Ce0.9Gd0.1O 1.95- membranes II. experimental determination
DEFF Research Database (Denmark)
Chatzichristodoulou, Christodoulos; Søgaard, Martin; Glasscock, Julie
2011-01-01
Thin (∼30 m), dense Ce0.9Gd0.1O1.95- (CGO10) membranes (5 5 cm2+) supported on a porous NiO/YSZ substrate were fabricated by tape casting, wet powder spraying and lamination. A La 0.58Sr0.4Co0.2Fe0.8O 3-δ/Ce0.9Gd0.1O1.95- (LSCF/CGO10) composite cathode was applied by screen printing. Oxygen...... compartment. The performance of the membrane was also investigated under varying CH 4 and H2O gas mixtures at 1106 K. The oxygen flux increased with decreasing steam to carbon ratio and was found to exceed 10 N mL min-1 cm-2 of O2 for steam to carbon ratios below 4:3. Post-test analysis of the tested membrane...
Studies on UV/NaOCl/TiO2/Sep photocatalysed degradation of Reactive Red 195.
Karaoğlu, M Hamdi; Uğurlu, Mehmet
2010-02-15
The photocatalytic degradation of Reactive Red 195 (RR195) has been investigated in aqueous suspensions by using ultraviolet (UV), sodium hypochlorite (NaOCl) and TiO(2)/Sep nanoparticles together. To get the TiO(2)/Sep nanoparticle, the nanocrystalline TiO(2) anatase phase on sepiolite was obtained using a sufficient thermal treatment by gradually increasing the temperature from 300, 400 and 500 degrees C for 3h. Then, TiO(2)/Sep materials were characterized using different spectral and technical structural analyses with scanning electron microscopy (SEM) and X-ray diffraction (XRD). The influence of pH, catalyst amount, oxidant and initial dye concentration was investigated in all the experiments. Maximum colour and chemical oxygen demand (COD) removal were 99.9% and 78% respectively, at a dye concentration of 250 mg L(-1), NaOCl dosage of 50.37 mM, 0.1 g L(-1) weight of TiO(2)/Sep and pH of 5.45 in 3h. In addition, the pseudo-first order model was applied and r(2) values were noted from 0.92 to 0.99.
Characterization of Ce0.9Gd0.1O1.95 powders synthesized by spray drying
DEFF Research Database (Denmark)
Blennow Tullmar, Peter; Chen, Weiwu; Lundberg, Mats
2009-01-01
Ce0.9Gd0.1O1.95 powders were synthesized by spray drying and successive calcinations. The phase purity, BET surface area, and particle morphology of as-sprayed and calcined powders were characterized. After calcination above 300 °C, the powders were single phase and showed a BET surface area of 68...
Astatine-211 labeling. A study towards automatic production of astatinated antibodies
International Nuclear Information System (INIS)
Emma Aneheim; Per Albertsson; Sture Lindegren; Holger Jensen
2015-01-01
Targeted alpha therapy is especially interesting for therapy of microscopic cancer tumors due to short path length and high linear energy transfer of the alpha particles. One of the most promising nuclides for targeted alpha therapy is 211 At. To facilitate larger clinical studies using 211 At, the current manual synthesis of radiolabeled antibodies would benefit from being transferred into an automated method. In this work, successful modifications of the manual synthesis have been performed in order to adapt it to automation. The automatic synthesis has also been tested using the modified synthesis method. (author)
Directory of Open Access Journals (Sweden)
Tim Crawford
2016-07-01
Full Text Available Biogenesis of the photosystems in oxygenic phototrophs requires co-translational insertion of chlorophyll a. The first committed step of chlorophyll a biosynthesis is the insertion of a Mg2+ ion into the tetrapyrrole intermediate protoporphyrin IX, catalyzed by Mg-chelatase. We have identified a Synechocystis sp. PCC 6803 strain with a spontaneous mutation in chlH that results in a Gly195 to Glu substitution in a conserved region of the catalytic subunit of Mg-chelatase. Mutant strains containing the ChlH Gly195 to Glu mutation were generated using a two-step protocol that introduced the chlH gene into a putative neutral site in the chromosome prior to deletion of the native gene. The Gly195 to Glu mutation resulted in strains with decreased chlorophyll a. Deletion of the PS II assembly factor Ycf48 in a strain carrying the ChlH Gly195 to Glu mutation did not grow photoautotrophically. In addition, the ChlH-G195E:ΔYcf48 strain showed impaired PS II activity and decreased assembly of PS II centers in comparison to a ΔYcf48 strain. We suggest decreased chlorophyll in the ChlH-G195E mutant provides a background to screen for the role of assembly factors that are not essential under optimal growth conditions.
2010-10-01
... electrical transmission tower footings, ground cables, or counterpoise, or in other areas where it is... Corrosion Control § 195.575 Which facilities must I electrically isolate and what inspections, tests, and... other structures as a single unit. (b) You must install one or more insulating devices where electrical...
41 CFR 102-33.195 - Do we need an automated system to account for aircraft costs?
2010-07-01
... for the Cost of Government Aircraft § 102-33.195 Do we need an automated system to account for... automated system to account for aircraft costs by collecting the cost data elements required by the Federal... through FAIRS, but are not required to have an automated system (see §§ 102-33.435 and 102-33.440 for the...
Oxygen permeation in thin, dense Ce0.9Gd0.1O 1.95- membranes I. Model study
DEFF Research Database (Denmark)
Chatzichristodoulou, Christodoulos; Søgaard, Martin; Hendriksen, Peter Vang
2011-01-01
at the feed and permeate side of the membrane, related to the gaseous oxygen reduction and fuel oxidation, respectively, as well as the gas conversion and gas diffusion resistances in the porous support structure at the permeate side. The temperature and oxygen activity dependence of the oxide ionic...... was analyzed by a separation of the various losses. The chemical expansion of Ce 0.9Gd0.1O1.95-δ under operation was estimated from the calculated oxygen activity and nonstoichiometry profiles inside the membrane. © 2011 The Electrochemical Society.......A model of a supported planar Ce0.9Gd0.1O 1.95-δ oxygen membrane in a plug-flow setup was constructed and a sensitivity analysis of its performance under varying operating conditions and membrane parameters was performed. The model takes into account the driving force losses at the catalysts...
$\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams
We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.
Energy Technology Data Exchange (ETDEWEB)
Hilgers, K.
2005-12-15
New production routes for the therapeutically useful radionuclides {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt and {sup 195m}Pt were investigated. Cross section data were measured using the stacked-foil technique and compared with theoretical calculations. A production method for the platinum nuclides was developed. The {sup 141}Pr(p, 2n){sup 140}Nd and {sup nat}Ce({sup 3}He, xn){sup 140}Nd reactions were investigated for production of {sup 140}Nd. Cross section data of nuclear reactions leading to the side products {sup 141}Nd, {sup 139}Nd and {sup 139}Ce could also be achieved. The experimental data were compared with theoretical calculations using the code ALICE-IPPE. A comparison of the calculated thick target yields showed that the {sup 141}Pr(p, 2n){sup 140}Nd reaction gives a higher yield. The {sup 192}Os(p, n){sup 192}Ir reaction was examined in the context of the production of {sup 192}Ir. Cross section data were determined and compared with theoretical calculations using the codes ALICE-IPPE and EMPIRE II. The yield of this reaction was compared with the yield of the reactor production of this nuclide. The reactor production seems to be more suitable because of a higher purity and yield. Cross section data were measured for the {sup 192}Os({alpha}, n){sup 195m}Pt, {sup 192}Os({alpha}, 3n){sup 193m}Pt and {sup 192}Os({sup 3}He, 4n){sup 191}Pt reactions. The activity of {sup 193m}Pt and {sup 195m}Pt was determined by X-ray spectroscopy after a chemical separation procedure. The ALICE-IPPE code was found to be inappropriate to reproduce the experimental values. The calculated yields were compared with the yields of other reactions, especially the reactor production of {sup 195m}Pt. The yield of the {sup 192}Os({alpha}, n){sup 195m}Pt reaction is lower compared to the yield of the reactor production, but offers lower target costs and higher specific activity. A production method for {sup 193m}Pt and {sup 195m}Pt was developed. Batch yields of 0.9 MBq
Directory of Open Access Journals (Sweden)
Geraldo Magela Gomes da Cruz
2008-06-01
Full Text Available Em uma casuística de 24.000 pacientes 923 eram portadores de tumores de intestino grosso (3.8%, 870 dos quais eram tumores colorretais (94,2%, dos quais 490 eram câncer no cólon (53,1% e 380 no reto (41,2% e apenas 53 tumores anais (5,7%. O objetivo deste trabalho é estudar 380 pacientes portadores de câncer retal, analisando, especificamente, os 195 estomas criados nos mesmos, estratificando-os em temporários e definitivos, descrevendo suas modalidades e indicações bem como suas complicações e abordagem cirúrgicas das mesmas. De 380 pacientes portadores de câncer retal 373 foram operados (98,2% e 338 tiveram os tumores removidos (91,8%, tendo sido a retossigmoidectomia abdominal a técnica cirúrgica mais realizada (172 ou 45,3%, das quais, 133 com anastomose manual (35,0% e 39 com anastomose mecânica (10,3%, seguida pela amputação abdominoperineal (135 casos ou 35,5%. Dos 373 pacientes operados foram realizados estomas em 195 (52,3%, 174 dos quais definitivos (46,6% e 21 temporários (5,7%. Destarte, dos 195 estomas realizados, 174 foram definitivos (89,2% e 21 temporários (10,8%. As modalidades de estomas mais realizados foram colostomias terminais (146 casos, 39,1% e colostomias em alça (30 casos, 8,0%. Dos 21 estomas temporários nove foram colostomias em alça (5,2% e 12 foram ileostomias em alça (7,0%. Em 16 dos 21 casos o estoma foi feito como protetor de anastomose em 133 casos de ressecção com anastomose manual (oito colostomias em alça e oito ileostomias em alça; e cinco foram realizados em 39 casos de anastomoses mecânicas, sendo uma colostomia em alça e quatro ileostomias em alça. Os 174 estomas definitivos foram feitos em 135 casos de amputação abdominoperineal, 35 em tumores irressecáveis e quatro em proctocolectomia, tendo sido 146 colostomias terminais (83,9%, quatro ileostomias terminais (2,3%, 21 colostomias em alça (12,1% e três colostomias duplas (1,7%. Ocorreram 14 complicações (7,2% nos 195
Branching ratio for the isoscalar transition 2+, T = 1, 1.95 MeV→0+, T = 1, 0.66 MeV in 22Na
International Nuclear Information System (INIS)
Vermeer, W.J.; Poletti, A.R.
1982-01-01
The branching ratio for the isoscalar transition 2 + , T = 1, 1.95 MeV→0 + , T = 1, 0.66 MeV in 22 Na was measured as (0.29+-0.05)% of the total decays of the 1.95MeV level. This, together with the measured mean-life of this level, gives an E2 strength of (16+-5) Wu, in good agreement with the estimate of 18 Wu obtained from the analogue transitions in 22 Ne and 22 Mg assuming a linear relationship between M(E2) and Tsub(z). Upper limits for some weak decay branches in 19 F were also obtained. (author)
The long-term follow-up of 195 patients with renal failure: a preliminary report.
Griffiths, H J; Zimmerman, R E; Lazarus, M; Lowrie, E; Gottlieb, M N; Phillips, E; Pomerantz, K
1977-03-01
Radiographic and bone mineral (BM) data were collected over a three-year period on 195 patients with chronic renal failure. Most women maintained BM on dyalysis, whereas 44% of the men lost BM (p less than 0.05). Following transplantation, 86% of the patients either maintained or restored BM. After parathyroidectomy, only half of the women and 34% of the men gained BM. Normal radiographs may be associated with low BM values, but there is a correlation between decreasing BM and increasing renal osteodystrophy in women (p less than 0.05).
International Nuclear Information System (INIS)
Palit, Mithun; Arout Chelvane, J.; Basumatary, Himalay; Pandian, S.; Chandrasekaran, V.
2009-01-01
Alloys of Tb 0.3 Dy 0.7 Fe 1.95-x Nb x and Tb 0.3 Dy 0.7 Fe 1.95-x Zr x , with x = 0-0.075, were prepared by conventional melting and casting under vacuum. The magnetostriction improved remarkably with the individual addition of Nb and Zr. It is seen from the microstructural features that Nb addition results in the formation of NbFe 2 as the primary phase while Zr addition results in the depletion of (Tb,Dy)Fe 3 phase owing to the substitution of Zr for rare earths in the main phase
2010-07-01
... transportation service provider (TSP) send to receive payment for a transportation billing? 102-118.195 Section... must a transportation service provider (TSP) send to receive payment for a transportation billing? For... Government Billing Documents Terms and Conditions Governing Acceptance and Use of A Government Bill of Lading...
Radiation-stimulated phase in titanium dihydride TiH1.95
International Nuclear Information System (INIS)
Khidirov, I.; Mukhtarova, N.N.; Baktibaev, K.O.; Getmanskiy, V.V.
2001-01-01
In titanium dihydride TiH 1.95 γ-irradiation has been shown by X-ray and neutron-diffraction methods to stimulate the phase transition FCC→VCT at doses ≥3·10 10 R and irradiation temperature ≅100 d eg C. The space group of the formed phase is D 4h 17 -14/mmm, its lattice parameters a m =0.3161 nm, c m =0.4418 nm are related to parameters of the initial (FCC) phase by relations a m ≅a k /2 1/2 , c m ≅a k . It was established that the phase obtained is metastable, it relaxes at the temperatures ≥37 d eg C and transforms into the stable FCC phase that corresponds to the equilibrium phase diagram of Ti-H system. The temperature of the phase transition increases by influence of γ-quanta, the radiation-stimulated phase differs from thermostimulated one by a larger unit cell and a smaller degree of tetragonal distortion. (author)
Bart, A.; van Thiel, P. P. A. M.; de Vries, H. J. C.; Hodiamont, C. J.; van Gool, T.
2013-01-01
Leishmaniasis is an imported disease in the Netherlands. We report data for the period between 2005 and 2012, on clinical presentation, country where leishmaniasis was acquired, and causative species, for 195 civilian and military patients who had travelled abroad. Most patients were affected by
International Nuclear Information System (INIS)
Huang Xiaobing; Chen Honghui; Zhou Shibiao; Chen Yuandao; Yang Jifeng; Ren Yurong; Wang Haiyan; Qu Meizhen; Pan Zhonglai; Yu Zuolong
2012-01-01
Li 1.95 FeSiO 4 /C and Li 2 FeSiO 4 /C composites were synthesized by a traditional solid-state reaction method and then discussed comparatively through the results of X-ray diffraction (XRD), scanning electron microscopy (SEM), the Brunauer–Emmet–Teller (BET) method, the charge–discharge test and electrochemical impedance spectra measurement, respectively. The results demonstrated that the Li 1.95 FeSiO 4 /C composite could exhibit much better battery performance in terms of the discharge capacity, cycling stability and rate capability in comparison with the Li 2 FeSiO 4 /C composite. At 0.2C and 5C, it delivered a discharge capacity of 142 mAh g −1 and 93 mAh g −1 , respectively, and after 100 cycles at 1C, 95.1% of its initial capacity was retained.
Charge transfer and rapidity gap analysis in p(π+)n interactions at 195 GeV/c
International Nuclear Information System (INIS)
Eisenberg, Y.; Haber, B.; Hochmann, D.; Karshon, U.; Ronat, E.E.; Shapira, A.; Yekutieli, G.
1980-01-01
We present charge transfer probabilities between CM hemispheres in pn and π + n interactions at 195 GeV/c. The relative probabilities for charge exchanges ΔQ > 1 as a function of rapidity gap length, r, are given. Both results are compared with those of π - p interactions at 200 GeV/c. The average of r, viz. , is given as a function of the gap number and of ΔQ for various multiplicities, and the reduced average gap lengths /ysub(max) for pn interactions are compared with data at a lower energy. (orig.)
An Expert System for Managing Storage Space Constraints Aboard United States Naval Vessels
1991-12-01
d. solvents, thinners, primers, cmpounds, varnishes , and lacquers i e. alcohol, acetone, ether, and naphtha; f. greases * nd pastes Except for...suffocation. Malocarbon liquids are compounds of carbon containing any of the halogen elements ( fluorine , chlorine, bromine, iodine, or astatine. (Examples are
International Nuclear Information System (INIS)
Kipper, S.L.; Ashburn, W.L.; Norris, S.L.; Rimkus, D.S.; Dillon, W.A.
1985-01-01
Graded, sequential, rest/exercise, gold-195m, first-pass ventriculography and thallium-201 (Tl-201) single-photon emission computed tomography (SPECT) were performed simultaneously during a single, electrocardiograph-monitored, bicycle stress test in 24 individuals. The technical aspects and logistics involved in performing this combined radionuclide study are stressed in this preliminary report. Fourteen healthy volunteers each had a normal left ventricular ejection fraction and wall-motion response, along with normal T1-201 perfusion and washout, as determined by both visual and quantitative analysis of the tomographic sections. Each of ten patients with coronary artery disease had at least one abnormality of these parameters. The authors suggest that it is technically feasible to evaluate both cardiac function and myocardial perfusion simultaneously by combing Au-195m ventriculography and Tl-201 SPECT imaging into a single, noninvasive, diagnostic package
DEFF Research Database (Denmark)
He, Zeming; Yuan, Hao; Glasscock, Julie
2010-01-01
The present work investigates the processes of densification and grain growth of Ce0.9Gd0.1O1.95-δ (CGO10) during sintering in reducing atmosphere. Sintering variables were experimentally characterized and analyzed using defect chemistry and sintering constitutive laws. Based on the achieved...
Energy Technology Data Exchange (ETDEWEB)
Kellershohn, C; Pellerin, P [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires
1961-07-01
Ca{sup 45} metabolism has been studied as a function of time by autoradiography at -195 deg. C in the new-born rat after sub-epidermal dorsal injected of 20 micro-curies per animal. This study confirms: 1) The existence of a rapidly exchangeable calcium bone fraction; 2) A considerable intestinal excretion of radio-calcium, much greater than the urinary elimination; 3) A gradual transfer of the activity for the long bones of the epiphyseal to the diaphyseal regions during growth, together with secondary modifications during ossification. (author) [French] Le metabolisme du {sup 45}Ca est etudie en fonction du temps par autoradiographie a -195 deg. C, chez le rat nouveau-ne apres injection sous-epidermique dorsale de 20 microcuries par animal. Cette etude confirme: 1) l'existence d'une fraction calcique osseuse rapidement echangeable; 2) une excretion intestinale considerable du radiocalcium, tres superieure a l'elimination urinaire; 3) un transfert progressif de l'activite pour les os longs des regions epiphysaires aux regions diaphysaires au cours de la croissance, ainsi que les remaniements secondaires au cours de l'ossification. (auteur)
STS-33 crewmembers on KSC LC Pad 39B 195 ft level with OV-103 in background
1990-01-01
STS-33 crewmembers, wearing launch and entry suit (LES), take a break from training activities to pose for group portrait in front of Discovery, Orbiter Vehicle (OV) 103, at the 195 ft level elevator entrance at Kennedy Space Center (KSC) Launch Complex (LC) Pad 39B. Left to right are Pilot John E. Blaha, Mission Specialist (MS) Kathryn C. Thornton, MS Manley L. Carter, Jr, Commander Frederick D. Gregory, and MS F. Story Musgrave. Visible in the background is the catwalk to OV-103's side hatch.
Ionic conductivity of Ca and Mg doped NdGdZr1.95Sc0.05O7
International Nuclear Information System (INIS)
Anithakumari, P.; Mandal, B.P.; Grover, V.; Tyagi, A.K.; Mishra, A.K.
2014-01-01
The ionic conductivity of pyrochlore based materials makes them promising candidates for fuel-cell applications where high ionic conductivity and low activation energy are desired. Earlier it has been reported that 5%Sc doped GdNdZr 2 O 7 shows highest ionic conductivity. In this present work, an attempt has been made to further increase the oxygen vacancy concentration by the incorporation of Ca 2+ and Mg 2+ ions at A site of NdGdZr 1.95 Sc 0.05 O 7 (NGZS)
International Nuclear Information System (INIS)
Hoeschele, J.D.; Ferren, L.A.; Roberts, J.A.; Whitfield, L.R.
1983-01-01
The discovery and successful clinical application of the potent anti-tumor compound, cis-Dichlorodiammineplatinum(II), cis-DDP* has stimulated considerable interest in developing effective but less toxic second-generation platinum antitumor drugs. One such candidate drug is cis-Dichloro-trans-dihydroxo-bis-(isopropylamine)platinum(IV), cis-trans-[PtCl 2 (OH) 2 (i-PrNH 2 ) 2 ], (CHIP). An important feature of this Pt(IV) agent is that in addition to exhibiting a generally milder clinical toxicity than cisplatin, the dose-limiting toxicity of CHIP is the more common myelosuppression rather than the less desirable nephrotoxicity. Also, CHIP has been reported recently to be more effective than cisplatin against both alkylating agent sensitive and resistant strains of the Yoshida sarcoms. A microscale synthesis for /sup 195m/Pt-labelled CHIP and the tissue distribution and pharmacokinetic properties of this agent in normal female Fischer 344 rats are reported. A comparison with similar data for /sup 195m/Pt-cis-DDP is included
Charge radii and electromagnetic moments of At-211195
Cubiss, J. G.; Barzakh, A. E.; Seliverstov, M. D.; Andreyev, A. N.; Andel, B.; Antalic, S.; Ascher, P.; Atanasov, D.; Beck, D.; Bieroń, J.; Blaum, K.; Borgmann, Ch.; Breitenfeldt, M.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Derkx, X.; De Witte, H.; Elseviers, J.; Fedorov, D. V.; Fedosseev, V. N.; Fritzsche, S.; Gaffney, L. P.; George, S.; Ghys, L.; Heßberger, F. P.; Huyse, M.; Imai, N.; Kalaninová, Z.; Kisler, D.; Köster, U.; Kowalska, M.; Kreim, S.; Lane, J. F. W.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Marsh, B. A.; Mitsuoka, S.; Molkanov, P. L.; Nagame, Y.; Neidherr, D.; Nishio, K.; Ota, S.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Revill, J. P.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Sandhu, K.; Schweikhard, L.; Sels, S.; Truesdale, V. L.; Van Beveren, C.; Van den Bergh, P.; Wakabayashi, Y.; Van Duppen, P.; Wendt, K. D. A.; Wienholtz, F.; Whitmore, B. W.; Wilson, G. L.; Wolf, R. N.; Zuber, K.
2018-05-01
Hyperfine-structure parameters and isotope shifts of At-211195 have been measured for the first time at CERN-ISOLDE, using the in-source resonance-ionization spectroscopy method. The hyperfine structures of isotopes were recorded using a triad of experimental techniques for monitoring the photo-ion current. The Multi-Reflection Time-of-Flight Mass Spectrometer, in connection with a high-resolution electron multiplier, was used as an ion-counting setup for isotopes that either were affected by strong isobaric contamination or possessed a long half-life; the ISOLDE Faraday cups were used for cases with high-intensity beams; and the Windmill decay station was used for short-lived, predominantly α -decaying nuclei. The electromagnetic moments and changes in the mean-square charge radii of the astatine nuclei have been extracted from the measured hyperfine-structure constants and isotope shifts. This was only made possible by dedicated state-of-the-art large-scale atomic computations of the electronic factors and the specific mass shift of atomic transitions in astatine that are needed for these extractions. By comparison with systematics, it was possible to assess the reliability of the results of these calculations and their ascribed uncertainties. A strong deviation in the ground-state mean-square charge radii of the lightest astatine isotopes, from the trend of the (spherical) lead isotopes, is interpreted as the result of an onset of deformation. This behavior bears a resemblance to the deviation observed in the isotonic polonium isotopes. Cases for shape coexistence have been identified in At,199197, for which a significant difference in the charge radii for ground (9 /2- ) and isomeric (1 /2+ ) states has been observed.
International Nuclear Information System (INIS)
Jong, R.B.J. de
1982-01-01
During initial evaluation studies in animals generators were available which yielded amounts of gold-195m ranging from 10 to 40 millicuries and more. The countrates obtained from the largest size generators were so high that the cameras and especially the data storage and handling equipment could no longer adequately handle these countrates. Therefore generators yielding 20 to 25 mCi were decided upon as most suitable for clinical use. At present generators yielding 20 to 25 mCi are evaluated in clinical patient studies. These generators are not completely free from radioactive mercury appearing in the eluates. Between 10 and 25 microcuries of Hg195m are eluted in a 2 ml elution together with the gold amount. Prior to an initial evaluation in humans, studies in pigs were performed to obtain distribution data for dosimetry calculations. The practical clinical usefulness of these measurements would be in monitoring the effect the treatment of shock. In shock both mechanisms, an increase in mean resident time within the vascular bed of an organ system as well as an increased intravascular to extravascular exchange within one organ may occur. Due to the fact that a radioactive tracer with a halflife in the same range as the time required to reach equilibrium in the distribution of the administered tracer is available should make these measurements feasible. The possibilities are studied in an animal shock model
International Nuclear Information System (INIS)
Fazio, F.; Margonato, A.; Gerundini, P.; Vicedomini, G.; Gilardi, M.C.; Fregoso, A.; Bencivelli, W.; Milanesi, L.; Pozza, G.
1985-01-01
Left ventricular ejection fraction (LVEF) was evaluated by gold-195m first pass ventriculography in 10 diabetic patients with microangiopathy, in 10 diabetics without any complications, and in 10 healthy controls during maximum exercise. No differences among groups were present at rest, but at maximal exercise LVEF was significantly lower in microangiopathic patients than in the other two groups. Also muscle blood flow measured by xenon-133 washout was significantly lower during exercise in microangiopathic subjects. Small-vessel involvement of myocardium and muscle could play a role in the development of cardiovascular abnormalities during exercise in diabetics
First-pass cardioangiography with the new radionuclide gold-195m
International Nuclear Information System (INIS)
Schad, N.; Nickel, O.; Schoen, H.; Le Thi, O.; Bruzzone, F.
1985-01-01
Experiences with 500 injections of gold-195m in 251 patients are reported. By shortening the outlet tubing of the generator, the same average count rate could be obtained for the first day of use as with technetium-99m, i.e., maximum counts during first pass averaged 300,000 counts/sec before background subtraction. But, after dead-time and nonuniformity correction and with 1-in. collimation, over the left ventricle an average of 10,000 total counts were determined at the end-diastolic image after background subtraction. By selecting patients weighing <80 kg, for the second day one could achieve 10,000 counts over the left ventricle at end-diastole. Thus for cardiac studies the generator can be used on two consecutive days. Because of the short half-time of 30 sec, several consecutive injections can be used. Ejection fractions and cardiac indexes correspond to those measured with /sup 99m/Tc. After myocardial infarction (MI) the LAO view permitted differentiating between severe septal and posterior or lateral dysfunction, e.g., in four of 30 MI cases, only the LAO view was diagnostic of a serious posterior or posterolateral functional disorder. Two injections are routinely used in children. Functional analysis occurs on different functional images such as regional ejection fractions, ejection rates, and so-called systolic mean transit times
Workshop on selected aspects of radiochemistry
International Nuclear Information System (INIS)
1991-11-01
The aspects chosen for the workshop are: isotope preparation, separation methods; radiochemical methods and analyses; environmental protection and radiochemistry; the chemistry of the fifth halogen, astatine. From the 28 contributions presented at the workshop, 24 are of relevance in the INIS and EDB scope and are separately retrievable from the database. (BBR) [de
Depairing current density of Ba0.5K0.5Fe1.95Co0.05As2 microbridges with nanoscale thickness
International Nuclear Information System (INIS)
Li, Jun; Yuan, Jie; Ge, Jun-Yi; Ji, Min; Feng, Hai-Luke; Yuan, Ya-Hua; Hatano, Takeshi; Vanacken, Johan; Yamaura, Kazunari; Wang, Hua-Bing
2014-01-01
Highlights: • The critical current density of Ba 0.5 K 0.5 Fe 1.95 Co 0.05 As 2 microbridges is 7.9 MA/cm 2 at 21 K. • The critical current is in consistence with the Ginzburg–Landau depairing limit. • The depairing current density is less than that of impurity-free crystal. - Abstract: We investigated the depairing current density of Ba 0.5 K 0.5 Fe 1.95 Co 0.05 As 2 microbridges with width of 2 μm and thickness of 150 nm. The current vs. voltage characteristics of the microbridges show a Josephson-like behavior with the obvious hysteresis. The critical current density was observed as J c = 7.9 MA/cm 2 at temperature 21 K, which is consistent with the Ginzburg–Landau depairing limit. However, the depairing current density is less than that of impurity-free crystal, although the Co ions provide additional pinning centers within the superconducting Fe 2 As 2 layers. The Co impurity also enhances the anisotropic factor of the critical current density by 1.3 (1 T) or 1.7 (3 T)
Nutz, Alexis; Schuster, Mathieu; Boës, Xavier; Rubino, Jean-Loup
2017-01-01
Lakes act as major archives for continental paleoenvironments, particularly when the evolution of lake levels over time serves as a guide for understanding regional paleohydrology and paleoclimate. In this paper, two sections from the Nachukui Formation (Turkana Depression, East African Rift System) provide a complete record of lake level variability and then paleohydrology for Lake Turkana between 1.95 and 1.72 Ma. This period corresponds to a key time during which important human evolutionary and technological innovations have occurred in East Africa and in the Turkana area. Based on sedimentary facies and sequence analyses on coastal deposits, one long-term regressive-transgressive cycle is identified between 1.95 and 1.72 Ma. Superimposed on this trend, five higher-frequency cycles of lake level change are identified between 1.87 and 1.76 Ma. Origins of these periodicities are attributed to orbital forcings. The extents of bathymetry change and shoreline migration during these periods are explored, suggesting that the period between 1.87 and 1.76 Ma was relatively dry and that climate experienced a relatively low variability. This finding differs strongly from most of the previous paleoenvironmental investigations in the region that argue high climate variability during a relatively wet period. This work emphasizes the importance of using sequence stratigraphy for analyzing lacustrine deposits.
2012-04-01
fermented yeast , pure hydrogen, or endogenous biomass decay). When similarly respiring (~120 ?eeq PCE/(L-hr)) batch and PSS cultures were contrasted, the...REPORT Insights gained from the “Dehalococcoides ethenogenes” strain 195?s transcriptome responding to a wide range of respiration rates and substrate...types. 14. ABSTRACT 16. SECURITY CLASSIFICATION OF: Bacteria of the group “Dehalococcoides” display the ability to respire recalcitrant chlorinated
Energy Technology Data Exchange (ETDEWEB)
Jaszczak, R.J.
1995-12-01
Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.
International Nuclear Information System (INIS)
Jaszczak, R.J.
1995-12-01
Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons
New possibilities for quantitative measurements of regional cerebral blood flow with gold-195m
International Nuclear Information System (INIS)
Lindner, P.; Nickel, O.
1985-01-01
A previously reported theory for quantitative cerebral blood flow measurement for nondiffusible radiotracers has been applied to patients after stroke and to volunteers undergoing a mental stimulation exercise. The energy spectrum of gold-195m shows two strong photon peaks, one at an energy level of 68 keV and a second at an energy-level of 262 keV. The low energy peak is suitable for perfusion studies in lateral views of the hemispheres; no look-through effect is seen. The high energy level is good for studies in posterior-anterior positions. Parametric images for quantitative regional cerebral blood flow can be generated. The area of occluded vessels in the case of stroke can be detected. Quantitative activation patterns of cerebral blood flow during mental stimulation can be generated. The results prove that, not only with freely diffusible indicators like xenon but also with nondiffusible indicators, it is possible to measure quantitatively cerebral blood flow patterns
DEFF Research Database (Denmark)
Ni, De Wei; Schmidt, Cristine Grings; Teocoli, Francesca
2013-01-01
The sintering behavior of porous Ce0.9Gd0.1O1.95(CGO10) tape cast layers was systematically investigated to establish fundamental kinetic parameters associated to densification and grain growth. Densification and grain growth were characterized by a set of different methods to determine the domin...... and grain boundary mobility in the porous body was estimated around 10−18–10−16m3N−1s−1 at the investigated temperature range.© 2013 Elsevier Ltd. All rights reserved.......The sintering behavior of porous Ce0.9Gd0.1O1.95(CGO10) tape cast layers was systematically investigated to establish fundamental kinetic parameters associated to densification and grain growth. Densification and grain growth were characterized by a set of different methods to determine...... the dominant sintering mechanisms and kinetics, both in isothermal and at constant heating rate (iso-rate) conditions. Densification of porous CGO10 tape is thermally activated with typical activation energy which was estimated around 440–470 kJ mol−1. Grain growth showed similar thermal activation energy...
International Nuclear Information System (INIS)
Singh, Anar; Schefer, Jürg; Frontzek, Matthias; Sura, Ravi; Conder, Kazimierz; Sibille, Romain F.; Ceretti, Monica; Paulus, Werner
2016-01-01
The existing controversy about the symmetry of the crystal structure of the ground state of the critical doped La_1_._9_5Sr_0_._0_5CuO_4 has been resolved by analyzing the single crystal neutron diffraction data collected between 5 and 730 K. We observed small but significant intensities for “forbidden” reflections given by extinction rules of the orthorhombic Bmab space group at low temperatures. A careful investigation of neutron diffraction data reveals that the crystal structure of La_1_._9_5Sr_0_._0_5CuO_4 at 5 K is monoclinic with B2/m (2/m 1 1) space group. The monoclinic structure emerges from the orthorhombic structure in a continuous way; however, the structure is stable below ∼120 K which agrees with other observed phenomena. Our results on symmetry changes are crucial for the interpretation of physical properties also in other high temperature superconductors with similar structures.
The Installation Restoration Program Toxicology Guide. Volume 2
1987-05-01
Periodic Table: fluorine , chlorine, bromine, iodine, and astatine. Fluorine is the most active of all chemical elements. 5/87 LIST OF ABBREVIATIONS...fire- retardant varnishes and as an aminizing agent for cotton fabric (901). 37.2 ENVIRONMENTAL FATE A1D EXPOSURE PATHWAYS 37.2.1 Transport in Soil...subject to packaging and labeling regulations. Directive on Paints, Varnishes . Printing Inks. Adhesives and Similar Product; (1334) Pentachlorophenol
DEFF Research Database (Denmark)
Barber, Ryan M; Fullman, Nancy; Sorensen, Reed J D
2017-01-01
and lowest observed HAQ Index was larger in 2015 than in 1990, ranging from 28·6 to 94·6. Of 195 geographies, 167 had statistically significant increases in HAQ Index levels since 1990, with South Korea, Turkey, Peru, China, and the Maldives recording among the largest gains by 2015. Performance on the HAQ...... Index and individual causes showed distinct patterns by region and level of development, yet substantial heterogeneities emerged for several causes, including cancers in highest-SDI countries; chronic kidney disease, diabetes, diarrhoeal diseases, and lower respiratory infections among middle...
Structure of the central RNA recognition motif of human TIA-1 at 1.95 A resolution
International Nuclear Information System (INIS)
Kumar, Amit O.; Swenson, Matthew C.; Benning, Matthew M.; Kielkopf, Clara L.
2008-01-01
T-cell-restricted intracellular antigen-1 (TIA-1) regulates alternative pre-mRNA splicing in the nucleus, and mRNA translation in the cytoplasm, by recognizing uridine-rich sequences of RNAs. As a step towards understanding RNA recognition by this regulatory factor, the X-ray structure of the central RNA recognition motif (RRM2) of human TIA-1 is presented at 1.95 A resolution. Comparison with structurally homologous RRM-RNA complexes identifies residues at the RNA interfaces that are conserved in TIA-1-RRM2. The versatile capability of RNP motifs to interact with either proteins or RNA is reinforced by symmetry-related protein-protein interactions mediated by the RNP motifs of TIA-1-RRM2. Importantly, the TIA-1-RRM2 structure reveals the locations of mutations responsible for inhibiting nuclear import. In contrast with previous assumptions, the mutated residues are buried within the hydrophobic interior of the domain, where they would be likely to destabilize the RRM fold rather than directly inhibit RNA binding
DEFF Research Database (Denmark)
Jadhav, L. D.; Pawar, S. H.; Chourashiya, M. G.
2007-01-01
Gadolinium doped ceria oxide is one of the promising materials as an electrolyte for IT-SOFCs. Ce0.9Gd0.1O1.95 (GDC10) powder was prepared by solid state reaction and sintered at 1473 K, 1573 K, 1673 K and 1773 K All samples were studied using X-ray diffraction, scanning electron micrograph and d...
Low toxicity binder systems for tape cast Ce0.9Gd0.1O1.95 laminates
DEFF Research Database (Denmark)
Klemensø, Trine; Menon, Mohan; Ramousse, Severine
2010-01-01
Conventional binder systems for tape casting contain toxic phthalate plasticizers and butanone (MEK) as part of the solvent. The effects of exchanging the phthalate with a non-toxic alternative, and butanone with ethanol, were studied on laminates of high-green density CGO (Ce0.9Gd0.1O1.95) tapes....... Samples were prepared with a binder system containing DBP (dibutyl phthalate) plasticizer and MEK solvent, and with a binder system based on a non-toxic non-phthalate plasticizer and ethanol. In both systems, the weight ratio of plasticizer to the PVB (polyvinyl butyral) binder was varied between 0.......4 and 0.7. Substitution to the less toxic binder system had no adverse impacts on the microstructure. In fact, denser packing and improved homogeneity were observed with the non-phthalate-based system at ratio 0.5 indicating improved dispersion in this system. The denser packing also coincided...
Kautkar, Pranay R.; Acharya, Smita A.
2018-05-01
xDy0.45Ba0.05Sr0.5Co0.8Fe0.2O3-δ - xCe0.85Gd0.15O1.95 (x = 50 %) composite cathode supported on Ce0.85Gd0.15O1.95 (GDC15) electrolyte are studied for applications in IT-SOFCs. Results attribute that Dy0.45Ba0.05Sr0.5Co0.8Fe0.2O3-δ material is chemically compatible with Ce0.85Gd0.15O1.95 (GDC15). Rietveld refined X-ray diffraction patterns notify orthorhombic (space group:Pbnm) symmetry for Dy0.45 Ba0.05Sr0.5Co0.8Fe0.2O3-δ and fluorite type structure (space group: Fm-3m) symmetry for GDC15. The polarization resistance (Rp) of composite cathode reduces to the minimum value of 1.35 Ω cm2 at 650 °C in air. Area specific resistance (ASR) of composite cathode has found 0.67 Ω.cm2 at 650°C respectively. Result shows that the surface diffusion of the dissociative adsorbed oxygen at electrode/electrolyte interface on the composite cathode.
International Nuclear Information System (INIS)
Druba, V.V.; Druba, T.A.; Reznik, V.R.
1989-01-01
Determination of time dependence of phase difference of residual voltage on motor windings of the main circulation pumps (MCP) and voltage of power supply section under MCP self-starting under conditions of short-time breaks in electric power supply is one of the main problems to which reliability and safety of NPP operation is related. A method to measure this dependence in real conditions in case of MCP free run-out and run-out in generating mode is suggested. The method considered is used for tests of the Kalinin NPP-2 MCP-195M self-starting. Analysis of run-out curves in the case of a break in MCP power supply for 1.8 s shows that the most favourable conditions for MCP self-starting are 0.63±0.03 s after de-energizing. 2 refs.; 3 figs.; 1 tab
DEFF Research Database (Denmark)
Ni, De Wei; Esposito, Vincenzo; Foghmoes, Søren Preben Vagn
2014-01-01
process at the initial sintering stage at T constitutive laws indicate......The sintering behavior of Ce0.9Gd0.1O1.95(CGO) tape cast layers with different porosity was investigated by an extensive characterization of densification, microstructural evolution, and applying the constitutive laws of sintering. The densification of CGO tapes associates with grain coarsening...
New possibilities for quantitative measurements of regional cerebral blood flow with Au-195 m
International Nuclear Information System (INIS)
Lindner, P.; Nickel, O.
1984-01-01
A previously reported theory for quantitative cerebral blood flow measurement for nondiffusible radiotracers has been applied on patients after stroke and an volunteers undergoing a mental stimulation exercise. Quantitative measurements of cerebral blood flow patterns not only in p-a. but also in lateral views of the brain are possible by the use of the recently developed generator for the short lived (30 sec) isotope Au-195 m. The energy spectrum of the eluate of the generator shows two strong photon peaks, one at an energy level of 68 KeV and a second at an energy-level of 262 KeV. The low energy peak is suitable for perfusion studies in lateral views of the hemispheres, no ''look through'' effect is seen. The high energy level is good for studies in p-a-positions. The studies last less than 1 minute and can be repeated after 3 minutes. Parametric images for quantitative regional cerebral blood flow can be generated. The area of occluded vessels in the case of stroke can be detected. Quantitative activation patterns of cerebral blood flow during mental stimulation can be generated. The results prove that not only with freely diffusible indicators like Xenon but also with nondiffusible indicators it is possible to measure quantitatively cerebral blood flow patterns. (orig.)
Production of slow protons in the inclusive reactions p(π+)+n→psub(slow)+x at 195 GeV/c
International Nuclear Information System (INIS)
Eisenberg, Y.; Haber, D.; Braun, H.
1977-11-01
The inclusive reactions pn → psub(s)=x and π + →psub(s)+x at incident momentum of 195 GeV/c have been studied in an exposure of the Fermilab 30-in. deuterium filled bubble chamber to a mixed (π + ,p) beam. Analysing the t and M 2 dependence of our data within the framework of triple Regge models it is concluded that pion exchange yields a dominating contribution. Comparing our data with the pp results it is concluded that isoscalar Regge exchange (ω) is much larger than isovector (rho) Regge exchange. We observe significant leading π - emission from the recoiling mass x, comparable to that observed in on-mass shell π - p→π - experiments. This verifies our conclusions about pion exchange dominance in the above reactions. (author)
Dynamic changes in left ventricular function during cold pressor stimulation assessed with gold-195m
International Nuclear Information System (INIS)
Dymond, D.S.; Caplin, J.; Flatman, W.
1985-01-01
The temporal changes in left ventricular function induced by cold pressor stimulation were assessed in 12 normal controls and 12 patients with coronary artery disease (CAD) by rapid, sequential first-pass nuclear angiography with gold-195m. Imaging was performed at rest, after 1, 2.5, and 4 min of cold pressor and after 2 min of recovery. After 1 min, LVEF (left ventricular ejection fraction) fell significantly in normals and in patients but only in the coronary patients was a significant fall maintained at 2.5 and 4 min. The number of new abnormalities on the regional ejection fraction images for normals and those with CAD, respectively, was 12 and 19 at 1 min, 1 and 21 at 2.5 min, 2 and 13 at 4 min, and 0 and 8 during recovery. The authors conclude that (1) cold pressor-induced depression of left ventricular function is transient in normals but often prolonged in patients with CAD and (2) the temporal dissociation between rise in blood pressure and fall in LVEF suggests factors other than afterload changes may be involved in depression of cardiac function
Early hominin diet included diverse terrestrial and aquatic animals 1.95 Ma in East Turkana, Kenya.
Braun, David R; Harris, John W K; Levin, Naomi E; McCoy, Jack T; Herries, Andy I R; Bamford, Marion K; Bishop, Laura C; Richmond, Brian G; Kibunjia, Mzalendo
2010-06-01
The manufacture of stone tools and their use to access animal tissues by Pliocene hominins marks the origin of a key adaptation in human evolutionary history. Here we report an in situ archaeological assemblage from the Koobi Fora Formation in northern Kenya that provides a unique combination of faunal remains, some with direct evidence of butchery, and Oldowan artifacts, which are well dated to 1.95 Ma. This site provides the oldest in situ evidence that hominins, predating Homo erectus, enjoyed access to carcasses of terrestrial and aquatic animals that they butchered in a well-watered habitat. It also provides the earliest definitive evidence of the incorporation into the hominin diet of various aquatic animals including turtles, crocodiles, and fish, which are rich sources of specific nutrients needed in human brain growth. The evidence here shows that these critical brain-growth compounds were part of the diets of hominins before the appearance of Homo ergaster/erectus and could have played an important role in the evolution of larger brains in the early history of our lineage.
Bikbov, Boris; Perico, Norberto; Remuzzi, Giuseppe
2018-05-23
Chronic kidney disease (CKD) imposes a substantial burden on health care systems. There are some especially vulnerable groups with a high CKD burden, one of which is women. We performed an analysis of gender disparities in the prevalence of all CKD stages and renal replacement therapy (defined as impaired kidney function [IKF]) in 195 countries. We used estimates produced by the Global Burden of Disease (GBD) Study 2016 revision using a Bayesian-regression analytic tool, DisMoD-MR 2.1. Data on gross domestic product based on purchasing power parity per capita (GDP PPP) was obtained via the World Bank International Comparison Program database. To estimate gender disparities, we calculated the male:female all-age prevalence rate ratio for each IKF condition. In 2016, the global number of individuals with IKF reached 752.7 million, including 417.0 million females and 335.7 million males. The most prevalent form of IKF in both groups was albuminuria with preserved glomerular filtration rate. Geospatial analysis shows a very heterogeneous distribution of the male:female ratio for all IKF conditions, with the most prominent contrast found in kidney transplant patients. The median male:female ratio varies substantially according to GDP PPP quintiles; however, countries with different economic states could have similar male:female ratios. A strong correlation of GDP PPP with dialysis-to-transplant ratio was found. The GBD study highlights the prominent gender disparities in CKD prevalence among 195 countries. The nature of these disparities, however, is complex and must be interpreted cautiously taking into account all possible circumstances. © 2018 S. Karger AG, Basel.
A simple method for labelling proteins with 211At via diazotized aromatic diamine
International Nuclear Information System (INIS)
Wunderlich, G.; Franke, W.-G.; Fischer, S.; Dreyer, R.
1987-01-01
A simple and rapid method for labelling proteins with 211 At by means of a 1,4-diaminobenzene link is described. This link is transformed into the diazonium salt and subsequently reactions of both 211 At and proteins with the diazonium salt take place simultaneously. For possibly high yields of astatized protein an appropriate temperature of 273 K was found. The results demonstrate the difference between the reaction mechanisms of iodine and astatine with proteins. (author)
International Nuclear Information System (INIS)
Thomas, P.; Huebschmann, W.; Schuettelkopf, H.; Vogt, S.
1983-03-01
Diffusion experiments have been carried out at the Karlsruhe Nuclear Research Center in order to investigate the atmospheric diffusion of pollutants and to determine specifically the influence on atmospheric diffusion of topographic conditions specific to the site. For this purpose, halogenated hydrocarbons are emitted at 160 m and 195 m height, their local concentration distribution is measured at ground level downwind of the source. Part 1 of the report describes the diffusion experiments performed and presents the detailed data of measurements. These include the coordinates of the sampling positions, the measured concentrations and the relevant meteorological data recorded during the experiments. The stability classes prevailing during the experiments are derived from these data and are indicated. (orig.) [de
Anisotropic perpendicular axis magnetostriction in twinned TbxDy1-xFe1.95
International Nuclear Information System (INIS)
Teter, J.P.; Wun-Fogle, M.; Clark, A.E.; Mahoney, K.
1990-01-01
The longitudinal magnetostriction (Δl/l) for twinned Tb x Dy 1-x Fe 1.95 material, prepared by the free-standing float-zone method, has been previously measured and found to be very large (2000x10 -6 ) at room temperature. The magnetostrictions for the [111] and [1 bar 10] crystallographic axes perpendicular to the applied stress and magnetic-field [11 bar 2] direction are presented as functions of temperature, applied stress, and applied magnetic field. The temperature range is ±60 degree C centered about the anisotropy compensation temperature of Terfenol-D (+10 degree C). The stress ranges from 2 to 32 MPa and the magnetic field to ±2000 Oe. The temperature dependence of the perpendicular axes magnetostriction is similar to that of the conventional magnetostriction measured parallel to the [11 bar 2] growth axis. Relative values for the saturation magnetostriction exhibit a large anisotropy in the perpendicular direction, ranging from -117% for the [111] to +19% for the [1 bar 10] direction. This ratio stays constant as a function of temperature above the compensation temperature for a given prestress above 8 MPa. The largest absolute value of magnetostriction (2260x10 -6 ) occurs in the [111] direction at 10 degree C at a prestress pressure of 12 MPa. Above this temperature the magnetostriction falls at a rate of -8.5x10 -6 /degree C. The volume magnetostriction is shown to be small and highly sample dependent. All data is consistent with the parent-twin magnetization model and also the magnetostriction values along nonprincipal axes
International Nuclear Information System (INIS)
Secchiaroli, M.; Marassi, R.; Wohlfahrt-Mehrens, M.; Dsoke, S.
2016-01-01
Highlights: • Bi-material electrode composed by activated carbon and Li 3 V 1.95 Ni 0.05 (PO 4 ) 3 /C is proposed. • It is studied as high energy/power positive and negative electrodes, between 3.0–4.3 and 3.0–1.5 V vs. Li/Li + . • This electrode shows high specific capacity and capacity retention up to 26.6 A g −1 . • Excellent cycle stability is shown over 2000 cycles at 26.6 A g −1 . - Abstract: Exceptionally high specific capacities at ultrahigh charge/discharge currents have been obtained with a bi-material electrode prepared using Li 3 V 1.95 Ni 0.05 (PO 4 ) 3 /C (LVNP/C) and activated carbon (AC) as coexisting active materials. Thanks to the amphoteric properties of LVNP/C, this electrode designated as LVNP/C-AC, has been evaluated both as positive and negative electrode in 1 M LiPF 6 in EC:DMC (1:1). At high specific currents (26.6 A g −1 ), the bi-material electrode delivers specific capacities as high as 61 and 24 mAh g −1 , between 3.0–4.3 V and 3.0–1.5 V vs Li/Li + , respectively. By contrast, the corresponding values for LVNP/C are 49 and 18 mAh g −1 . In both potential windows, the bi-material electrode shows an excellent cycling stability over 2000 cycles at 26.6 A g −1 , with capacity retention of 95 and 89%, between 3.0–4.3 and 3.0–1.5 V vs Li/Li + , respectively. The synergic effect of the activated carbon on the electrochemical performances of Li 3 V 1.95 Ni 0.05 (PO 4 ) 3 /C is investigated by comparing the cyclic voltammetry, electrochemical impedance spectroscopy, electronic conductivity, galvanostatic cycling, and scanning electron microscopy of the bi-material electrode with the ones of LVNP/C. This study highlights the huge potentialities of this bi-material electrode for the development of high energy and high power Li-ion hybrid supercapacitors.
International Nuclear Information System (INIS)
Kolchina, L.M.; Lyskov, N.V.; Petukhov, D.I.; Mazo, G.N.
2014-01-01
Highlights: • PCO–GDC composites are studied as a cathode for SOFCs. • The rate-determined step of the overall electrode process vs. temperature was defined. • PCO–GDC33 composite gave the lowest area surface resistance of 0.41 Ω cm 2 at 700 °C. • PCO–GDC33 is preferred to use as a cathode material for IT-SOFCs. - Abstract: Pr 2 CuO 4 –Ce 0.9 Gd 0.1 O 1.95 (PCO–GDC) composites screen printed on Ce 0.9 Gd 0.1 O 1.95 (GDC) electrolyte were considered as a cathode material for intermediate temperature solid oxide fuel cells (IT-SOFCs). Phase composition, microstructure and electrochemical properties were investigated by X-ray powder diffraction (XRD), scanning electron microscopy and AC impedance spectroscopy, respectively. The oxygen reduction on porous PCO–GDC electrode applied on CGO electrolyte was studied in a symmetrical cell configuration by AC impedance spectroscopy at OCV conditions at 670–730 °C and p O 2 =10 -2 -0.21atm. The charge transfer process and the dissociation of adsorbed molecular oxygen were found to be rate-determining steps of the oxygen reduction reaction. Results reveal that both GDC addition and electrode morphology have strong influence on area specific resistance (ASR) of the electrode/electrolyte interface. The lowest ASR value of 0.41 Ω cm 2 was achieved for the composition containing 33 wt.% GDC at 700 °S in air. The data obtained allow to consider the PCO–GDC33 composite as a promising cathode material for IT-SOFCs
The First Outbreak Caused by Acinetobacter baumannii ST208 and ST195 in China
Directory of Open Access Journals (Sweden)
Junyan Qu
2016-01-01
Full Text Available This study aimed to analyze the clinical characteristics of patients and molecular mechanisms of the first outbreak mainly caused by sequence types (STs 208 multidrug resistant (MDR Acinetobacter baumannii in China. A total of 10 clinical samples were collected from 5 patients who were involved in the outbreak. Bacterial identification and antibiotic sensitivity tests were performed by the VITEK-2 COMPACT automated system. MICs of tigecycline for clinical isolates were determined using broth microdilution. The clonal relatedness of A. baumannii clinical isolates in our local settings was determinated by pulsed-field gel electrophoresis (PFGE and multilocus sequence typing (MLST. A total of 7 A. baumannii strains were isolated and all were MDR strains; two of them were carbapenem-nonsusceptible strains. blaOXA-23 was the only acquired carbapenemase gene in the isolates. The isolates belonged to a single clonal pulsotype determined by PFGE and two sequences types (STs determined by MLST. The isolates belonged to the globally disseminated clonal complex 92, among which ST195 and ST208 were the most common sequence types (71.43% and 28.57%. The outbreak was successfully controlled by stringent infection control measures, especially improving the hand hygiene compliance and enhancing antimicrobial stewardship. In conclusion, this is the first description of an outbreak caused mainly by A. baumannii of ST208 in China. Infection control measures should be strengthened when infection outbreaks in hospital.
Synthesis and characterization of Gd0.1Ce0.9O1.95 thin films by spray pyrolysis technique
DEFF Research Database (Denmark)
Chourashiya, M. G.; Pawar, S. H.; Jadhav, L. D.
2008-01-01
The Gd doped ceria (CGO) in thin layers is of great interest for low temperature operation. In the present investigation, we report on the use of spray pyrolysis technique for the synthesis of CGO thin films. The process parameters were optimized for synthesizing Gd0.1Ce0.9O1.95 films. Films were...... characterized by XRD, EDS, SEM, and AFM and are observed to be phase pure and dense with surface roughness of the order of ∼5 nm. The d.c. conductivity was also measured and is observed to be ∼0.5 S/cm at 623 K....
Energy Technology Data Exchange (ETDEWEB)
Martinez, Juan Bonifacio; Urena Nunez, Fernando [Instituto Nacional de Investigaciones Nucleares, Ocoyoacac, Estado de Mexico (Mexico)]. E-mail: juan.bonifacio@inin.gob.mx
2009-09-15
This work presents hydrogen absorption in quaternary alloy Mg1.95Ti0.05Ni0.95Cu0.05 obtained by the mechanical alloying method, followed by thermal treatment in ultra-high pure argon atmosphere. The composition of the phases, microstructure and morphology of ground powders and with thermal treatment were characterized by DRX, SEM/EDS and TEM. After 20 hours of mechanical grinding and recooked at 300 degrees Celsius/1h in argon atmosphere, the quaternary alloy has a Mg{sub 2}Ni crystalline hexagonal structure with a crystallite size under 10 nm. The absorption measurements were performed under a pressure of 0.2 to 1.2 MPa at a temperature of 200 degrees Celsius in a micro-reactor. The quantification of absorption-desorption of hydrogen in the intermetallic was conducted in a TGA-DSC simultaneous calorimeter. Metallic hydride-dehydride powder was characterized with SEM and XRD. [Spanish] En este trabajo se presenta la absorcion de hidrogeno en la aleacion cuaternaria Mg1.95Ti0.05Ni0.95Cu0.05 obtenida por el metodo de aleado mecanico, seguida de tratamiento termico en atmosfera de argon de ultra alta pureza. La composicion de las fases, microestructura y morfologia de los polvos molidos y con tratamiento termico fue caracterizada por DRX, SEM/EDS y TEM. Despues de 20 h de molienda mecanica con recocido a 300 grados Celsios/1h en atmosfera de argon, la aleacion cuaternaria tiene una estructura cristalina hexagonal Mg{sub 2}Ni con tamano de cristalito menor a 10 nm. Las mediciones de absorcion fueron realizadas bajo una presion de 0.2 a 1.2 MPa a una temperatura de 200 grados Celsios en un micro-reactor. La cuantificacion de absorcion-desorcion de hidrogeno en el intermetalico se realizo en un calorimetro simultaneo TGA-DSC. Se determino que la cantidad maxima absorbida de hidrogeno en la aleacion cuaternaria fue de 3.24% en peso cuando la presion fue de 0.8 MPa a dicha temperatura. Polvos metalicos hidrurados-deshidrurados se caracterizaron por SEM y XRD.
Energy Technology Data Exchange (ETDEWEB)
Chanteur, J; Pellerin, P [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires
1961-07-01
Rats weighing 25 g were exposed for 5 mn to a flux of 6.10{sup 12} thermal neutrons/cm{sup 2}/s. Anatomical autoradiography at -195 deg. C has enabled the radioactive organs to be easily localised, to follow in course of time the decrease of radioactivity, and from it to deduce the probable nature of the numerous emitters in question. In particular, the phosphorus 32 has thus appeared to be one of those responsible for internal irradiation, general, on the one hand, by activating cellular phosphorus, local, on the other, by activating bony phosphates. Owing to this, an accidental irradiation by neutrons might have consequences that are both somatic (elective irradiation of the bone marrow) and genetic (activation of nucleic acids). The gamma spectrometry has confirmed the nature of certain other emitters. (author) [French] Des rats de 25 g ont ete exposes pendant 5 mn a un flux de 6.10{sup 12} neutrons thermiques/cm{sup 2}/s. L'autoradiographie anatomique a -195 deg. C a permis de localiser facilement les organes radioactifs, de suivre dans le temps la decroissance de la radioactivite, et d'en deduire la nature probable des nombreux emetteurs en cause. En particulier, le phosphore 32 est ainsi apparu comme l'un des responsables de l'irradiation interne, d'une part generale par activation du phosphore cellulaire, d'autre part locale par activation des phosphates osseux. Une irradiations accidentelle par neutrons aurait, de ce fait, des consequences a la fois somatiques (irradiation elective de la moelle osseuse) et genetiques (activation des acides nucleiques). La spectrometrie gamma a confirme la nature de certains autres emetteurs. (auteur)
Energy Technology Data Exchange (ETDEWEB)
Gao, Pengfei [Key Laboratory of Electromagnetic Processing of Materials (Ministry of Education), Northeastern University, Shenyang 110819 (China); Liu, Tie, E-mail: liutie@epm.neu.edu.cn [Key Laboratory of Electromagnetic Processing of Materials (Ministry of Education), Northeastern University, Shenyang 110819 (China); Dong, Meng [Key Laboratory of Electromagnetic Processing of Materials (Ministry of Education), Northeastern University, Shenyang 110819 (China); Yuan, Yi [School of Materials and Metallurgy, Northeastern University, Shenyang 110819 (China); Wang, Qiang [Key Laboratory of Electromagnetic Processing of Materials (Ministry of Education), Northeastern University, Shenyang 110819 (China)
2016-03-01
In this paper, we studied how applying a high magnetic field during solidification of Tb{sub 0.27}Dy{sub 0.73}Fe{sub 1.95} alloys affected their magnetic domain structure, crystal orientation, and magnetostriction. We observed the morphology of the magnetic domain during solidification, finding it change with the applied field: from fiber like (0 T) to dot like and closure mixed (4.4 T) to fiber like (8.8 T) to fishbone like (11.5 T). The alloy solidified at 4.4 T showed the best contrast of light and dark in its domain image, widest magnetic domain, fastest magnetization, and highest magnetostriction; this alloy is followed in descending order by the alloys solidified at 11.5 T, 8.8 T, and 0 T. The orientation of the (Tb, Dy)Fe{sub 2} phase changed with magnetic field from random (0 T) to 〈111〉 (4.4 T) to 〈113〉 (8.8 T) to 〈110〉 (11.5 T). The improvement in magnetostriction was likely caused by modification of both the magnetization process and the alloy microstructure. - Highlights: • We present how magnetic field affects magnetic domain structure of Tb{sub 0.27}Dy{sub 0.73}Fe{sub 1.95}. • Morphology and width of magnetic domain change with increasing magnetic field. • Magnetization and magnetostriction of alloy change with increasing magnetic field. • A transformation of random–〈111〉–〈113〉–〈110〉 for (Tb, Dy)Fe{sub 2} orientation forms.
Energy Technology Data Exchange (ETDEWEB)
Ghosh, Kaustab; Lahiri, Susanta [Saha Institute of Nuclear Physics, Kolkata (India). Chemical Sciences Div.; Maiti, Moumita [Indian Institute of Technology Roorkee, Roorkee (India). Dept. of Physics
2017-07-01
The {sup 195(m,g),197m}Hg radionuclides were produced in accelerator when natural Au foil was irradiated with 23 MeV protons. The no-carrier-added (NCA) Hg radioisotopes were separated from the bulk Au target by liquid-liquid extraction (LLX) employing hydrophobic RTILs 1-butyl-3-methylimidazolium hexafluorophosphate([C{sub 4}mim][PF{sub 6}]) and 1-butyl-3-methylimidazolium bis(trifluoromethylsulfonyl)imide([bmim][Tf{sub 2}N]) as extractant with HNO{sub 3} and HCl. In each case, bulk Au was extracted into the RTIL phase leaving NCA Hg-radionuclides in the aqueous phase. The RTILs were recovered by washing with 1 M K{sub 2}S{sub 2}O{sub 5} and freshly prepared 1 M FeSO{sub 4}. The reported separation methods follow green chemistry approach as it does not involve any volatile reagents.
DEFF Research Database (Denmark)
Ovtar, Simona; Gurauskis, Jonas; Bjørnetun Haugen, Astri
2017-01-01
The oxygen permeation through dense Ce0.9Gd0.1O1.95-La0.6Sr0.4FeO3−d dual-phase composite asymmetric membranes supported on a porous MgO tube was studied. The membranes were prepared by thermoplastic extrusion, dip coating, co-sintering and infiltration of a catalyst. Oxygen permeation measureme...
Wilbur, D. Scott; Chyan, Ming-Kuan; Hamlin, Donald K.; Nguyen, Holly; Vessella, Robert L.
2011-01-01
Evaluation of monoclonal antibody (MAb) fragments (e.g. Fab′, Fab or engineered fragments) as cancer-targeting reagents for therapy with the α-particle emitting radionuclide astatine-211 (211At) has been hampered by low in vivo stability of the label and a propensity of these proteins localize to kidneys. Fortunately, our group has shown that the low stability of the 211At label, generally a meta- or para-[211At]astatobenzoyl conjugate, on MAb Fab′ fragments can be dramatically improved by use of closo-decaborate(2-) conjugates. However, the higher stability of radiolabeled MAb Fab′ conjugates appears to result in retention of the radioactivity in kidneys. This investigation was conducted to evaluate whether the retention of radioactivity in kidney might be decreased by the use of acid-cleavable hydrazone between the Fab′ and the radiolabeled closo-decaborate(2-) moiety. Five conjugation reagents containing sulfhydryl-reactive maleimide groups, a hydrazone functionality and a closo-decaborate(2-) moiety were prepared. In four of the five conjugation reagents, a discrete polyethylene glycol (PEG) linker was used, and one substituent adjacent to the hydrazone was varied (phenyl, benzoate, anisole or methyl) to provide varying acid-sensitivity. In the initial studies, the five maleimido-closo-decaborate(2-) conjugation reagents were radioiodinated (125I or 131I), then conjugated with an anti-PSMA Fab′ (107-1A4 Fab′). Biodistributions of the five radioiodinated Fab′ conjugates were obtained in nude mice at 1, 4 and 24 h post injection (pi). In contrast to closo-decaborate(2-) conjugated to 107-1A4 Fab′ through a non-cleavable linker, two conjugates containing either a benzoate or a methyl substituent on the hydrazone functionality displayed clearance rates from kidney, liver and spleen that were similar to those obtained with directly radioiodinated Fab′ (i.e. no conjugate). The maleimido-closo-decaborate(2-) conjugation reagent containing a benzoate
International Nuclear Information System (INIS)
Lindner, P.; Nickel, O.
1983-01-01
A previously reported theory for quantitative cerebral blood flow measurement for nondiffusible radiotracers has been applied to patients after stroke and to volunteers undergoing a mental stimulation exercise. Quantitative measurements of cerebral blood flow pattern in p-a and lateral projections of the brain are obtained using the short lived (30s) isotope sup(195m)Au from the recently developed generator. The energy spectrum of the eluate from the generator shows two strong photon peaks, one at an energy level of 68 KeV and a second at 262 KeV. The low-energy peak is suitable for perfusion studies of the cerebral hemispheres in lateral projection, being without ''look through'' effect. The high-energy level is good for studies in p-a-projection. Studies last less than 1 min and can be repeated after 3 min. Parametric images for quantitative regional cerebral blood flow can be generated, in which the avascular region following stroke can be detected. Quantitative activation patterns of cerebral blood flow during mental stimulation can be generated. The results show that it is possible to measure cerebral blood-flow patterns not only with freely diffusible indicators like Xenon but also with nondiffusible indicators. (orig.)
International Nuclear Information System (INIS)
Hasegawa, Y.; Tanaka, K.; Tsuruta, T.
2000-01-01
In an Accelerator-based neutron irradiation field using 7 Li(p, n) 7 Be neutrons by 1.95 MeV protons, the distributions of 10 B reaction rates and thermal neutron fluence in a water phantom were measured using Boron-doped CR-39 and Au activation analysis, respectively. Comparing the results of the measurements, we discussed the validity of the evaluation method of 10 B reaction rate using thermal neutron fluence. (author)
DEFF Research Database (Denmark)
Cheng, Shiyang; Chatzichristodoulou, Christodoulos; Søgaard, Martin
2017-01-01
Pr. A series of compositions of PrxGd0.1Ce0.9-xO1.95-δ (x = 0, 0.02, 0.05, 0.08, 0.15, 0.25, 0.3 and 0.4) was prepared by solid state reaction. X-ray powder diffraction (XPD) indicates that Pr is completely dissolved in the fluorite structure up to 40 at.%. Pronounced nonlinear thermal expansion...... behavior was observed as a function of temperature, due to the simultaneous contributions of both thermal and chemical expansion. The electronic and ionic conductivities were measured as a function of temperature and oxygen partial pressure. Within the range from 10 to 15 at.% Pr, a drastic drop...
Astatine-211 labelled proteins and their stability in vivo
International Nuclear Information System (INIS)
Yi Changhou; Jin Jannan; Zhang Shuyuan; Wang Ketai; Zhang Dayuan; Zhou Maolun
1989-01-01
211 At or 131 I labelled proteins, e.g. 211 At-IgG or 211 At-BSA (bovine serum albumin) were prepared by 211 At reaction with the diazo-compound of para-aminobenzoic acid, which is then conjugated with IgG or BSA via an acylation reaction. The 211 At-carbon bond was found metabolically stable under in vivo conditions. For the labelling of proteins with 211 At or 131 I, other methods of direct oxidation are also described. The results show that for the labelling of proteins with 211 At, high rate of incorporation can be obtained with hydrogen peroxide as oxidant, but the labelling of proteins with 131 I is more favourable with the strong oxidant Chloramine-T. (author) 12 refs.; 6 figs
Microhardness and fracture toughness of Ce0.9Gd0.1O1.95 for manufacturing solid oxide electrolytes
International Nuclear Information System (INIS)
Mangalaraja, R.V.; Ananthakumar, S.; Uma, Kasimayan; Jimenez, Romel M.; Lopez, Marta; Camurri, Carlos P.
2009-01-01
Synthesis of nanocrystalline gadolinium doped ceria (Ce 0.9 Gd 0.1 O 1.95 ) was attempted by nitrate-fuel combustion technique involving different organic fuels namely urea, citric acid, glycine and poly ethylene glycol. As-combusted ceria precursors were calcined at 700 deg. C for 2 h for obtaining fully dense, nanocrystalline ceria powders. Cylindrical ceria discs were fabricated by uni-axial pressing and sintered intentionally at low temperature of 1200 deg. C for 2 h for assessing the sintering characteristics of the nano powders as well as the mechanical performance of the sintered ceria body. The study confirms that the nano powders could be sintered to 98% theoretical sintered density at 1200 deg. C with a grain size of 400 nm to 1 μm. The sintered samples exhibited the Vickers microhardness of 8.82 ± 0.2 GPa and the fracture toughness of 1.75 ± 0.3 MPa m 1/2 at a load 20 N for glycine and citric acid fuels derived ceria, respectively. A comparison between the fuels was made with respect to the sintering and mechanical properties of doped ceria. Citric acid and glycine fuels resulted in sintered ceria with high hardness where as the urea and polyethylene fuels derived nano ceria resulted in high fracture toughness.
International Nuclear Information System (INIS)
Liu Tie; Liu Yin; Wang Qiang; Gao Pengfei; He Jicheng; Iwai, Kazuhiko
2013-01-01
The microstructure evolution and magnetization and magnetostriction properties of Tb 0.3 Dy 0.7 Fe 1.95 alloy solidified in a high magnetic field were investigated. A cellular microstructure was produced, with the grains highly aligned along the direction of the magnetic field. The (Tb,Dy)Fe 2 phase was highly oriented, with its 〈1 1 1〉 axis along the magnetic field direction. The easy magnetization direction of the alloy lay along the magnetic field direction. The magnetostriction at room temperature significantly increased to double that of the sample prepared without high magnetic field; in addition, a sharp rise in the initial magnetostriction at low fields was observed. Applying a high magnetic field during the solidification process is proposed as an effective route for fabricating 〈1 1 1〉 oriented Tb–Dy–Fe compounds, and improving their magnetic and magnetostrictive properties. (paper)
International Nuclear Information System (INIS)
Chanteur, J.; Pellerin, P.
1961-01-01
Rats weighing 25 g were exposed for 5 mn to a flux of 6.10 12 thermal neutrons/cm 2 /s. Anatomical autoradiography at -195 deg. C has enabled the radioactive organs to be easily localised, to follow in course of time the decrease of radioactivity, and from it to deduce the probable nature of the numerous emitters in question. In particular, the phosphorus 32 has thus appeared to be one of those responsible for internal irradiation, general, on the one hand, by activating cellular phosphorus, local, on the other, by activating bony phosphates. Owing to this, an accidental irradiation by neutrons might have consequences that are both somatic (elective irradiation of the bone marrow) and genetic (activation of nucleic acids). The gamma spectrometry has confirmed the nature of certain other emitters. (author) [fr
Fu, Jie; Xu, Zhen; Li, Qing-Shan; Chen, Song; An, Shu-Qing; Zeng, Qing-Fu; Zhu, Hai-Liang
2010-01-01
A comparative study of treatment of simulated wastewater containing Reactive Red 195 using zero-valent iron/activated carbon (ZVI/AC), microwave discharge electrodeless lamp/sodium hypochlorite (MDEL/NaClO) and the combination of ZVI/AC-MDEL/NaClO was conducted. The preliminary results showed the two steps method of ZVI/AC-MDEL/NaClO had much higher degradation efficiency than both single steps. The final color removal percentage was nearly up to 100% and the chemical oxygen demand reduction percentage was up to approximately 82%. The effects of operational parameters, including initial pH value of simulated wastewater, ZVI/AC ratio and particle size of ZVI were also investigated. In addition, from the discussion of synergistic effect between ZVI/AC and MEDL/NaClO, we found that in the ZVI/AC-MEDL/NaClO process, ZVI/AC could break the azo bond firstly and then MEDL/NaClO degraded the aromatic amine products effectively. Reversing the order would reduce the degradation efficiency.
CMS Collaboration
2013-01-01
A model-independent search for physics beyond the standard model, in events with at least three leptons, is presented. The data sample corresponds to 19.5\\,fb$^{-1}$ of integrated luminosity in pp collisions at $\\sqrt{s}=8$ TeV collected by the CMS experiment at the LHC in 2012. Data are binned in exclusive channels characterized by lepton charge and flavor combinations, the magnitude of missing transverse energy and jet activity in the event, the invariant mass of opposite-sign lepton pairs consistent or inconsistent with the decay of a $Z$ boson, and the presence or absence of b quarks and taus. The observations are consistent with expectations from standard model processes. We characterize the sensitivity of this analysis to new physics by interpreting the results in various supersymmetric models that yield multilepton final states including ones with Higgs bosons arising from supersymmetric decays. Finally, we place a 95\\% confidence level limit on the branching ratio for $t \\rightarrow ch$ decays. We fin...
Directory of Open Access Journals (Sweden)
Rafaela Scariot
2010-12-01
Full Text Available Objective: The present retrospective study explored the spectrum and characteristics of patients treated with orthognathic surgery at the Universidade Federal do Paraná, Brazil. Materials and method: Over a six-year period from July 2002 to July 2008, the records of 195 patients with dentofacial deformities who underwent orthognathic surgical procedures were followed up. Results: Mean patient age was 25.87 years (range 14 to 65 years and the female to male ratio was 1.5:1. The predominant racial group was "white". Most patients belonged to the economically productive population. Sixty-two patients had complete dentition. Only 3.59% patients had local anesthesia (rapid palatal expansion. Transverse maxillary deficiency was the most common deformity, followed by maxillary anteroposterior deficiency associated with mandibular anteroposterior excess. Mandibular set-back was the intervention most frequently performed. The surgical procedures took an average of 3 hours 51 minutes and orthodontic treatments took an average of 44.48 months. Complications occurred in 22.57% of patients, the most common of which were permanent paresthesia of the lower lip (7.17% and inadequate fracture reduction (5.12%. Conclusions: The findings included concepts that were useful for characterizing the profile of patients who undergo orthognathic surgery in southern Brazil. The results also may help to correctly develop protocols for patient care designed to improve the overall results of the procedures.Objetivo: Este estudio retrospectivo explora el espectro y las características de los pacientes tratados con cirugía ortognática en la Universidade Federal do Paraná. Material y método: A lo largo de 6 años, a partir de julio de 2002 hasta julio de 2008, se efectuó el seguimiento de 195 pacientes con deformidades dentofaciales que se sometieron a procedimientos de cirugía ortognática. Resultados: La edad media de los pacientes fue de 25,87 años (de 14 a 65 y la
Growth of niobium on the three-dimensional topological insulator Bi{sub 2}Te{sub 1.95}Se{sub 1.05}
Energy Technology Data Exchange (ETDEWEB)
Meixner, Philipp [Novel Materials Group, Humboldt-Universität zu Berlin, 12489 Berlin (Germany); Department of Physics and Astronomy, Seoul National University, Seoul 151-747 (Korea, Republic of); Lim, Seong Joon [Department of Physics and Astronomy, Seoul National University, Seoul 151-747 (Korea, Republic of); Park, Joonbum; Kim, Jun Sung [Department of Physics, Pohang University of Science and Technology, Pohang 790-784 (Korea, Republic of); Fischer, Saskia F. [Novel Materials Group, Humboldt-Universität zu Berlin, 12489 Berlin (Germany); Seo, Jungpil [NANOSPM Lab, Daegu Gyeongbuk Institute of Science and Technology, Daegu 711-873 (Korea, Republic of); Kuk, Young [Department of Physics and Astronomy, Seoul National University, Seoul 151-747 (Korea, Republic of)
2016-01-15
Graphical abstract: - Highlights: • We grew niobium on topological insulator at different substrate temperatures. • Local density of states is modified by deposited Nb islands. • We found a downward shift of the Dirac point, since niobium acts as a donor. • Nb grew in layer-by-layer growth mode up to an annealing temperature of 450 °C. • We applied a new cleaving method allowing for sample heating of flux-grown TI. - Abstract: While applying a new cleaving method, we investigated the growth of Nb on the three-dimensional (3D) topological insulator (TI) Bi{sub 2}Te{sub 1.95}Se{sub 1.05} by scanning tunneling microscopy and spectroscopy. After the deposition of nearly a full monolayer of Nb by high-energy electron-beam evaporation, we observed a downshift of the bands and the Dirac point on the TI surface, which is the result of an n-type doping of the TI by transition metal adatoms. Extra peaks in the spectroscopy results upon Nb deposition might indicate a Rashba-split of the bulk bands. Nb grew in small 10 nm wide islands upon sub-monolayer growth and in a layer-by-layer growth mode up to an annealing temperature of 450 °C.
International Nuclear Information System (INIS)
1995-07-01
This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches
International Nuclear Information System (INIS)
Knapp, F.F. Jr.; Mirzadeh, S.; Stabin, M.; Brill, A.B.
2005-01-01
Because of localized energy deposition within a very small volume, cellular targeted therapy with high linear energy transfer (LET) Auger-electron and alpha-particle emitting radioisotopes is of great interest. While the energy deposition from alpha particles usually encompasses several cell diameters, the dose from Auger electrons is confined to a single cell. Two major challenges for broader use of Alpha and Auger emitters are the efficient and cost effective routine production of sufficient levels of these radioisotopes, and the availability of targeting molecules to which the radioisotopes can be attached for cellular delivery of sufficient levels of activity for effective therapy. Examples of several Alpha-and Auger-emitting radioisotopes of current interest are presented. Alpha- and Auger electron-emitting radioisotopes can be produced in accelerators (A) and nuclear reactors (R), and several alpha emitter congeners (i.e. thorium-229) can be obtained from uranium decay products. The challenge for reactor production, is the availability and exploitation of methods - other then the usual radiative (n,γ) production route which will provide no-carrier-added (nca) or the high specific activity radioisotopes of interest. The submitted manuscript has been authored by a contractor of the U.S. Government under contract DE-AC05-00OR22725. Accordingly, the U.S. Government retains a nonexclusive, royalty-free license to publish or reproduce the published form of this contribution, or allow others to do so, for U.S. Government purposes High LET radioisotopes of current interest which are in the initial stages of development and/or which demonstrate practical use in clinical trials include several alpha-emitters, in particular bismuth-213 - and also the actinium-225 parent - astatine-211 and bismuth-212. Extensive experimental studies have been reported with Auger iododeoxyuridine (IdUR) radiolabeled with the iodine-125 emitter-labeled. However, development of production
Influence of porosity on densification and grain growth kinetics of Ce0.9Gd0.1O1.95 tape
DEFF Research Database (Denmark)
Ni, De Wei; Esposito, Vincenzo; Foghmoes, Søren Preben Vagn
porous layer allowing gas flow is necessary in catalytic and in gas purification devices. During the sintering with shrinkage, the total solid volume is maintained to be a constant value but the shape and size of each particle change with the formation of grain boundaries. This change in solid particles...... is accompanied by the change of shape, size and fraction of pores in a given volume. Therefore, porosity can be treated as an extra phase during sintering study. In this work, we presented the densification and grain growth behaviour of Ce0.9Gd0.1O1.95 tape cast layers with different percentage of porosity....... The emphasis was put on the effect of porosity on densification and grain growth kinetics. Derived from the sintering constitutive laws, the densification and grain growth kinetics were experimentally characterized and analyzed. Furthermore, the activation energies for viscous flow were determined from master...
Wang, Kefeng; Sun, Yin; Tao, Wei; Fei, Xiang; Chang, Chawnshang
2017-05-28
Increasing evidence has demonstrated that the androgen receptor (AR) plays important roles to promote the metastasis of clear cell renal cell carcinoma (ccRCC). The detailed mechanisms, especially how AR functions via altering the circular RNAs (circRNAs) remain unclear. Here we identified a new circRNA (named as circHIAT1) whose expression was lower in ccRCCs than adjacent normal tissues. Targeting AR could suppress ccRCC cell progression via increasing circHIAT1 expression. ChIP assay and luciferase assay demonstrated that AR suppressed circHIAT1 expression via regulating its host gene, Hippocampus Abundant Transcript 1 (HIAT1) expression at the transcriptional level. The consequences of AR-suppressed circHIAT1 resulted in deregulating miR-195-5p/29a-3p/29c-3p expressions, which increased CDC42 expression to enhance ccRCC cell migration and invasion. Increasing this newly identified signal via circHIAT1 suppressed AR-enhanced ccRCC cell migration and invasion. Together, these results suggested that circHIAT1 functioned as a metastatic inhibitor to suppress AR-enhanced ccRCC cell migration and invasion. Targeting this newly identified AR-circHIAT1-mediated miR-195-5p/29a-3p/29c-3p/CDC42 signals may help us develop potential new therapies to better suppress ccRCC metastasis. Copyright © 2017 Elsevier B.V. All rights reserved.
Oxygen Exchange and Transport in (La0.6Sr0.4)0.98FeO3-d – Ce0.9Gd0.1O1.95 Dual-Phase Composites
DEFF Research Database (Denmark)
Ovtar, Simona; Søgaard, Martin; Norrman, Kion
2018-01-01
The chemical diffusion coefficient and the effective surface exchange coefficient (kex) of dual-phase (La0.6Sr0.4)0.98FeO3-d (LSF) − Ce0.9Gd0.1O1.95 (CGO) composites containing between 30 and 70 vol.% of CGO were determined by electrical conductivity relaxation (ECR) at high oxygen partial...... pressures (10−3 .../s for a 70 vol.% of CGO in the composite at 750°C for a pO2 change from 0.2 to 1.0 atm. The experiments demonstrate that the kex is enhanced due to a synergistic effect between the two phases, and suggest a direct involvement of CGO phase in the oxygen surface exchange reaction. Possible mechanisms...
DEFF Research Database (Denmark)
Huang, Hua; Cheng, Shiyang; Gao, Jianfeng
2014-01-01
The dual-phase Ce0.9Gd0.1O1.95–La0.6Sr0.4Co0.2Fe0.8O3−δ asymmetric membrane was prepared via a phase-inversion tape-casting method. The membrane consisted of a thicker porous support layer and a thinner dense layer. When the dense side of the membrane was coated with a La0.6Sr0.4CoO3−δ catalytic...
Dinevski, Nikolaj; Sarnthein, Johannes; Vasella, Flavio; Fierstra, Jorn; Pangalu, Athina; Holzmann, David; Regli, Luca; Bozinov, Oliver
2017-07-01
To determine the rate of surgical-site infections (SSI) in neurosurgical procedures involving a shared-resource intraoperative magnetic resonance imaging (ioMRI) scanner at a single institution derived from a prospective clinical quality management database. All consecutive neurosurgical procedures that were performed with a high-field, 2-room ioMRI between April 2013 and June 2016 were included (N = 195; 109 craniotomies and 86 endoscopic transsphenoidal procedures). The incidence of SSIs within 3 months after surgery was assessed for both operative groups (craniotomies vs. transsphenoidal approach). Of the 109 craniotomies, 6 patients developed an SSI (5.5%, 95% confidence interval [CI] 1.2-9.8%), including 1 superficial SSI, 2 cases of bone flap osteitis, 1 intracranial abscess, and 2 cases of meningitis/ventriculitis. Wound revision surgery due to infection was necessary in 4 patients (4%). Of the 86 transsphenoidal skull base surgeries, 6 patients (7.0%, 95% CI 1.5-12.4%) developed an infection, including 2 non-central nervous system intranasal SSIs (3%) and 4 cases of meningitis (5%). Logistic regression analysis revealed that the likelihood of infection significantly decreased with the number of operations in the new operational setting (odds ratio 0.982, 95% CI 0.969-0.995, P = 0.008). The use of a shared-resource ioMRI in neurosurgery did not demonstrate increased rates of infection compared with the current available literature. The likelihood of infection decreased with the accumulating number of operations, underlining the importance of surgical staff training after the introduction of a shared-resource ioMRI. Copyright © 2017 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Justin Shmalberg
2015-01-01
Full Text Available Integrative veterinary medicine, the combination of complementary and alternative therapies with conventional care, is increasingly prevalent in veterinary practice and a focus of clinical instruction in many academic teaching institutions. However, the presenting complaints, therapeutic modalities, and patient population in an integrative medicine service have not been described. A retrospective analysis of 5,195 integrative patient treatment sessions in a veterinary academic teaching hospital demonstrated that patients most commonly received a combination of therapeutic modalities (39% of all treatment sessions. The 274 patients receiving multiple modalities were most frequently treated for neurologic and orthopedic disease (50.7% versus 49.6% of all presenting complaints, resp.. Older neutered or spayed dogs (mean age = 9.0 years and Dachshunds were treated more often than expected based on general population statistics. Acupuncture, laser therapy, electroacupuncture, and hydrotherapy were frequently administered (>50% patients. Neurologic patients were more likely to receive acupuncture, electroacupuncture, and therapeutic exercises but less likely than orthopedic patients to receive laser, hydrotherapy, or therapeutic ultrasound treatments (P<0.05. The results suggest that the application of these specific modalities to orthopedic and neurologic diseases should be subjected to increased evidence-based investigations. A review of current knowledge in core areas is presented.
Nakagawa, Naoki; Maruyama, Hiroki; Ishihara, Takayuki; Seino, Utako; Kawabe, Jun-ichi; Takahashi, Fumihiko; Kobayashi, Motoi; Yamauchi, Atsushi; Sasaki, Yukie; Sakamoto, Naka; Ota, Hisanobu; Tanabe, Yasuko; Takeuchi, Toshiharu; Takenaka, Toshihiro; Kikuchi, Kenjiro; Hasebe, Naoyuki
2011-01-01
Fabry disease is an X-linked lysosomal storage disorder caused by mutations of the α-galactosidase A gene (GLA), and the disease is a relatively prevalent cause of left ventricular hypertrophy mimicking idiopathic hypertrophic cardiomyopathy. We assessed clinically 5 patients of a three-generation family and also searched for GLA mutations in 10 family members. The proband had left ventricular hypertrophy with localized thinning in the basal posterior wall and late gadolinium enhancement (LGE) in the near-circumferential wall in cardiovascular magnetic resonance images and her sister had vasospastic angina pectoris without organic stenosis of the coronary arteries. LGE notably appeared in parallel with decreased α-galactosidase A activity and increased NT-pro BNP in our patients. We detected a new GLA missense mutation (G195V) in exon 4, resulting in a glycine-to-valine substitution. Of the 10 family members, 5 family members each were positive and negative for this mutation. These new data extend our clinical and molecular knowledge of GLA gene mutations and confirm that a novel missense mutation in the GLA gene is important not only for a precise diagnosis of heterozygous status, but also for confirming relatives who are negative for this mutation.
Directory of Open Access Journals (Sweden)
Chi-Yue Huang
2005-01-01
Full Text Available ODP Site 1202 of Leg 195 was designed primarily for a high-resolution study of the paleoceanography of the Kuroshio Current in the southern Okinawa Trough off NE Taiwan. Four holes were drilled in which Hole 1202D is described in detail in this study for an assessment of core quality for paleoceanography study and understanding of sedimentological features, especially turbidite sedimentation and the sediment provenances during the Late Quaternary in the southern Okinawa Trough. Pelagic mud with insignificant silt or sand layers is observed from the core top down to 133 m (mbsf; Marine Isotope Stages 1-3, but the silt-sand layer ratio (SLR: total thickness of silt and sand layers / 1.5 m of core increases gradually from a value of 50 % between 223 and 279 m, followed by decreases to values 250 _ Slate fragments are commonly found in fine-grained turbidite dominant intervals (160 - 280 m, while mica flakes can be observed in the muds throughout the core. The major detrital components were derived primarily from the Miocene slate belt of the pre-collision accretionary prism of the Central Range in northern Taiwan. The occurrence of volcanics could represent submarine volcanic activity in the active-opening Okinawa Trough back-arc basin off NE Taiwan. Shallow-marine fossils including benthic foraminifers, echinoids, bryozoans and mollusks are also found in the fine-grained turbidite dominant intervals. These fossil assemblages could have been deposited in the shallow shelf and then transported to the depositional site along with voluminous terrigenous materials derived from Taiwan, via submarine channels or by slope failures due to frequent earthquakes induced by plate convergence/collision and extension in the southwestern Okinawa Trough off NE Taiwan. It is concluded that the top 133 m of the core is better suited for paleoceanographic reconstruction.
Directory of Open Access Journals (Sweden)
Marek Napierała
2006-02-01
Full Text Available The aim of the research was to present motor development with the help of centile charts, where the centile curves determine particular parts of the population: 3, 10, 25, 50, 75, 90 and 97 percentile. The research was conducted in the spring of 2001. A survey of 11 803 girls aged between 7.5 and 19.5 years old, from various types of rural and urban schools of the Kujawsko-Pomorskie district, was conducted. Centile charts make it possible to observe the process of the development of the examined characteristic, to answer the question as to whether an individual is at the level which is characteristic of a certain age, and, in case of aberrations, to come to a conclusion that the process of growth is disturbed. While determining the centile position one can become familiar with the level of development of an individual against calendar individuals of the same age. The value of C50 determines the calendar age of an individual. The results of the empiric research shows that the curve of the individual development of a child "wanders" within some channels, which is quite normal and does not mean a distortion of development. Cílem výzkumů bylo představit motorický vývoj pomocí centilových stupnic, kdy centilové křivky určují jisté části populace: 3, 10, 25, 50, 75, 90 a 97 percentil. Výzkumy byly prováděny na jaře roku 2001. Týkaly se 11 803 dívek ve věku mezi 7,5 a 19,5 lety z různých typů venkovských a městských škol kujavsko-pomořského kraje. Centilové stupnice umožňují sledovat proces vývoje zkoumaných charakteristik, zodpovědět na otázku, zda se jednotlivec nachází na úrovni charakteristické pro určitý věk a – v případě odchylek – dospět k závěru, že proces růstu je narušený. Při stanovování centilové pozice je možno poznat úroveň vývoje jednotlivce ve srovnání s jednotlivci téhož kalendářního věku. Kalendářní věk jednotlivce určuje hodnota C50. Výsledky empirick
Directory of Open Access Journals (Sweden)
Esteban Alfaro Calderón
2008-01-01
Full Text Available Análisis de la reforma realizada al inciso 8 del artículo 195 de la Constitución Política en el año 2002; sobre la posibilidad de someter a referéndum las reformas constitucionales después de ser aprobadas en una legislatura y antes de la siguiente, esto si dos terceras partes de los miembros de la Asamblea así lo acuerdan. Hace un estudio desde la perspectiva de quienes la apoyan, así como de sus detractores. Adicionalmente realiza una investigación de doctrina y jurisprudencia de la Sala Constitucional y del Tribunal Supremo de Elecciones, en lo que al referéndum y al principio de participación se refiere.
La0.99Co0.4Ni0.6O3−δ–Ce0.8Gd0.2O1.95 as composite cathode for solid oxide fuel cells
DEFF Research Database (Denmark)
Hjalmarsson, Per; Mogensen, Mogens Bjerg
2011-01-01
We have studied a new composite SOFC cathode consisting of LaCo0.4Ni0.6O3−δ (LCN60) and Ce0.9Gd0.1O1.95 (CGO). The polarisation resistance (RP) at 750°C and OCV was measured to 0.05±0.01Ωcm2 and the activation energy was determined to be about 1eV. The impedance spectra were modelled with an EQC......-infiltrated LCN60–CGO cathodes is substantially lower than that of LSM–YSZ and comparable with single phase LSC cathodes at low T due to its low EA. RP was also found to be stable at 750°C and OCV. The cathodes were integrated onto ScYSZ based anode supported cells which were measured to have an ASR of 0...
Microdosimetry of astatine-211 and comparison with that of iodine-125
International Nuclear Information System (INIS)
Unak, T.
2001-01-01
211 At is an alpha and Auger emitter radionuclide and has been frequently used for labeling of different kind of chemical agents. 125 I is also known as an effective Auger emitter. The radionuclides which emit short range and high LET radiations such as alpha particles and Auger electrons have high radiotoxic effectiveness on the living systems. The microdosimetric data are suitable to clarify the real radiotoxic effectiveness and to get the detail of diagnostic and therapeutic application principles of these radionuclides. In this study, the energy and dose absorptions by cell nucleus from alpha particles and Auger electrons emitted by 211 At have been calculated using a Monte Carlo calculation program (code: UNMOC). For these calculations two different model corresponding to the cell nucleus have been used and the data obtained were compared with the data earlier obtained for 125 I. As a result, the radiotoxicity of 211 At is in the competition with 125 I. In the case of a specific agent labelled with 211 At or 125 I is incorporated into the cell or cell nucleus, but non-bound to DNA or not found very close to it, 211 At should considerably be much more radiotoxic than 125 I, but in the case of the labelled agent is bound to DNA or take a place very close to it, the radiotoxicity of 125 I should considerably be higher than 211 At. (author)
Teze, David; Sergentu, Dumitru-Claudiu; Kalichuk, Valentina; Barbet, Jacques; Deniaud, David; Galland, Nicolas; Maurice, Rémi; Montavon, Gilles
2017-05-31
211 At is a most promising radionuclide for targeted alpha therapy. However, its limited availability and poorly known basic chemistry hamper its use. Based on the analogy with iodine, labelling is performed via astatobenzoate conjugates, but in vivo deastatination occurs, particularly when the conjugates are internalized in cells. Actually, the chemical or biological mechanism responsible for deastatination is unknown. In this work, we show that the C-At "organometalloid" bond can be cleaved by oxidative dehalogenation induced by oxidants such as permanganates, peroxides or hydroxyl radicals. Quantum mechanical calculations demonstrate that astatobenzoates are more sensitive to oxidation than iodobenzoates, and the oxidative deastatination rate is estimated to be about 6 × 10 6 faster at 37 °C than the oxidative deiodination one. Therefore, we attribute the "internal" deastatination mechanism to oxidative dehalogenation in biological compartments, in particular lysosomes.
Bjøntegaard, Øyvind; Krauss, Matias; Budelmann, Harald
2015-01-01
This report presents the Round-Robin (RR) program and test results including a statistical evaluation of the RILEM TC195-DTD committee named “Recommendation for test methods for autogenous deformation (AD) and thermal dilation (TD) of early age concrete”. The task of the committee was to investigate the linear test set-up for AD and TD measurements (Dilation Rigs) in the period from setting to the end of the hardening phase some weeks after. These are the stress-inducing deformations in a hardening concrete structure subjected to restraint conditions. The main task was to carry out an RR program on testing of AD of one concrete at 20 °C isothermal conditions in Dilation Rigs. The concrete part materials were distributed to 10 laboratories (Canada, Denmark, France, Germany, Japan, The Netherlands, Norway, Sweden and USA), and in total 30 tests on AD were carried out. Some supporting tests were also performed, as well as a smaller RR on cement paste. The committee has worked out a test procedure recommenda...
DEFF Research Database (Denmark)
Moesgaard Iburg, Kim
2018-01-01
used the Global Burden of Diseases, Injuries, and Risk Factors Study 2016 (GBD 2016) to assess personal health-care access and quality with the Healthcare Access and Quality (HAQ) Index for 195 countries and territories, as well as subnational locations in seven countries, from 1990 to 2016. Methods...... and quality from underlying risk factor patterns, we risk-standardised cause-specific deaths due to non-cancers by location-year, replacing the local joint exposure of environmental and behavioural risks with the global level of exposure. Supported by the expansion of cancer registry data in GBD 2016, we used......·0 (14·3–23·7) in Somalia, and 23·4 (20·2–26·8) in Guinea-Bissau. The pace of progress achieved between 1990 and 2016 varied, with markedly faster improvements occurring between 2000 and 2016 for many countries in sub-Saharan Africa and southeast Asia, whereas several countries in Latin America...
Farré, Nuria; Vela, Emili; Clèries, Montse; Bustins, Montse; Cainzos-Achirica, Miguel; Enjuanes, Cristina; Moliner, Pedro; Ruiz, Sonia; Verdú-Rotellar, Jose Maria; Comín-Colet, Josep
2016-09-01
Heart failure (HF) is one of the diseases with greater healthcare expenditure. However, little is known about the cost of HF at a population level. Hence, our aim was to study the population-level distribution and predictors of healthcare expenditure in patients with HF. This was a population-based longitudinal study including all prevalent HF cases in Catalonia (Spain) on 31 December 2012 (n = 88 195). We evaluated 1-year healthcare resource use and expenditure using the Health Department (CatSalut) surveillance system that collects detailed information on healthcare usage for the entire population. Mean age was 77.4 (12) years; 55% were women. One-year mortality rate was 14%. All-cause emergency department visits and unplanned hospitalizations were required at least once in 53.4% and 30.8% of patients, respectively. During 2013, a total of €536.2 million were spent in the care of HF patients (7.1% of the total healthcare budget). The main source of expenditure was hospitalization (39% of the total) whereas outpatient care represented 20% of the total expenditure. In the general population, outpatient care and hospitalization were the main expenses. In multivariate analysis, younger age, higher presence of co-morbidities, and a recent HF or all-cause hospitalization were independently associated with higher healthcare expenditure. In Catalonia, a large portion of the annual healthcare budget is devoted to HF patients. Unplanned hospitalization represents the main source of healthcare-related expenditure. The knowledge of how expenditure is distributed in a non-selected HF population might allow health providers to plan the distribution of resources in patients with HF. © 2016 The Authors. European Journal of Heart Failure © 2016 European Society of Cardiology.
Energy Technology Data Exchange (ETDEWEB)
Olmos, L.; Alvarado-Hernandez, F.; Omar Jimenez, H.; Vergara-Hernandez, J.; Arroyo Albiter, M.; Ochoa-Gamboa, R. A.
2015-07-01
The main drawback of ferromagnetic shape memory alloys fabricated through casting methods are its brittleness. In order to overcome this disadvantage, powder metallurgy is an ideal technique for the consolidation of many engineering parts. This paper is focused on the study of the milling and sintering effects of metallic powders over the evolution of the crystalline phases responsibly for the shape memory effect of these materials. To achieve this objective, ferromagnetic shape memory alloy powders (Ni{sub 5}3.5-Fe{sub 1}9.5-Ga{sub 2}7) were prepared from a cast ingot by mechanical milling at two different times of 30 and 60 minutes. The evolution of the phases was investigated through high temperature X-ray diffraction (HTXRD), whereas sintering was analyzed with dilatometry tests. X-ray studies showed that four different phases can be present depending on the particle size and temperature at which the heat treatment was performed. Coarser powders showed a B2 structure along with a γ phase while the finer showed a L21 structure when treated below 1173 K. Furthermore, finer powders had a modulated M14 martensitic structure after sintering at temperatures above 1273 K. The sintering of powders was slow and a mass diffusion mechanism was not clearly observed. (Author)
Lean, Soo-Sum; Yeo, Chew Chieng; Suhaili, Zarizal; Thong, Kwai-Lin
2016-01-01
Acinetobacter baumannii is a Gram-negative nosocomial pathogen of importance due to its uncanny ability to acquire resistance to most antimicrobials. These include carbapenems, which are the drugs of choice for treating A. baumannii infections, and polymyxins, the drugs of last resort. Whole genome sequencing was performed on two clinical carbapenem-resistant A. baumannii AC29 and AC30 strains which had an indistinguishable ApaI pulsotype but different susceptibilities to polymyxin. Both genomes consisted of an approximately 3.8 Mbp circular chromosome each and several plasmids. AC29 (susceptible to polymyxin) and AC30 (resistant to polymyxin) belonged to the ST195 lineage and are phylogenetically clustered under the International Clone II (IC-II) group. An AbaR4-type resistance island (RI) interrupted the comM gene in the chromosomes of both strains and contained the blaOXA−23 carbapenemase gene and determinants for tetracycline and streptomycin resistance. AC29 harbored another copy of blaOXA−23 in a large (~74 kb) conjugative plasmid, pAC29b, but this gene was absent in a similar plasmid (pAC30c) found in AC30. A 7 kb Tn1548::armA RI which encodes determinants for aminoglycoside and macrolide resistance, is chromosomally-located in AC29 but found in a 16 kb plasmid in AC30, pAC30b. Analysis of known determinants for polymyxin resistance in AC30 showed mutations in the pmrA gene encoding the response regulator of the two-component pmrAB signal transduction system as well as in the lpxD, lpxC, and lpsB genes that encode enzymes involved in the biosynthesis of lipopolysaccharide (LPS). Experimental evidence indicated that impairment of LPS along with overexpression of pmrAB may have contributed to the development of polymyxin resistance in AC30. Cloning of a novel variant of the blaAmpC gene from AC29 and AC30, and its subsequent expression in E. coli also indicated its likely function as an extended-spectrum cephalosporinase. PMID:26779129
International Nuclear Information System (INIS)
Akbari-Fakhrabadi, A.; Avila, Ricardo E.; Carrasco, Hector E.; Ananthakumar, S.; Mangalaraja, R.V.
2012-01-01
Highlights: ► Combustion synthesis was followed to prepare NiO–GDC nanocomposite. ► NiO–GDC anode was applied over GDC electrolyte to fabricate a semi-cell. ► Electrical conductivity of the semi-cell was characterized. ► Structure, composition, particle size and morphology of NiO–GDC were studied. - Abstract: NiO–Ce 0.9 Gd 0.1 O 1.95 (NiO–10GDC) nanocomposite anode material was synthesized through combustion technique for possible low temperature solid oxide fuel cells (LT–SOFCs). A low weight loss is seen in the TG/DTA thermogram that indicates the complete combustion of the reactant mixtures. The powder X-ray diffraction patterns showed that the presence of NiO, GDC and Ni crystallite phases in the as combusted product. Upon calcination at 600 °C, the metallic Ni oxidized to NiO. TEM images showed a wide size distribution of fine spherical GDC and large irregularly shaped NiO particles. This NiO–10GDC anode material was applied over GDC electrolyte as a porous thin layer. Using this surface engineered GDC electrolyte a semi-cell (electrode/electrolyte structure) was fabricated. The electrical conductivity of the semi-cell was characterized with respect to temperature.
Kim, Chanho; Park, Hyunjung; Jang, Inyoung; Kim, Sungmin; Kim, Kijung; Yoon, Heesung; Paik, Ungyu
2018-02-01
Controlling triple phase boundary (TPB), an intersection of the ionic conductor, electronic conductor and gas phase as a major reaction site, is a key to improve cell performances for low-temperature solid oxide fuel cells. We report a synthesis of morphologically well-defined Gd0.1Ce0.9O1.95 (GDC) embedded Ba0.5Sr0.5Co0.8Fe0.2O3-δ (BSCF) nanofibers and their electrochemical performances as a cathode. Electrospun fibers prepared with a polymeric solution that contains crystalline Ba0.5Sr0.5Co0.8Fe0.2O3-δ particles in ∼200 nm size and Gd(NO3)3/Ce(NO3)3 precursors in an optimized weight ratio of 3 to 2 result in one dimensional structure without severe agglomeration and morphological collapse even after a high calcination at 1000 °C. As-prepared nanofibers have fast electron pathways along the axial direction of fibers, a higher surface area of 7.5 m2 g-1, and more oxygen reaction sites at TPBs than those of GDC/BSCF composite particles and core-shell nanofibers. As a result, the Gd0.1Ce0.9O1.95 embedded Ba0.5Sr0.5Co0.8Fe0.2O3-δ nanofiber cell shows excellent performances of the maximum power density of 0.65 W cm-2 at 550 °C and 1.02 W cm-2 at 600 °C, respectively.
Use of interhalogen exchange for preparation of astatine-benzene and iodo-benzene
International Nuclear Information System (INIS)
Kolachkovski, A.; Khalkin, V.A.
1976-01-01
Experimental testing of interhalogen exchange between the solid and liquid phases has been carried out at 155 deg C with particular reference to a NaOH-Na 131 I-BrPh system. Iodine transition rate is dependent on the process duration and alkali amount. The relative amounts of 131 IPh resultant from the reaction of interhalogen exchange is evaluated by paper chromatography. The results obtained may be considered as those which provide experimental support for the assumed efficiency of the production of 131 IPh based on the reaction of interhalogen exchange to yield 70-80% 131 IPh
Energy Technology Data Exchange (ETDEWEB)
Xia, Junbo [Key Laboratory of Functional Materials and Devices under Special Environments, CAS, Xinjiang Key Laboratory of Electronic Information Materials and Devices, Xinjiang Technical Institute of Physics and Chemistry, CAS, Urumqi 830011 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Zhao, Qing, E-mail: zhaoq@ms.xjb.ac.cn [Key Laboratory of Functional Materials and Devices under Special Environments, CAS, Xinjiang Key Laboratory of Electronic Information Materials and Devices, Xinjiang Technical Institute of Physics and Chemistry, CAS, Urumqi 830011 (China); Gao, Bo [Key Laboratory of Functional Materials and Devices under Special Environments, CAS, Xinjiang Key Laboratory of Electronic Information Materials and Devices, Xinjiang Technical Institute of Physics and Chemistry, CAS, Urumqi 830011 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Chang, Aimin, E-mail: changam@ms.xjb.ac.cn [Key Laboratory of Functional Materials and Devices under Special Environments, CAS, Xinjiang Key Laboratory of Electronic Information Materials and Devices, Xinjiang Technical Institute of Physics and Chemistry, CAS, Urumqi 830011 (China); Zhang, Bo; Ma, Renjun [Key Laboratory of Functional Materials and Devices under Special Environments, CAS, Xinjiang Key Laboratory of Electronic Information Materials and Devices, Xinjiang Technical Institute of Physics and Chemistry, CAS, Urumqi 830011 (China); University of Chinese Academy of Sciences, Beijing 100049 (China)
2014-04-05
Highlights: • The NTC thermister nano-powders Mn{sub 1.05−y}Co{sub 1.95−x−z−w}Ni{sub x}Mg{sub y}Al{sub z}Fe{sub w}O{sub 4} were prepared by microemulsion method. • The metal ions were subsided after twice sediment reaction. • The specimens show good electrical properties by doping some nontransition metals. -- Abstract: The NTC thermistor nano-powders of Mn{sub 1.05−y}Co{sub 1.95−x−z−w}Ni{sub x}Mg{sub y}Al{sub z}Fe{sub w}O{sub 4} were prepared by microemulsion method. Scanning electron microscope (SEM) image showed that the particles were well distributed. The mean particle-size was 72 nm. The structure of the precursor was investigated with Fourier infrared spectrometer (FI). The compositions of the powder and the as-sintered ceramic were evaluated by Energy Disperse Spectroscopy (EDS). X-ray diffraction (XRD) result indicated that the sintered samples were in the spinel structure. The room temperature resistivity ρ{sub 25}, material constant B{sub 25/85} and activation energies of the NTC thermistor are in the range of 1173–19,059 Ω cm, 3169–3771 k, 0.2672–0.3136 eV. The room temperature resistivity and B{sub 25/85} constant were found to increase with Al{sub 2}O{sub 3} content. The Mn{sub 0.9}Co{sub 1.2}Ni{sub 0.21}Mg{sub 0.15}Al{sub 0.09}Fe{sub 0.45}(A2) and Mn{sub 0.9}Co{sub 1.2}Ni{sub 0.27}Mg{sub 0.15}Al{sub 0.03}Fe{sub 0.45}(A3) specimens both showed a 200 °C resistance drift (ΔR/R) within 10% after aging at 910 °C for 600 h.
DEFF Research Database (Denmark)
Hjalmarsson, Per; Hallinder, Jonathan; Mogensen, Mogens Bjerg
2012-01-01
A bi-continuous porous cathode consisting of nano-particles of strontium substituted lanthanum cobaltite (LSC) covering the surface of a Ce0.9Gd0.1O1.95 (CGO10) backbone has been produced. The polarization resistance (R (P)) of this cathode was measured to similar to 35 m Omega cm(2) at 650...... A degrees C. The area-specific resistance at 650 A degrees C (ASR) when applied onto an anode supported cell (ASC) was found to increase from 540 to 730 m Omega cm(2) when subjected to a thermal cycle to 850 A degrees C. This effect was attributed to particles coarsening but also to a reaction...
International Nuclear Information System (INIS)
Korotkin, Yu.S.; Ter-Akop'yan, G.M.; Popeko, A.G.; Drobina, T.P.; Zhuravleva, E.L.
1982-01-01
The results of experiments on further concentration of a new natural spontaneously fissionable nuclide, the concentrates of which form the Cheleken geothermal brines have been obtained, are presented. The conclusions are drown about the chemical nature of a new spontaneously fissionable nuclide. It is a chalcophile element which copreipitates with sulphides of copper, lead, arsenic and mercury from weakly acid solutions. The behaviour of the new nuclide in sulphide systems in many respects is similar to the behaviour of polonium, astatine and probably of bismuth. The most probable stable valence of the new nuclide varies from +1 up to +3. The data available on the chemical behaviour of the new nuclide as well as the analysis over contamination by spontaneously fissionable isotopes permit to state that the new natural spontaneously fissionable nuclide does not relate to the known isotopes
Is Electronegativity a Useful Descriptor for the 'Pseudo-Alkali-Metal' NH4?
International Nuclear Information System (INIS)
Whiteside, Alexander; Xantheas, Sotiris S.; Gutowski, Maciej S.
2011-01-01
Molecular ions in the form of 'pseudo-atoms' are common structural motifs in chemistry, with properties that are transferrable between different compounds. We have determined the electronegativity of the 'pseudo-alkali metal' ammonium (NH4) and evaluated its reliability as a descriptor in comparison to the electronegativities of the alkali metals. The computed properties of its binary complexes with astatine and of selected borohydrides confirm the similarity of NH4 to the alkali metal atoms, although the electronegativity of NH4 is relatively large in comparison to its cationic radius. We paid particular attention to the molecular properties of ammonium (angular anisotropy, geometric relaxation, and reactivity), which can cause deviations from the behaviour expected of a conceptual 'true alkali metal' with this electronegativity. These deviations allow for the discrimination of effects associated with the polyatomic nature of NH4.
Directory of Open Access Journals (Sweden)
Jason A Bennie
Full Text Available The current Australian Physical Activity Guidelines recommend that adults engage in regular muscle-strengthening activity (e.g. strength or resistance training. However, public health surveillance studies describing the patterns and trends of population-level muscle-strengthening activity participation are sparse. The aim of this study is to examine the prevalence, trends and sociodemographic correlates of muscle-strengthening activity participation in a national-representative sample of Australians aged 15 years and over.Between 2001 and 2010, quarterly cross-sectional national telephone surveys were conducted as part of the Australian Sports Commission's 'Exercise, Recreation and Sport Survey'. Pooled population-weighted proportions were calculated for reporting: [i] no muscle-strengthening activity; [ii] insufficient muscle-strengthening activity, and [iii] sufficient muscle-strengthening activity. Associations with sociodemographic variables were assessed using multiple logistic regression analyses.Out of 195,926 participants, aged 15-98 years, only 10.4% (95% CI: 10.1-10.7 and 9.3% (95% CI: 9.1-9.5 met the muscle-strengthening activity recommendations in the past two weeks and in the past year, respectively. Older adults (50+ years, and those living in socioeconomically disadvantaged, outer regional/remote areas and with lower education were less likely to report sufficient muscle-strengthening activity (p<0.001. Over the 10-year monitoring period, there was a significant increase in the prevalence of sufficient muscle-strengthening activity (6.4% to 12.0%, p-value for linear trend <0.001.A vast majority of Australian adults did not engage in sufficient muscle-strengthening activity. There is a need for public health strategies to support participation in muscle-strengthening activity in this population. Such strategies should target older and lower educated adults, and those living in socioeconomically disadvantaged, outer regional
Directory of Open Access Journals (Sweden)
Olmos, Luis
2015-06-01
Full Text Available The main drawback of ferromagnetic shape memory alloys fabricated through casting methods are its brittleness. In order to overcome this disadvantage, powder metallurgy is an ideal technique for the consolidation of many engineering parts. This paper is focused on the study of the milling and sintering effects of metallic powders over the evolution of the crystalline phases responsibly for the shape memory effect of these materials. To achieve this objective, ferromagnetic shape memory alloy powders (Ni53.5-Fe19.5-Ga27 were prepared from a cast ingot by mechanical milling at two different times of 30 and 60 minutes. The evolution of the phases was investigated through high temperature X-ray diffraction (HTXRD, whereas sintering was analyzed with dilatometry tests. X-ray studies showed that four different phases can be present depending on the particle size and temperature at which the heat treatment was performed. Coarser powders showed a B2 structure along with a γ phase while the finer showed a L21 structure when treated below 1173 K. Furthermore, finer powders had a modulated M14 martensitic structure after sintering at temperatures above 1273 K. The sintering of powders was slow and a mass diffusion mechanism was not clearly observed.La principal desventaja de las aleaciones con memoria de forma ferromagnéticas obtenidas por fundición es su fragilidad. Para superar esta desventaja la metalurgia de polvos es una técnica ideal para la consolidación de las piezas, por lo que este trabajo se orientó a estudiar el efecto generado por los procesos de molienda y sinterizado de polvos sobre la evolución de las fases cristalinas que le confieren la memoria de forma a estos materiales. Para ello se prepararon polvos de la aleación ferromagnética con memoria de forma Ni53.5-Fe19.5-Ga27 a partir de un lingote fundido mediante molienda mecánica, durante dos tiempos diferentes de molienda de 30 y 60 minutos. La evolución de las fases fue
DEFF Research Database (Denmark)
Back, T.; Haraldsson, B.; Hultborn, R
2009-01-01
of the glomerular filtration rate (GFR). The renal toxicity was evaluated at levels close to the dose limit for the bone marrow and well within the range for therapeutic efficacy on tumors. Astatinated MX35-F(ab')(2) monoclonal antibodies were administered intravenously to nude mice. Both non-tumor-bearing animals...... manifested late. Examination of the kidney sections showed histologic changes that were overall subdued. Following alpha-RIT with (211)At-MX35-F(ab')(2) at levels close to the dose limit of severe myelotoxicity, the effects found on renal function were relatively small, with only minor to moderate reductions...... in GFR. These results suggest that a mean absorbed dose to the kidneys of approximately 10 Gy is acceptable, and that the kidneys would not be the primary dose-limiting organ in systemic alpha-RIT when using (211)At-MX35-F(ab')(2) Udgivelsesdato: 2009/12...
Boiling points of the superheavy elements 117 and 118
International Nuclear Information System (INIS)
Takahashi, N.
2001-01-01
It has been shown that the relativistic effect on the electrons reveal in the heavy element region. What kind of changes will appear in the heavy elements because of the relativistic effects? Can we observe the changes? We observed that the boiling points of astatine and radon are lower than that extrapolated values from lighter elements in the same groups. Systematic behavior of the elements on the boiling point was examined and a new method for the estimation of the boiling points of the superheavy elements in the halogen and rare gases has been found. The estimated values of the elements 117 and 118 are 618 and 247 K, respectively which are considerably lower than those obtained until now. If these values are correct the production of the superheavy elements with heavy ions reaction may be affected. Further, the chemical properties may be fairly different from the lighter elements. (author)
DEFF Research Database (Denmark)
Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena
2014-01-01
Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...... and much less is known of high-LET irradiation. In this paper we investigated the DNA damage response and biological consequences to photons from Cobolt-60 ((60)Co) and alpha particles from (211)At in normal primary thyrocytes of different cell cycle status. For both radiation qualities the intensity...
International Nuclear Information System (INIS)
Rosevear, A.; Sims, H.E.
1985-01-01
sup(195m)Au for medical usage is separated from sup(195m)Hg in a solution containing ions of sup(195m)Hg by contacting the solution with an adsorbing agent to adsorb 195 Hgsup(H) thereon, followed by selective elution of sup(195m)Au generated by radioactive decay of the sup(195m)Hg. The adsorbing agent comprises a composite material in the form of an inert porous inorganic substrate (e.g. Kieselguhr),the pores of which are occupied by a hydrogel of a polysaccharide (e.g. agarose) carrying terminal thiol groups for binding Hgsup(H) ions. (author)
Energy Technology Data Exchange (ETDEWEB)
Bhowmik, R.N. [Experimental Condensed Matter Physics Dvision, Saha Institute of Nuclear Physics, Kolkata-70064 (India)]. E-mail: rnb@cmp.saha.ernet.in; Ranganathan, R. [Experimental Condensed Matter Physics Dvision, Saha Institute of Nuclear Physics, Kolkata-70064 (India)]. E-mail: ranga@cmp.saha.ernet.in; Nagarajan, R. [Tata Institute of Fundamental Research, Department of Condensed Matter Physics and Materials Science, Colaba Road, Mumbai (India)
2006-04-15
We discuss our investigation of DC magnetization, as a function of time, temperature and magnetic field, and explore some distinct magnetic behaviour in the polycrystalline spinel Co{sub 0.2}Zn{sub 0.8}Fe{sub 1.95}Ho{sub 0.05}O{sub 4}. The system is essentially to be a ferrimagnet and the ferrimagnetic order (spontaneous magnetization) is identified using Arrot plot of M(H) data. Application of some scaling laws have shown the coexistence of spin glass (SG) and superparamagnetism (SPM) with ferrimagnetic order (FIMO) at low and high temperature, respectively, in the system. The coexistence of SG and SPM with FIMO shows paramagnetic to ferrimagnetic state at T{sub C}{approx}225K and ferrimagnetic to cluster spin glass state below T{sub m}{approx}120K. The non-linear increase, without hysteresis, of M(H) data above T{sub C} indicates the existence of short range interacting clusters in the paramagnetic state. In addition, the anisotropy effect of Ho{sup 3+} has shown some interesting magnetic features, such as, spin glass of Ising nature and an unusual maximum in the thermoremanent magnetization about 180K.
Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"
Energy Technology Data Exchange (ETDEWEB)
Wilbur, Daniel Scott
2012-12-12
Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.
The potential of 211Astatine for NIS-mediated radionuclide therapy in prostate cancer
International Nuclear Information System (INIS)
Willhauck, Michael J.; Sharif Samani, Bibi-Rana; Goeke, Burkhard; Wolf, Ingo; Senekowitsch-Schmidtke, Reingard; Stark, Hans-Juergen; Meyer, Geerd J.; Knapp, Wolfram H.; Morris, John C.; Spitzweg, Christine
2008-01-01
We reported recently the induction of selective iodide uptake in prostate cancer cells (LNCaP) by prostate-specific antigen (PSA) promoter-directed sodium iodide symporter (NIS) expression that allowed a significant therapeutic effect of 131 I. In the current study, we studied the potential of the high-energy alpha-emitter 211 At, also transported by NIS, as an alternative radionuclide after NIS gene transfer in tumors with limited therapeutic efficacy of 131 I due to rapid iodide efflux. We investigated uptake and therapeutic efficacy of 211 At in LNCaP cells stably expressing NIS under the control of the PSA promoter (NP-1) in vitro and in vivo. NP-1 cells concentrated 211 At in a perchlorate-sensitive manner, which allowed a dramatic therapeutic effect in vitro. After intrapertoneal injection of 211 At (1 MBq), NP-1 tumors accumulated approximately 16% ID/g 211 At (effective half-life 4.6 h), which resulted in a tumor-absorbed dose of 1,580 ± 345 mGy/MBq and a significant tumor volume reduction of up to 82 ± 19%, while control tumors continued their growth exponentially. A significant therapeutic effect of 211 At has been demonstrated in prostate cancer after PSA promoter-directed NIS gene transfer in vitro and in vivo suggesting a potential role for 211 At as an attractive alternative radioisotope for NIS-targeted radionuclide therapy, in particular in smaller tumors with limited radionuclide retention time. (orig.)
International Nuclear Information System (INIS)
Foulon, Catherine F.; Alston, Kevin L.; Zalutsky, Michael R.
1998-01-01
We report herein the preparation and biological evaluation of two radioastatinated biotin conjugates, (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide. Both conjugates were stable in the presence of human serum and cerebrospinal fluid as well as murine serum, indicating a resistance to degradation to biotinidase. The normal tissue clearance of (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide was rapid, as observed previously with their iodo analogues. Also reported are the first syntheses of N-succinimidyl 5-[ 211 At]astato-3-pyridinecarboxylate and 3-[ 211 At]astatoaniline, two reagents of potential utility for labeling proteins and peptides with 211 At
Kirk-Lawlor, N. E.; Jordan, T. E.; Rech, J.; Lehmann, S.
2010-12-01
Endorheic paleolake deposits of diatomite, mudstone, sandstone, and evaporites are exposed in the Atacama Desert of northern Chile. This study focuses on a major latest Miocene-Pliocene paleolake system centered at 19.5°S, near Tiliviche. A diatiomite unit, up to 35m thick, composed of 0.2-1.5m thick beds of massive, white diatiomite, free of plant matter and root traces, is interpreted have formed from lacustrine diatom blooms. At its maximum extent, the lake would have had a surface area of roughly 200 km2, based on the extent of the diatomite unit, and might have been 50-100 m deep, as inferred by the relationship between the diatomite unit and modern topography. The Tiliviche paleolake initially formed before 6.4 Ma, and much of its sedimentary record formed under a wetter climatic and hydrologic regime than the present. Prior to 3.5 Ma, the lake had evolved into a groundwater-fed saltpan. Polygonally fractured efflorescent halite evaporite and bedded gypsum and gypsarenite evaporite deposits that overlie the diatomite unit are evidence of this saltpan environment. The modern Atacama Desert is hyperarid, with an average precipitation of 2 mm/yr in the driest areas. The paleosol record demonstrates that hyperarid conditions dominated this region since the middle Miocene, albeit with multiple fluctuations to less arid conditions of short to moderately long duration. This hyperaridity is due to the desert’s latitude, ocean currents and the rainshadow created by the Andes. There is no evidence that the rainshadow effect has diminished since the late Miocene, hence global climate changes affecting ocean temperatures and atmospheric patterns likely caused the wetter periods in the Atacama. In particular, prior workers noted wetter conditions in the region ~6-5 Ma, followed by a return to hyper-arid conditions. The regional Pliocene return to hyperaridity coincided with the desiccation of the Tiliviche endorheic lake system. During the late Miocene (~6-5 Ma) wetter
2010-10-01
... pipeline system or (b) receive and store hazardous liquid transported by a pipeline for reinjection and... and controls the safety-related operations of a pipeline facility via a SCADA system from a control... Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY...
2010-10-01
... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY... people and has a population density of at least 1,000 people per square mile; (3) An other populated area...
2010-04-01
... breeder chickens. Use as sole source of organic arsenic. Poultry should have access to drinking water at... supplements as a top dress or mix into the daily ration to provide 22.7 mg per 100 lb of body weight (0.5 mg... chlortetracycline. Feed Type C medicated feed supplements as a top dress or mix into the daily ration to provide 22...
2010-07-01
... term Federal financial assistance includes: (1) Grants and loans of Federal funds, (2) The grant or... or any interest in such property without consideration or at a nominal consideration, or at a consideration which is reduced for the purpose of assisting the recipient, or in recognition of the public...
2010-07-01
... way in the enjoyment of any advantage or privilege enjoyed by others receiving any service, financial... its employment practices under such program (including recruitment or recruitment advertising...
Sarquis, Leila M M; Coggon, David; Ntani, Georgia; Walker-Bone, Karen; Palmer, Keith T; Felli, Vanda E; Harari, Raul; Barrero, Lope H; Felknor, Sarah A.; Gimeno, David; Cattrell, Anna; Vargas-Prada, Sergio; Bonzini, Matteo; Solidaki, Eleni; Merisalu, Eda; Habib, Rima R.; Sadeghian, Farideh; Kadir, M Masood; Warnakulasuriya, Sudath SP; Matsudaira, Ko; Nyantumbu, Busisiwe; Sim, Malcolm R; Harcombe, Helen; Cox, Ken; Marziale, Maria H; Harari, Florencia; Freire, Rocio; Harari, Natalia; Monroy, Magda V; Quintana, Leonardo A; Rojas, Marianela; Harris, E Clare; Serra, Consol; Martinez, J Miguel; Delclos, George; Benavides, Fernando G; Carugno, Michele; Ferrario, Marco M; Pesatori, Angela C; Chatzi, Leda; Bitsios, Panos; Kogevinas, Manolis; Oha, Kristel; Freimann, Tiina; Sadeghian, Ali; Peiris-John, Roshini J; Sathiakumar, Nalini; Wickremasinghe, A Rajitha; Yoshimura, Noriko; Kelsall, Helen L; Hoe, Victor C W; Urquhart, Donna M; Derrett, Sarah; McBride, David; Herbison, Peter; Gray, Andrew; Vega, Eduardo J. Salazar
2016-01-01
To inform case-definition for neck/shoulder pain in epidemiological research, we compared levels of disability, patterns of association and prognosis for pain that was limited to the neck or shoulders (LNSP) and more generalised musculoskeletal pain that involved the neck or shoulder(s) (GPNS). Baseline data on musculoskeletal pain, disability and potential correlates were collected by questionnaire from 12,195 workers in 47 occupational groups (mostly office workers, nurses, and manual workers) in 18 countries (response rate = 70%). Continuing pain after a mean interval of 14 months was ascertained through a follow-up questionnaire in 9,150 workers from 45 occupational groups. Associations with personal and occupational factors were assessed by Poisson regression and summarised by prevalence rate ratios (PRRs). The one-month prevalence of GPNS at baseline was much greater than that of LNSP (35.1% vs. 5.6%), and it tended to be more troublesome and disabling. Unlike LNSP, the prevalence of GPNS increased with age. Moreover, it showed significantly stronger associations with somatising tendency (PRR 1.6 vs. 1.3) and poor mental health (PRR 1.3 vs. 1.1); greater variation between the occupational groups studied (prevalence ranging from 0% to 67.6%) that correlated poorly with the variation in LNSP; and was more persistent at follow-up (72.1% vs. 61.7%). Our findings highlight important epidemiological distinctions between sub-categories of neck/shoulder pain. In future epidemiological research that bases case definitions on symptoms, it would be useful to distinguish pain which is localised to the neck or shoulder from more generalised pain that happens to involve the neck/shoulder region. PMID:26761390
New developments of the in-source spectroscopy method at RILIS/ISOLDE
Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V
2013-01-01
At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...
Studies of Stable Octupole Deformations in the Radium Region
2002-01-01
The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...
International Nuclear Information System (INIS)
Hofer, K.G.
1980-06-01
Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125 I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125 I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125 I-labelled Synkavit would be desirable for clinical application
Geiger, Tobias
2018-04-01
Gross domestic product (GDP) represents a widely used metric to compare economic development across time and space. GDP estimates have been routinely assembled only since the beginning of the second half of the 20th century, making comparisons with prior periods cumbersome or even impossible. In recent years various efforts have been put forward to re-estimate national GDP for specific years in the past centuries and even millennia, providing new insights into past economic development on a snapshot basis. In order to make this wealth of data utilizable across research disciplines, we here present a first continuous and consistent data set of GDP time series for 195 countries from 1850 to 2009, based mainly on data from the Maddison Project and other population and GDP sources. The GDP data are consistent with Penn World Tables v8.1 and future GDP projections from the Shared Socio-economic Pathways (SSPs), and are freely available at http://doi.org/10.5880/pik.2018.010 (Geiger and Frieler, 2018). To ease usability, we additionally provide GDP per capita data and further supplementary and data description files in the online archive. We utilize various methods to handle missing data and discuss the advantages and limitations of our methodology. Despite known shortcomings this data set provides valuable input, e.g., for climate impact research, in order to consistently analyze economic impacts from pre-industrial times to the future.
Safety of minimally invasive mitral valve surgery without aortic cross-clamp.
Umakanthan, Ramanan; Leacche, Marzia; Petracek, Michael R; Kumar, Sathappan; Solenkova, Nataliya V; Kaiser, Clayton A; Greelish, James P; Balaguer, Jorge M; Ahmad, Rashid M; Ball, Stephen K; Hoff, Steven J; Absi, Tarek S; Kim, Betty S; Byrne, John G
2008-05-01
We developed a technique for open heart surgery through a small (5 cm) right-anterolateral thoracotomy without aortic cross-clamp. One hundred and ninety-five consecutive patients (103 male and 92 female), age 69 +/- 8 years, underwent surgery between January 2006 and July 2007. Mean preoperative New York Heart Association function class was 2.2 +/- 0.7. Thirty-five patients (18%) had an ejection fraction 0.35 or less. Cardiopulmonary bypass was instituted through femoral (176 of 195, 90%), axillary (18 of 195, 9%), or direct aortic (1 of 195, 0.5%) cannulation. Under cold fibrillatory arrest (mean temperature 28.2 degrees C) without aortic cross-clamp, mitral valve repair (72 of 195, 37%), mitral valve replacement (117 of 195, 60%), or other (6 of 195, 3%) procedures were performed. Concomitant procedures included maze (45 of 195, 23%), patent foramen ovale closure (42 of 195, 22%) and tricuspid valve repair (16 of 195, 8%), or replacement (4 of 195, 2%). Thirty-day mortality was 3% (6 of 195). Duration of fibrillatory arrest, cardiopulmonary bypass, and "skin to skin" surgery were 88 +/- 32, 118 +/- 52, and 280 +/- 78 minutes, respectively. Ten patients (5%) underwent reexploration for bleeding and 44% did not receive any blood transfusions. Six patients (3%) sustained a postoperative stroke, eight (4%) developed low cardiac output syndrome, and two (1%) developed renal failure requiring hemodialysis. Mean length of hospital stay was 7 +/- 4.8 days. This simplified technique of minimally invasive open heart surgery is safe and easily reproducible. Fibrillatory arrest without aortic cross-clamping, with coronary perfusion against an intact aortic valve, does not increase the risk of stroke or low cardiac output. It may be particularly useful in higher risk patients in whom sternotomy with aortic clamping is less desirable.
Production of Astatine-211 at the Duke University Medical Center for its regional distribution
Energy Technology Data Exchange (ETDEWEB)
Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)
2016-01-01
Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.
Kahl, Wolf-Achim; Jöns, Niels; Bach, Wolfgang; Klein, Frieder
2013-04-01
In the forearc of the Mariana subduction zone system, a number of seamounts form from extrusion of blueschist and serpentine mud. Ocean Drilling Program Leg 195 drilled the South Chamorro seamount, where ultramafic clasts occur within the mud matrix. These clasts show a complex serpentinization history, which bears the potential for tracking the alteration history during uplift and cooling of mantle wedge rocks to the seafloor. Moreover, the microfabrics of the highly serpentinized harzburgite and dunite clasts exhibit evidence for multiple fracturing events in the forearc mantle. These, in turn, lead to fluid influx and varied styles of serpentinization of harzburgite and dunite. The serpentinized ultramafic clasts exhibit a variety of microfabrics that range from virtually undeformed to strongly deformed samples. Pervasively serpentinized harzburgites feature either an equigranular fabric of serpentinized olivine and orthopyroxene crystals, or different vein generations related to multiple stages of serpentinization. Several types of fluid pathways in harzburgites are present: (i) veins containing brucite and iron oxides, developed linearly without marked conformance with the rock fabric. In places, these veins developed mm-cm wide halos with finger-shaped serpentinization fronts. Veins of type (i) are either developed as syntaxial veins from a single crack-seal event with large magnetite crystals growing from one wall to the other (as confirmed with high-resolution X-ray microtomography), or formed by multiple fluid events. (ii) serpentine veins that encompass regions of marginally serpentinized, microgranular olivine and large orthopyroxene crystals. (iii) extensional serpentine veins (known as "Frankenstein" type). In the clasts studied, their occurrence is restricted to the halo region of type (i) veins. (iv) as a late-stage feature, extensional veins documenting multiple crack-seal events can be present in the serpentinites (either in undeformed regions with
Hong, Yuan-Yuan; Ma, Yu-Chao; Zhou, Yu-Guang; Gao, Fei; Liu, Hong-Can; Chen, San-Feng
2009-11-01
A nitrogen-fixing bacterium, designated strain X19-5(T), was isolated from rhizosphere soil of Sonchus oleraceus. Phylogenetic analysis based on a fragment of the nifH gene and the full-length 16S rRNA gene sequence revealed that strain X19-5(T) was a member of the genus Paenibacillus. Strain X19-5(T) showed the highest 16S rRNA gene sequence similarity (98.8 %) with Paenibacillus graminis RSA19(T) and below 97 % similarity with other recognized members of the genus. The level of DNA-DNA relatedness between strain X19-5(T) and P. graminis RSA19(T) was 45.7 %. The DNA G+C content of strain X19-5(T) was 46.8 mol%. The major fatty acids were anteiso-C(15 : 0), C(16 : 0) and iso-C(16 : 0). On the basis of its phenotypic characteristics and the level of DNA-DNA hybridization, strain X19-5(T) is considered to represent a novel species of the genus Paenibacillus, for which the name Paenibacillus sonchi sp. nov. is proposed. The type strain is X19-5(T) (=CCBAU 83901(T)=LMG 24727(T)).
Diffusion of Implanted Radioisotopes in Solids
2002-01-01
Implantation of radioisotopes into metal and semiconductor samples is performed. The implanted isotope or its decay-product should have a half-life long enough for radiotracer diffusion experiments. Such radioisotopes are utilized to investigate basic diffusion properties in semiconductors and metals and to improve our understanding of the atomic mechanisms of diffusion. For suitably chosen systems the combination of on-line production and clean implantation of radioisotopes at the ISOLDE facility opens new possibilities for diffusion studies in solids. \\\\ \\\\ The investigations are concentrated on diffusion studies of $^{195}$Au in amorphous materials. The isotope $^{195}$Au was obtained from the mass 195 of the mercury beam. $^{195}$Hg decays into $^{195}$Au which is a very convenient isotope for diffusion experiments. \\\\ \\\\ It was found that $^{195}$Au is a slow diffusor in amorphous Co-Zr alloys, whereas Co is a fast diffusor in the same matrix. The ``asymmetry'' in the diffusion behaviour is of considerab...
International Nuclear Information System (INIS)
Coveney, J.R.; Robbins, M.S.
1986-01-01
There is clinical interest in /sup 195m/Hg//sup 195m/Au generators for radionuclide angiocardiography. Generators are /sup 195m/Hg-impregnated columns through which S 2 O 3 2- /NO 3 - eluant is passed to recover /sup 195m/Au daughter (t/sub 1/2p/ approx. 30s) permitting repeated patient study at short intervals, but co-elution of some /sup 195m/Hg (t/sub 1/2p approx. 40h) limits per-study dose: eluate was injected i.v. to male and female New Zealand White rabbits (1.4-2.4 kg, 12 ml eluate ea.); approx. 40% of injected dose (ID) of /sup 195m/Hg was in kids by 3d and approx. 20% ID remained after 14d; only 37% ID was excreted (2/3 in feces) at 7d. To evaluate DMPS action upon kid /sup 195m/Hg burden, male Sprague-Dawley rats (187-240 g) were injected i.v. with 2ml eluate containing 0.02 mg DMPS/ml or eluate alone. DMPS slightly reduced % ID /sup 195m/Hg in kids 22h later: 12.2 +/- 0.3 to 8.5 +/- 0.3 (mean +/- s.e.m., n = 4). Additional rats were given 5 mg BAL/kg, i.p., or 2ml propylene glycol vehicle/kg 3-4' before 2ml eluate, i.v.; % ID of Hg was again only slightly reduced (14.4 +/- 0.2 to 10.7 +/- 0.1). Neither BAL nor DMPS, useful in repeat-dose regimens in heavy metal poisoning, are suitable in single doses for reducing absorbed radiation dose in /sup 195m/Au angiocardiography
Publications | Page 195 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
The structure of the supply chains has become more complex, with more individual production nodes and distribution... Multilateralism in crisis (restricted access). There is a crisis in multilateralism. This paper examines multilateralism by looking at the two most important current efforts to devise new multilateral rules binding ...
Publications | Page 195 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
We share the results of our funded research, and offer free training materials to ... Enhancing the adaptive capacity of communities to climate change induced ... The research project presented here was conceived as the second phase of a ...
2010-07-01
... AGENCY” and sent to: U.S. EPA, Washington Financial Management Center, Radon Proficiency Program User... or individuals who wish to notify EPA of any errors or corrections they wish to make to their listing...
Lifescience Database Archive (English)
Full Text Available d/ 1126 0.0 VHJ195 (VHJ195Q) /CSM/VH/VHJ1-D/VHJ195Q.Seq.d/ 1102 0.0 SLD492 (SLD492Q) /CSM/SL/SLD4-D/SLD492... 0.0 1 ( AU052538 ) Dictyostelium discoideum slug cDNA, clone SLD492. 817 0.0 1 ( C83939 ) Dictyostelium dis
Low cost removal of reactive dyes using wheat bran
International Nuclear Information System (INIS)
Cicek, Fatma; Ozer, Dursun; Ozer, Ahmet; Ozer, Ayla
2007-01-01
In this study, the adsorption of Reactive Blue 19 (RB 19), Reactive Red 195 (RR 195) and Reactive Yellow 145 (RY 145) onto wheat bran, generated as a by-product material from flour factory, was studied with respect to initial pH, temperature, initial dye concentration, adsorbent concentration and adsorbent size. The adsorption of RB 19, RR 195 and RY 145 onto wheat bran increased with increasing temperature and initial dye concentration while the adsorbed RB 19, RR 195 and RY 145 amounts decreased with increasing initial pH and adsorbent concentration. The Langmuir and Freundlich isotherm models were applied to the experimental equilibrium data depending on temperature and the isotherm constants were determined by using linear regression analysis. The monolayer covarage capacities of wheat bran for RB 19, RR 195 and RY 145 dyes were obtained as 117.6, 119.1 and 196.1 mg/g at 60 deg. C, respectively. It was observed that the reactive dye adsorption capacity of wheat bran decreased in the order of RY 145 > RB 19 > RR 195. The pseudo-second order kinetic and Weber-Morris models were applied to the experimental data and it was found that both the surface adsorption as well as intraparticle diffusion contributed to the actual adsorption processes of RB 19, RR 195 and RY 145. Regression coefficients (R 2 ) for the pseudo-second order kinetic model were higher than 0.99. Thermodynamic studies showed that the adsorption of RB 19, RR 195 and RY 145 dyes onto wheat bran was endothermic in nature
Nuclear and chemical data for life sciences
International Nuclear Information System (INIS)
Moumita Maiti; Indian Institute of Technology Roorkee, Roorkee, Uttarakhand
2013-01-01
Use of reactor produced radionuclides is popular in life sciences. However, cyclotron production of proton rich radionuclides are being more focused in recent times. These radionuclides have already gained attention in various fields, including life sciences, provided they are obtained in pure form. This article is a representative brief of our contributions in generating nuclear data for the production of proton rich radionuclides of terbium, astatine, technetium, ruthenium, cadmium, niobium, zirconium, rhenium, etc., which may have application in clinical, biological, agriculture studies or in basic research. The chemical data required to separate the product isotopes from the corresponding target matrix have been presented along with a few propositions of radiopharmaceuticals. It also emphasizes on the development of simple empirical technique, based on the nuclear reaction model analysis, to generate reliable nuclear data for the estimation of yield and angular distribution of emitted neutrons and light charged particles from light as well as heavy ion induced reactions on thick stopping targets. These data bear utmost important in radiation dosimetry. (author)
Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy
De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan
The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...
Development of Reagents for Application of At-211 to Targeted Radionuclide Therapy of Cancer
International Nuclear Information System (INIS)
Wilbur, D. Scott
2011-01-01
This grant covered only a period of 4 months as the major portion of the award was returned to DOE due to an award of funding from NIH that covered the same research objectives. A letter regarding the termination of the research is attached as the last page of the Final Report. The research conducted was limited due to the short period of this grant, but the results obtained in that period are outlined in the Final Report. The studies addressed in the research effort were directed at a problem that is of critical importance to the in vivo application of the alpha-particle emitting radionuclide At-211. That problem, low in vivo stability of many astatinated molecules, severely limits the use of At-211 in therapeutic applications. The advances sought in the studies were expected to expand the types of biomolecules that can be used as carriers of At-211, and provide improved in vivo targeting of the radiation dose compared with the dose delivered to normal tissue.
Sci-Thur AM: YIS – 01: New technologies for astatine-211 targeted alpha therapy research
Energy Technology Data Exchange (ETDEWEB)
Crawford, Jason; Yang, Hua; Schaffer, Paul; Ruth, Thomas [University of Victoria, Victoria, BC (Canada); TRIUMF, Vancouver, BC (Canada)
2016-08-15
Purpose: The short-range, densely ionizing α-particles emitted by {sup 211}At (t{sub 1/2}=7.2h) are well suited for the treatment of diffuse microscopic disease, using cancer targeting biomolecules. {sup 211}At availability is limited by the rarity of α-cyclotrons required for standard production. Image-based dosimetry is also limited for {sup 211}At, which emits low intensity X-rays. Our goal was to leverage state-of-the-art infrastructure at TRIUMF to produce and evaluate two related isotopes, {sup 211}Rn (t{sub 1/2}=14.6h, 73% decay to {sup 211}At) as a generator for {sup 211}At, and {sup 209}At (t{sub 1/2}=5.4h, X-ray/gamma-ray emitter) as a novel 211At surrogate for preclinical imaging studies. Methods: Produced by spallation of uranium with 480 MeV protons, mass separated ion beams of short-lived francium isotopes were implanted into NaCl targets where {sup 211}Rn or {sup 209}At were produced by radioactive decay, in situ. {sup 211}Rn was transferred to dodecane from which {sup 211}At was efficiently extracted and evaluated for clinical applicability. High energy SPECT/CT was evaluated for measuring {sup 209}At activity distributions in mice and phantoms. Results: Our small scale {sup 211}Rn/{sup 211}At generator system provided high purity {sup 211}At samples. The methods are immediately scalable to the level of radioactivity required for in vivo experiments with {sup 211}At. {sup 209}At-based high energy SPECT imaging was determined suitable for pursuing image-based dosimetry in mouse tumour models. In the future, we will utilize quantitative {sup 209}At-SPECT for image-based dose calculations. Conclusion: These early studies provided a foundation for future endeavours with {sup 211}At-based α-therapy. Canada is now significantly closer to clinical targeted α-therapy of cancer.
International Nuclear Information System (INIS)
Meyer, G.J.; Roessler, K.; Stoecklin, G.
1979-01-01
Systematic studies of the astatodiazoniation reaction and a comparison with iododediazoniation under comparable conditions are reported. The yields for all astatohalobenzenes and -toluenes were nearly constant and unaffected by the nature of the diazonium compound, its isomeric form, and the number of isomers used at the same time. Only astatofluorobenzenes were obtained at higher yields. An electron-transfer mechanism is proposed for dediazoniation at these low halide concentration levels. At sufficient thermal excitation levels the electron transfer leads to the dissociation of nitrogen, while the phenyl and halogen radicals recombine. The isomer distribution found for some of the derivatives from dediazoniation may also be due to steric effects
International Nuclear Information System (INIS)
Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira
2015-01-01
Introduction: Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated 131 I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[ 131 I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[ 131 I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[ 211 At]pAtV, an 211 At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. Methods: The radiolabeled sigma receptor ligand (+)-[ 211 At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[ 211 At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. Results: The lipophilicity of (+)-[ 211 At]pAtV was similar to that of (+)-[ 125 I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1 h post-injection were also similar between (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV. Namely, (+)-[ 211 At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. Conclusion: These results indicate that (+)-[ 211 At]pAtV could function as an new agent for alpha-radionuclide receptor therapy.
Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira
2015-11-01
Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated (131)I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[(131)I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[(131)I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[(211)At]pAtV, an (211)At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. The radiolabeled sigma receptor ligand (+)-[(211)At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[(211)At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[(211)At]pAtV and (+)-[(125)I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. The lipophilicity of (+)-[(211)At]pAtV was similar to that of (+)-[(125)I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1h post-injection were also similar between (+)-[(211)At]pAtV and (+)-[(125)I]pIV. Namely, (+)-[(211)At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. These results indicate that (+)-[(211)At]pAtV could function as an new agent for alpha-radionuclide receptor therapy. Copyright © 2015 Elsevier Inc. All rights reserved.
Ling, Yihan; Xie, Huixin; Liu, Zijing; Du, Xiaoni; Chen, Hui; Ou, Xuemei; Zhao, Ling; Budiman, Riyan Achmad
2018-03-01
For the sake of improving the electrochemical activity and chromium tolerance of the K2NiF4-type oxide, La2NiO4+δ (LNO), with nonnucleation agents like Mn and Sr elements, the electrochemical performance and degradation were comparatively studied at two cathodes La2Ni0.9Fe0.1O4+δ (LNF) and LNF-40wt%Gd0.1Ce0.9O1.95 (LNF-GDC) on the GDC electrolyte, where 5wt%Cr2O3 incorporation provides Cr-containing atmosphere. Compared with non-doped LNO, LNF shows a higher interstitial oxygen concentration (δ = 0.298) and a lower electrical conductivity, where bivalent Ni ion, {Ni}_{Ni}^{ × } , and trivalent Ni ion, {Ni}_{Ni}^{ \\cdot } , and trivalent Fe ion on Ni-site, {Fe}_{Ni}^{ \\cdot } , were observed from the XPS measurements. LNF-GDC shows greatly reduced interfacial polarization resistances (Rp), which are only half of those of LNF, indicating a better electrochemical performance. More importantly, no significant degradation of LNF-GDC in performance has been observed under exposure of Cr-containing atmosphere at 700 °C for 350 h, while Rp of LNF increased by nearly 20%, suggesting LNF by GDC incorporation can enhance the electrochemical performance as well as chromium tolerance for intermediate temperature solid oxide fuel cells (IT-SOFCs).
Computing and automation division quarterly report 4 April - 3 July 1977
International Nuclear Information System (INIS)
Walkinshaw, W.; Lea, A.T.
1977-08-01
After the final 360/195 hardware changes were made, the dual 195 services started on 18 April 1977. Despite earlier problems the hardware has now settled down to an acceptable performance level. The network link to the 360/165 Daresbury is operational, allowing workstations connected to the nodal GEC 4080 to access the 165 as well as the dual 195s and the ICL 1906A. (author)
Franke, Steffi; Lihl, Christina; Renpenning, Julian; Elsner, Martin; Nijenhuis, Ivonne
2017-12-01
Chlorinated ethanes belong to the most common groundwater and soil contaminants. Of these, 1,2-dichloroethane (1,2-DCA) is a man-made, persistent and toxic contaminant, released due to improper waste treatment at versatile production sites. This study investigated the anaerobic transformation of 1,2-DCA by Dehalococcoides mccartyi strain 195 and strain BTF08 using triple-element compound-specific stable isotope analysis of carbon, chlorine and hydrogen for the first time. Isotope fractionation patterns for carbon (εCBTF08 = -28.4 ± 3.7‰; εC195 = -30.9 ± 3.6‰) and chlorine (εClBTF08 = -4.6 ± 0.7‰; εCl195 = -4.2 ± 0.5‰) within both investigated D. mccartyi strains, as well as the dual-element analysis (ΛBTF08 = 6.9 ± 1.2; Λ195 = 7.1 ± 0.2), supported identical reaction mechanisms for dehalogenation of 1,2-DCA. Hydrogen isotope fractionation analysis revealed dihaloelimination as prevalent reaction mechanism. Vinyl chloride as major intermediate could be excluded by performing the experiment in deuterated aqueous media. Furthermore, evaluation of the derived apparent kinetic isotope effects (AKIECBTF08 = 1.029/AKIEC195 = 1.031; AKIEClBTF08 = 1.005/AKIECl195 = 1.004) pointed towards simultaneous abstraction of both involved chlorine-substituents in a concerted matter. It was shown that D. mccartyi strain BTF08 and strain 195 are capable of complete, direct dihaloelimination of 1,2-DCA to ethene. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
49 CFR 195.446 - Control room management.
2010-10-01
... for the safe operation of a pipeline facility. (e) Alarm management. Each operator using a SCADA... controls all or part of a pipeline facility through a SCADA system. Each operator must have and follow... certain provisions of API RP 1165 are not practical for the SCADA system used; (2) Conduct a point-to...
195--10 Dec 2009 [ Final version].indd
African Journals Online (AJOL)
2009-12-10
Dec 10, 2009 ... Accepted: 25 June 2009. Published: ... This paper will focus on the Leuenberg Agreement as a possible ... to confuse the true meaning of the Confession. ... Differences were minimalised as a matter of terminology and words.
49 CFR 572.195 - Thorax with arm.
2010-10-01
... dummy is in vertical orientation. (4) Push the dummy at the knees and at mid-sternum of the upper torso with just sufficient horizontally oriented force towards the seat back until the back of the upper torso is in contact with the seat back. (5) While maintaining the dummy's position as specified in...
40 CFR 792.195 - Retention of records.
2010-07-01
... agency. (c) Wet specimens, samples of test, control, or reference substances, and specially prepared material which are relatively fragile and differ markedly in stability and quality during storage, shall be... mutagenicity tests, specimens of soil, water, and plants, and wet specimens of blood, urine, feces, biological...
21 CFR 58.195 - Retention of records.
2010-04-01
... specimens (except those specimens obtained from mutagenicity tests and wet specimens of blood, urine, feces, and biological fluids), samples of test or control articles, and specially prepared material, which are relatively fragile and differ markedly in stability and quality during storage, shall be retained...
40 CFR 160.195 - Retention of records.
2010-07-01
..., terminated, or discontinued. (c) Wet specimens, samples of test, control, or reference substances, and... storage, shall be retained only as long as the quality of the preparation affords evaluation. Specimens obtained from mutagenicity tests, specimens of soil, water, and plants, and wet specimens of blood, urine...
211 At-labeled agents for alpha-immunotherapy: On the in vivo stability of astatine-agent bonds
Ayed , Tahra ,; Pilmé , Julien; Tézé , David; Bassal , Fadel ,; Barbet , Jacques ,; Chérel , Michel; Champion , Julie ,; Maurice , Rémi; Montavon , Gilles ,; Galland , Nicolas ,
2016-01-01
International audience; The application of 211 At to targeted cancer therapy is currently hindered by the rapid deastatination that occurs in vivo. As the deastatination mechanism is unknown, we tackled this issue from the viewpoint of the intrinsic properties of At-involving chemical bonds. An apparent correlation has been evidenced between in vivo stability of 211 At-labeled compounds and the AtÀR (R ¼ C, B) bond enthalpies obtained from relativistic quantum mechanical calculations. Further...
International Nuclear Information System (INIS)
Wilbur, Daniel Scott
2016-01-01
This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O'Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211 At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211 At capture (>95%) from 8M HCl solutions and release with conc. NH 4 OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211 At when loading [ 211 At]astatate appeared to be similar to that of [ 211 At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211 At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO 3 , but higher capture rates (e.g. 99%) can be obtained when 10M HNO 3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211 At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211 At isolation studies have been conducted with full-scale target dissolution and 211 At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO 3 was used (rather than HCl) for loading the 211 At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211 At separation from bismuth, which allow use of HNO 3 /HCl mixtures for loading and NaOH for eluting 211 At. Such a column could greatly simplify the overall isolation process and make it easier to automate.
International Nuclear Information System (INIS)
Foulon, Catherine F.; Schoultz, Bent W.; Zalutsky, Michael R.
1997-01-01
Biotinyl-3-[ 211 At]astatoanilide ([ 211 At]AtBA) was prepared in more than 80% yield by destannylation. In vitro, [ 211 At]AtBA exhibited a high affinity for streptavidin, and was stable after incubation in human serum, cerebrospinal fluid and distilled water, whereas it was rapidly degraded in mouse serum. HPLC analysis showed that the main degradation pathway in mouse serum was the cleavage of [ 211 At]astatoaniline. In mice, [ 211 At]AtBA and its 125 I-labeled analogue cleared rapidly from most tissues; however, there was some evidence for dehalogenation of both tracers
211At-labelling of polymer particles for radiotherapy: synthesis, purification and stability
International Nuclear Information System (INIS)
Larsen, R.H.; Hassfjell, S.P.; Hoff, P.; Alstad, J.; Bjoergum, J.
1993-01-01
Cyclotron-produced 211 At was distilled from a Bi metal target and coupled to N-succinimidyl-3-(trimethylstannyl)benzoate. The resulting N-succinimidyl-3-( 211 At)astatobenzoate was thereafter coupled to aminated monosized polymer particles with a diameter of 1.8 μm. The total time elapsed from the end of the cyclotron irradiation until the final product was prepared was about 2.5 hours. From 23 to 51% of the target activity at the end of bombardment was measured in the final conjugate. Solid-liquid extraction purification of the astatinated intermediate, using Sep-pak columns (Waters), gave more reproducible yields in the final conjugation step. The 211 At-labelled particles were incubated with fetal calf serum, human serum and human full blood at room temperature. The 211 At activity on the particles was measured before and after three times washing at 4, 24 and 48 hours. The stability was not significantly different from 100% for all media and for all time points. This indicates that 211 At-labelled particles can be stable under in vivo conditions, and may thereby be a promising agent for intracavitary radiotherapy on free-floating cancer cells or surface fixed cells. (Author)
Energy Technology Data Exchange (ETDEWEB)
Koo, Ji-Hoon [Division of Advanced Materials Engineering, Chonbuk National University, Jeonbuk, 561-756 (Korea, Republic of); Lee, Ki-Tae, E-mail: ktlee71@jbnu.ac.kr [Division of Advanced Materials Engineering, Chonbuk National University, Jeonbuk, 561-756 (Korea, Republic of); Hydrogen and Fuel Cell Research Center, Chonbuk National University, Jeonbuk, 561-756 (Korea, Republic of)
2016-05-15
Both the electrical conductivity and mechanical strength of a Sr{sub 0.8}La{sub 0.2}TiO{sub 3}–Ce{sub 0.9}Gd{sub 0.1}O{sub 1.95} (SLT-GDC) composite decreased non-linearly as the GDC content increased. In the GDC percolation region, the electrical conductivity and the mechanical strength decreased significantly. Because the carbon deposition rate increased with increasing GDC content, the redox stability decreased. The area specific resistance (ASR) of the SLT-GDC composite anode at 800 °C in H{sub 2} decreased up to 15 vol.% GDC (SLT-GDC15) and then increased at the SLT-GDC20 and the SLT-GDC33 compositions, due to the high electro–catalytic activity and low electrical conductivity of GDC. Consequently, the SLT-GDC15 composition within the mixed region below SLT and GDC percolation limit exhibited the best electrochemical performance due to the optimized electronic and ionic conduction network. - Highlights: • SLT-GDC composite anodes can be designed by percolation theory. • Incorporation of GDC improves catalytic activity. • Composite within SLT percolation threshold exhibits high mechanical strength. • Composite within the mixed percolation region exhibits the best catalytic activity. • Redox stability of the SLT-GDC composite is correlated with GDC volume.
Regulation of calcium release from the endoplasmic reticulum by the serine hydrolase ABHD2.
Yun, Bogeon; Lee, HeeJung; Powell, Roger; Reisdorph, Nichole; Ewing, Heather; Gelb, Michael H; Hsu, Ku-Lung; Cravatt, Benjamin F; Leslie, Christina C
2017-09-02
The serine hydrolase inhibitors pyrrophenone and KT195 inhibit cell death induced by A23187 and H 2 O 2 by blocking the release of calcium from the endoplasmic reticulum and mitochondrial calcium uptake. The effect of pyrrophenone and KT195 on these processes is not due to inhibition of their known targets, cytosolic phospholipase A 2 and α/β-hydrolase domain-containing (ABHD) 6, respectively, but represent off-target effects. To identify targets of KT195, fibroblasts were treated with KT195-alkyne to covalently label protein targets followed by click chemistry with biotin azide, enrichment on streptavidin beads and tryptic peptide analysis by mass spectrometry. Although several serine hydrolases were identified, α/β-hydrolase domain-containing 2 (ABHD2) was the only target in which both KT195 and pyrrophenone competed for binding to KT195-alkyne. ABHD2 is a serine hydrolase with a predicted transmembrane domain consistent with its pull-down from the membrane proteome. Subcellular fractionation showed localization of ABHD2 to the endoplasmic reticulum but not to mitochondria or mitochondrial-associated membranes. Knockdown of ABHD2 with shRNA attenuated calcium release from the endoplasmic reticulum, mitochondrial calcium uptake and cell death in fibroblasts stimulated with A23187. The results describe a novel mechanism for regulating calcium transfer from the endoplasmic reticulum to mitochondria that involves the serine hydrolase ABHD2. Copyright © 2017 Elsevier Inc. All rights reserved.
Waitumbi, John N; Gerlach, Jay; Afonina, Irina; Anyona, Samuel B; Koros, Joseph N; Siangla, Joram; Ankoudinova, Irina; Singhal, Mitra; Watts, Kate; Polhemus, Mark E; Vermeulen, Nicolaas M; Mahoney, Walt; Steele, Matt; Domingo, Gonzalo J
2011-07-01
To determine the malaria prevalence by microscopy, antigen detection and nucleic acid detection in a defined subpopulation in a Plasmodium falciparum-endemic region during the peak transmission season. Blood specimens were collected in a cross-sectional study involving children aged 5-10 years (n = 195) presenting with acute fever to two clinics in Western Kenya. All specimens underwent microscopy, HRP2 and aldolase antigen detection by enzyme immunoassay (EIA), parasite-specific DNA and total nucleic acid (RNA and DNA) by real-time PCR (qPCR) and reverse-transcriptase PCR (qRT-PCR). Microscopy detected 65/195 cases of malaria infection [95% confidence interval (CI) 52-78]. HRP2 and aldolase EIA had similar sensitivity levels detecting antigen in 65/195 (95% CI, 52-78) and 57/195 (95% CI, 45-70) cases. Discordants in antigen detection vs. microscopy occurred at Detection of total nucleic acid allowed a 3 log lower limit of detection than just DNA detection by real-time PCR in vitro. In clinical specimens, 114/195 (95% CI, 100-127) were qPCR positive (DNA), and 187/195 (95% CI, 179-191) were qRT-PCR positive (DNA plus RNA). The prevalence of submicroscopic malaria infection was significantly higher when detecting total nucleic acid than just DNA in this outpatient population during the high transmission season. Defining standards for submicroscopic infection will be important for control programmes, diagnostics development efforts and molecular epidemiology studies. © 2011 Blackwell Publishing Ltd.
Superdeformed bands of odd nuclei in A=190 region in the quasiparticle picture
International Nuclear Information System (INIS)
Terasaki, J.; Flocard, H.; Heenen, P.H.; Bonche, P.
1996-07-01
Properties of the superdeformed (SD) bands of 195 Pb and 193 Hg have been studied by the cranked Hartree-Fock-Bogoliubov method. The calculations reproduce the flat behavior of the dynamical moment of inertia of two of the SD bands of 195 Pb measured recently. Possible configuration assignments for the observed bands 3 and 4 of 195 Pb are discussed. The two interacting SD bands of 193 Hg have also been calculated. The analysis confirms the superiority of a density-dependent pairing force over a seniority pairing interaction. (author)
Comparative account of benthic community at two different locations in the continental Antarctica
Digital Repository Service at National Institute of Oceanography (India)
Ingole, B.S.; Dhargalkar, V.K.
stream_size 12 stream_content_type text/plain stream_name DOD_Tech_Pub_1996_10_195.pdf.txt stream_source_info DOD_Tech_Pub_1996_10_195.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...
International Nuclear Information System (INIS)
Ramana, M Venkata; Sreenivasulu, G; Reddy, N Ramamanohar; Kumar, K V Siva; Murty, B S; Murthy, V R K
2007-01-01
Multiferroic particulate composites with composition xNi 0.93 Co 0.02 Mn 0.5 Fe 1.95 O 4-δ + (1 - x)PbZr 0.52 Ti 0.48 O 3 where the molar fraction x varies as 0, 0.1, 0.2, 0.3, 0.4 and 0.5 were prepared by the conventional ceramic method. The presence of two phases was confirmed by x-ray diffraction and scanning electron microscopy. The temperature variation of the longitudinal modulus (L) and the internal friction (Q -1 ) of these particulate composites at 104.387 kHz was studied in the wide temperature range 30-420 deg. C. The temperature variation of the longitudinal modulus (L) in each composition of these particulate composites showed two abrupt minima. One minimum coincided with the ferroelectric-paraelectric Curie transition temperature (θ E ) and the other with the ferrimagnetic-paramagnetic Curie transition (θ M ) temperature. The internal friction (Q -1 ) measurements also showed two sharp peaks in each composition corresponding to those temperatures where the minima were noticed in the temperature variation of the longitudinal modulus behaviour. The Curie transition temperature of pure ferrite was found to be 560 deg. C. Addition of 10% of ferrite to ferroelectric in a magnetoelectric (ME) composite resulted in a 360 deg. C fall in θ M and with a further increase in ferrite content the θ M variation was found to be very nominal. However, no significant ferroelectric Curie transition temperature shift could be noticed. This behaviour is explained in the light of structural phase transitions in these multiferroic particulate composites. These ME composites were prepared with a view to using them as ME sensors and transducers
Book Review: Organizations: A Systems Approach
DEFF Research Database (Denmark)
Schoeneborn, Dennis
2016-01-01
Review of: Stefan Kühl: Organizations. A Systems Approach (trans. P. Schmitz). Farnham: Gower Publishing, 2013. 195 pp. £14.99. ISBN 9781472413413.......Review of: Stefan Kühl: Organizations. A Systems Approach (trans. P. Schmitz). Farnham: Gower Publishing, 2013. 195 pp. £14.99. ISBN 9781472413413....
Energy Technology Data Exchange (ETDEWEB)
Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)
2016-07-19
This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.
Lifescience Database Archive (English)
Full Text Available -B/AFN547Q.Seq.d/ 1342 0.0 SLE172 (SLE172Q) /CSM/SL/SLE1-C/SLE172Q.Seq.d/ 1102 0.0 SLD492 (SLD492Q) /CSM/SL/SLD4-D/SLD492...8502 ) Dictyostelium discoideum cDNA clone:dda28m11, 5' ... 839 0.0 2 ( AU052538 ) Dictyostelium discoideum slug cDNA, clone SLD492...2597 ) Dictyostelium discoideum slug cDNA, clone SLD569. 113 2e-20 1 ( AU061182 ) Dictyostelium discoideum slug cDNA, clone SLD492
FCJ-195 Privacy, Responsibility, and Human Rights Activism
Directory of Open Access Journals (Sweden)
Becky Kazansky
2015-06-01
Full Text Available In this article, we argue that many difficulties associated with the protection of digital privacy are rooted in the framing of privacy as a predominantly individual responsibility. We examine how models of privacy protection, such as Notice and Choice, contribute to the ‘responsibilisation’ of human rights activists who rely on the use of technologies for their work. We also consider how a group of human rights activists countered technology-mediated threats that this ‘responsibilisation’ causes by developing a collective approach to address their digital privacy and security needs. We conclude this article by discussing how technological tools used to maintain or counter the loss of privacy can be improved in order to support the privacy and digital security of human rights activists.
South Asia | Page 195 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
Increased soil erosion, reduced water-storage capacity, changes in microclimates, and loss of nutrients have led to a decline in the productivity of marginal lands and the impoverishment of local communities. Read more about Deforestation in Viet Nam. Language English. Au tout début du siècle, les gibbons, qui étaienttrès ...
Lifescience Database Archive (English)
Full Text Available 0.003 4 AF312772 |AF312772.1 Tetrahymena thermophila macronuclear immobilization antigen LC (SerLC) mRNA, pa...rtial cds. 30 0.044 3 AF312771 |AF312771.1 Tetrahymena thermophila macronuclear immobilization antigen LB (S...survey sequence. 44 1.2 1 AF312774 |AF312774.1 Tetrahymena thermophila macronuclear immobilization...hermophila macronuclear immobilization antigen LD (SerLD) mRNA, complete cds. 30 ...erLB) mRNA, complete cds. 30 0.060 3 AF312770 |AF312770.1 Tetrahymena thermophila macronuclear immobilizat
21 CFR 133.195 - Swiss and emmentaler cheese.
2010-04-01
... treated with hydrogen peroxide/catalase, and is subjected to the action of lactic acid-producing and propionic acid-producing bacterial cultures. One or more of the clotting enzymes specified in paragraph (b... enzymes. Rennet and/or other clotting enzymes of animal, plant, or microbial origin. (3) Other optional...
49 CFR 195.6 - Unusually Sensitive Areas (USAs).
2010-10-01
... supplies. Public Water System (PWS) means a system that provides the public water for human consumption... quality) or B (good quality). (c) As used in this part— Adequate Alternative Drinking Water Source means a... cost, involves no decline in water quality, and will meet the consumptive, hygiene, and fire fighting...
Lifescience Database Archive (English)
Full Text Available gsnyrvslglpvgavmnsadnsgaknlyviavkgikgrlnrlpsagvgd mvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnil...yviavkgikgrlnrlpsag vgdmvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgni lgpvakecsdlwpkvatnagtiv*int
195 RELIGIOUS IDENTITY AND SOCIAL INSTABILITY IN NIGERIA ...
African Journals Online (AJOL)
NGOZI
study is anchored upon is the Social Identity Theory. The study recommends ..... attracted much attention and worry today (and which is the main concern of the .... Burke & Stet, is the selective application of the accentuation effect, primarily to ...
South Asia | Page 195 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
Although economic growth has reduced poverty in much of Asia, rural and ... These pressures strain the infrastructure and fray human relations, ultimately hampering development. ... Our regional office for Asia is located in New Delhi, India.
Why Ser and not Thr brokers catalysis in the trypsin fold.
Pelc, Leslie A; Chen, Zhiwei; Gohara, David W; Vogt, Austin D; Pozzi, Nicola; Di Cera, Enrico
2015-02-24
Although Thr is equally represented as Ser in the human genome and as a nucleophile is as good as Ser, it is never found in the active site of the large family of trypsin-like proteases that utilize the Asp/His/Ser triad. The molecular basis of the preference of Ser over Thr in the trypsin fold was investigated with X-ray structures of the thrombin mutant S195T free and bound to an irreversible active site inhibitor. In the free form, the methyl group of T195 is oriented toward the incoming substrate in a conformation seemingly incompatible with productive binding. In the bound form, the side chain of T195 is reoriented for efficient substrate acylation without causing steric clash within the active site. Rapid kinetics prove that this change is due to selection of an active conformation from a preexisting ensemble of reactive and unreactive rotamers whose relative distribution determines the level of activity of the protease. Consistent with these observations, the S195T substitution is associated with a weak yet finite activity that allows identification of an unanticipated important role for S195 as the end point of allosteric transduction in the trypsin fold. The S195T mutation abrogates the Na(+)-dependent enhancement of catalytic activity in thrombin, activated protein C, and factor Xa and significantly weakens the physiologically important allosteric effects of thrombomodulin on thrombin and of cofactor Va on factor Xa. The evolutionary selection of Ser over Thr in trypsin-like proteases was therefore driven by the need for high catalytic activity and efficient allosteric regulation.
Structure of $^{191}$Pb from $\\alpha$- and $\\beta$-decay spectroscopy
Cocolios, T E; Van de Walle, J; Franchoo, S; Marsh, B A; Sjoedin, A M; Huyse, M; Zemlyanoy, S; Cocolios, T E; Bastin, B; Barzakh, A; Page, R D; Mane, E; Van Duppen, P; Darby, I G; Venhart, M; Kudryavtsev, Yu; Huber, G; Fedosseev, V N; Andreyev, A N; Keupers, M; Flanagan, K T; Stefan, I; Dexters, W; Koester, U; Antalic, S; Buscher, J; Molkanov, P; Fedorov, D V
2010-01-01
Complementary studies of $^{191}$Pb have been made in the $\\beta$- decay of $^{191}$Bi at LISOL (CRC) and in the $\\alpha$- decay of $^{195}$Po at ISOLDE (CERN). Fine structures in the $\\alpha$- decay of the low-spin and high-spin isomers of $^{195}$Po have been fully resolved. Identification of the parent state is made possible via isomer selection based on narrow-band laser frequency scanning. The $\\alpha$-particle and $\\gamma$-ray energies have been determined with greater precision. New $\\alpha$-particle and $\\gamma$-ray energies are identified. Branching ratios in the decay of $^{195}$Po and $^{191}$Pb have been examined.
Search for shipwrecks in Goa water
Digital Repository Service at National Institute of Oceanography (India)
Thakkar, M.
stream_size 3 stream_content_type text/plain stream_name 2_Indian_Conf_Mar_Archaeol_I.O._Countries_1990_195.pdf.txt stream_source_info 2_Indian_Conf_Mar_Archaeol_I.O._Countries_1990_195.pdf.txt Content-Encoding ISO-8859-1 Content...-Type text/plain; charset=ISO-8859-1 ...
Integrating Pavement Crack Detection and Analysis Using Autonomous Unmanned Aerial Vehicle Imagery
2015-03-27
INTEGRATING PAVEMENT CRACK DETECTION AND ANALYSIS USING AUTONOMOUS UNMANNED AERIAL VEHICLE...protection in the United States. AFIT-ENV-MS-15-M-195 INTEGRATING PAVEMENT CRACK DETECTION AND ANALYSIS USING AUTONOMOUS UNMANNED AERIAL...APPROVED FOR PUBLIC RELEASE; DISTRIBUTION UNLIMITED. AFIT-ENV-MS-15-M-195 INTEGRATING PAVEMENT CRACK DETECTION AND ANALYSIS USING AUTONOMOUS
DEFF Research Database (Denmark)
Caspar-Bauguil, S; Arnaud, J; Huchenq, A
1994-01-01
In the present study, we have investigated the importance of a phenylalanine (phe195) in the Tcr-C alpha region on Tcr-alpha,beta/CD3 membrane expression. An exchange of phe195 with a tyrosine residue does not affect Tcr/CD3 membrane expression; however, exchange with aspartic acid, histidine or ...
75 FR 69912 - Pipeline Safety: Control Room Management/Human Factors
2010-11-16
... 192 and 195 [Docket ID PHMSA-2007-27954] RIN 2137-AE64 Pipeline Safety: Control Room Management/Human... Control Room Management/Human Factors rule at 49 CFR 192.631 and 195.446. The NPRM proposes to expedite... rule and to engage in open discussions with the agency at PHMSA's Control Room Management...
some geochemical considerations in the petrogenesis of madagali
African Journals Online (AJOL)
DJFLEX
lithophile elements (LILE) such as Rb, Ba, Th and K and depletion in some high field strength (HFS) elements ... Ferre et al (1998), using Sr initial ratios suggested that .... Ca O. 1.95. 2.25. 2.54. 1.96. 2.98. 2.47. 1.95. 2.55. 1.05. 1.10. 1.26. 1.37.
Alpha particle emitters in medicine
International Nuclear Information System (INIS)
Fisher, D.R.
1989-09-01
Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ( 211 At) and natural bismuth-212 ( 212 Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ( 223 Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs
The in vivo fate of a 211At labelled monoclonal antibody with known specificity in a murine system
International Nuclear Information System (INIS)
Vaughan, A.T.M.; Bateman, W.J.; Fisher, D.R.
1982-01-01
A monoclonal antibody reactive against the human transferrin receptor has been labelled with the alpha and X ray emitting isotope Astatine 211. The labelling procedure does not affect the ability of the product to bind to the transferrin receptor on the human leukemic cell line HL60. Using a direct binding assay, 211 At labelled antibody can be specifically inhibited from binding to its target cells by excess unlabelled antibody. Furthermore, the binding inhibition demonstrated in this system correlates to enhanced clonogenic survival of these cells, indicating that very few atoms of 211 At/cell are required for cell death. Data obtained from labelled antibody injected into mice show that the labelled product in serum retains the ability to bind to HL60 cells in vitro, although tissue distributions of the injected activity implies that some of the radiolabel is lost from the protein. Despite this loss of label, preliminary experiments on the localization of labelled antibody to HL60 cells growing s/c in nude mice show that tumor tissue has a higher specific activity than all other tissues, other than blood, after 12 hours. This suggests that further work on the nature of label degradation in vivo is warranted in the context of potential therapeutic and diagnostic studies
Influence of conductive electroactive polymer polyaniline on ...
Indian Academy of Sciences (India)
Conductive electroactive polymer polyaniline is utilized to substitute conductive additive acetylene black in the LiMn1.95Al0.05O4 cathode for lithium ion batteries. Results show that LiMn1.95Al0.05O4 possesses stable structure and good performance. Percolation theory is used to optimize the content of conductive additive ...
Clinical phenotype analysis of paroxysmal kinesigenic dyskinesia
Directory of Open Access Journals (Sweden)
Wo-tu TIAN
2017-07-01
Full Text Available Background Paroxysmal kinesigenic dyskinesia (PKD is a disorder characterized by recurrent and brief dystonic or choreoathetoid attacks that are induced by sudden voluntary movement with highly clinical and genetic heterogeneity. We aimed to investigate the clinical features of PKD in a large Chinese population. Methods One hundred and ninety five patients diagnosed as primary PKD were recruited. For all of the participants, neurological examinations were conducted and clinical manifestations were recorded and summarized in self - made uniform registration form for PKD patients. Clinical characteristics were statistically analyzed and compared between familial and sporadic PKD patients. Results Among all of the 195 PKD patients in the present study, the gender ratio was 4.42∶1 (male∶ female. The average age of onset was (12.32 ± 3.49 years. There were 162 patients (83.08% manifestated with pure form and 33 (16.92% with complicated form of PKD. Among them 16 patients (8.21% had essential tremor (ET, and 144 patients (73.85% had premonitory symptom. The percentage of patients manifested as dystonia, chorea and mixed form during episodic attacks were 68.72% (134/195, 4.10% (8/195 and 27.18% (53/195 repectively. There were 134 cases (68.72% had facial involvement. It was recorded that 115 (58.97%, 54 (27.69% and 26 (13.33% patients had frequency of attack < 10 times/d, 10-20 times/d and > 20-30 times/d respectively. The percentages of patients whose duration of attack <10 s, 10-30 s and > 30-60 s were 60% (117/195, 29.74% (58/195 and 10.26% (20/195 respectively. There were 64 patietns (32.82% with family history of PKD and 131 (67.18% were sporadic PKD patients. Up to 40% (78/195 of patients did not require/take medications, as they had minor clinical manifestations or concerns about the side effects of anticonvulsants. Among 117 patients (60% prescribed with anticonvulsants, 114 patients showed a good response, including complete control (N
International Nuclear Information System (INIS)
Heyser, J.W.; Chacon, M.J.
1989-01-01
Exogenous proline stimulated the growth of Petunia hybrida cells on 195 mM NaCl 10-fold as compared with cells grown on 195 mM CaCl medium minus proline. L-[ 15 N]-proline was fed to cells growing on 0 and 195 mM CaCl, and its metabolism was followed by 15 N NMR analysis of cell extracts. Total proline and amino acids were determined by ninhydrin assay. Proline and primary amino acids were easily resolved in NMR spectra and the amount of 15 N-label which remained in proline was determined. Reduced catabolism of proline in cells grown on NaCl was evident. The role of exogenous proline in conferring increased NaCl tolerance in this nonhalophyte will be discussed
Toyota, Masahiro
2013-07-01
A novel palladium-catalyzed intramolecular oxidative alkylation of unactivated olefins is described. This protocol was devised to solve one of the drawbacks of the original palladium-catalyzed cycloalkenylation that we developed. We call this new procedure the 'second generation palladium-catalyzed cycloalkenylation'. This protocol has been applied to the total syntheses of cis-195A, trans-195A, boonein, scholareins A, C, D, and alpha-skytanthine.
International Nuclear Information System (INIS)
Ragimov, R.N.
2001-01-01
The role of the initial localization of esophagus cancer and its growth character is important for timely diagnostics and the choice of treatment technique. The results of clinical, radiological and endoscopic examination of 195 cases of esophagus cancer are assessed. The diagnosis is verified on the basis of biopsy and histology. All 195 patients underwent the radiotherapy at ROCUS-M and AGAT-R facilities. Out of 195 cases, esophagus cancer is localized in cervical, medial and lower parts in 7, 125 and 63 patients, respectively. Macroscopically, cancer was of the exophyte from in 105 patients and the endophyte-infiltrative form in 63 patients. The analysis of gamma-therapy results is shown that the complete tumor regression is ascertained in 91 of 105 patients with the exophyte tumor following the curative radiotherapy (60-70 Gy) [ru
All projects related to | Page 195 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
From Data to Development: Exploring the Emerging Impact of Open Government ... Topic: INFORMATION SYSTEMS, INFORMATION POLICY, Internet, ACCESS TO ... Economic and social development, CASE STUDIES, POLICY MAKING, ...
14 CFR 221.195 - Requirement for filing printed material.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Requirement for filing printed material... filing printed material. (a) Any tariff, or revision thereto, filed in paper format which accompanies... supporting paper tariff, except as authorized by the Department. (b) Any printed justifications, or other...
1935 15' Quad #195 Aerial Photo Mosaic Index - NM
Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...
195-Year History of Mykolayiv Observatory: Events and People
Directory of Open Access Journals (Sweden)
Shulga, O.V.
2017-01-01
Full Text Available The basic stages of the history of the Mykolaiv Astronomical Observatory are shown. The main results of the Observatory activities are presented by the catalogs of star positions, major and minor planets in the Solar system, space objects in the Earth orbit. The information on the qualitative and quantitative structure of the Observatory, cooperation with the observatories of Ukraine and foreign countries as well as major projects carried out in the Observatory is provided.
Culture, Cross-Role Consistency, and Adjustment: Testing Trait and Cultural Psychology Perspectives
Church, A. Timothy; Anderson-Harumi, Cheryl A.; del Prado, Alicia M.; Curtis, Guy J.; Tanaka-Matsumi, Junko; Valdez Medina, José L.; Mastor, Khairul A.; White, Fiona A.; Miramontes, Lilia A.; Katigbak, Marcia S.
2008-01-01
Trait and cultural psychology perspectives on cross-role consistency and its relation to adjustment were examined in two individualistic cultures, the United States (N = 231) and Australia (N = 195), and four collectivistic cultures, Mexico (N = 199), Philippines (N = 195), Malaysia (N = 217), and Japan (N = 180). Cross-role consistency in trait ratings was evident in all cultures, supporting trait perspectives. Cultural comparisons of mean consistency provided support for cultural psychology...
1961-03-16
results of bacteriological research carried out by Kieberle and various other authors, The folloxd.ng forms of bovine tuberculosis are considered to be...January 195/V» xre have as early as 195? proposed a sliding scale for meat inspection with regard to bovine tuberculosis which takes into consideration...of other clinical symptoms, such as metritides, orchitis, arthritis, inflammation of .JW»^ mastitis , paralysis of hind feet, abscesses in muscles
PZT crack detection in suspension-based dual stage actuator [for HDDs
Yung Ping Yeh; Ku, C
2000-01-01
An impedance method is proposed to detect cracks of PZT bars in suspension based dual stage-actuators. The frequency response amplitude of impedance at the resonance of 1.95 MHz, the PZT bar width extension mode, was very sensitive to the cracks in PZT material. As cracks in the PZT bars propagated from invisible micro cracks to visible macro cracks, the impedance gain at 1.95 MHz dropped suddenly. (3 refs).
Wrestling the Bear: The Rise of Russian Hybrid Warfare
2015-04-13
34Russia: Mythology in the Service of Realpolitik." American Foreign Policy Interests 36, no. 3 (20 14): 195, http:l...complications in 13Michael Rywkin, "Russia: Mythology in the Service of Realpolitik." American Foreign Policy Interests 36, no. 3 (20 14): 195, http...ukraine- crisis-mh 17 -investigation-idUSKBNOH40LM20 140909. Rywkin, Michael. "Russia: Mythology in the Service of Realpolitik." American Foreign Policy
Measurement of highly active samples of ultrashort-lived radionuclides and its problems
International Nuclear Information System (INIS)
van der Baan, J.G.; Panek, K.J.
1985-01-01
The measurement of highly active eluates obtained from the generators for ultrashort-lived radionuclides poses several problems which are briefly discussed by using the example of the /sup 195m/Hg→/sup 195m/Au generator. For overcoming some of the problems, the construction of a multiple single-channel analyzer that allows high count rates, is described, as well as the counting technique applicable for highly active eluates
1953-12-01
75. Aeronautics In 1950. Engineer 191,67 and 100. Critical review of gas turbine progress in 1950. Engineer 191, 50. Gas turbines in 1950. Engineer 191...1952) ; Trans. ASME 75,121. A critical review of gas turbine progress, 1952. Engineer 195, 124. Aeronautics in 1952. Engineer 195, 24, 55 and 91...Physical fundamentals of jet propulsion. Forsch. Gebiete Ingenieurw. B19, Forschungaheft 437, p 5. 0. Santangelo, Metodo di calcolo delle
2017-07-15
National levels of personal health-care access and quality can be approximated by measuring mortality rates from causes that should not be fatal in the presence of effective medical care (ie, amenable mortality). Previous analyses of mortality amenable to health care only focused on high-income countries and faced several methodological challenges. In the present analysis, we use the highly standardised cause of death and risk factor estimates generated through the Global Burden of Diseases, Injuries, and Risk Factors Study (GBD) to improve and expand the quantification of personal health-care access and quality for 195 countries and territories from 1990 to 2015. We mapped the most widely used list of causes amenable to personal health care developed by Nolte and McKee to 32 GBD causes. We accounted for variations in cause of death certification and misclassifications through the extensive data standardisation processes and redistribution algorithms developed for GBD. To isolate the effects of personal health-care access and quality, we risk-standardised cause-specific mortality rates for each geography-year by removing the joint effects of local environmental and behavioural risks, and adding back the global levels of risk exposure as estimated for GBD 2015. We employed principal component analysis to create a single, interpretable summary measure-the Healthcare Quality and Access (HAQ) Index-on a scale of 0 to 100. The HAQ Index showed strong convergence validity as compared with other health-system indicators, including health expenditure per capita (r=0·88), an index of 11 universal health coverage interventions (r=0·83), and human resources for health per 1000 (r=0·77). We used free disposal hull analysis with bootstrapping to produce a frontier based on the relationship between the HAQ Index and the Socio-demographic Index (SDI), a measure of overall development consisting of income per capita, average years of education, and total fertility rates. This
Precise measurements of the thick target neutron yields of the 7Li(p,n) reaction
International Nuclear Information System (INIS)
Matysiak, W.; Prestwich, W.V.; Byun, S.H.
2011-01-01
Thick target neutron yield of the 7 Li(p,n) 7 Be reaction was measured in the proton energy range from 1.95 to 2.3 MeV by determining induced activity of the 7 Be. A HPGe detector was used to detect the 478 keV gamma-rays emitted through 7 Be decay. A series of irradiations with nominal proton energies of 1.95, 2.0, 2.1, 2.2, and 2.3 MeV were carried out. In an independent experiment, raw neutron spectra were collected by a 3 He ion chamber for the same series of proton energies. From the raw neutron spectra, it was noted, that the effective proton energies were lower than the nominal by 50-58 keV. After corrections for the proton energy offsets were applied, the measured neutron yields matched the analytically calculated yields within 20%. Long term stability of neutron yield was tested at two nominal proton energies, 2.1 and 1.95 MeV over an experimental period of one year. The results show that the yield at 2.1 MeV was stable within rmse variation coefficient of 4.7% and remained consistent even when the lithium target was replaced, whereas at 1.95 MeV, the maximum fluctuations reached a factor of 10.
Czech Academy of Sciences Publication Activity Database
Jiránková, E.; Staš, Lubomír; Kajzar, Vlastimil; Doležalová, Hana
2013-01-01
Roč. 10, č. 2 (2013), s. 189-195 ISSN 1214-9705 R&D Projects: GA MŠk ED2.1.00/03.0082; GA MV VG20102014034 Institutional support: RVO:68145535 Keywords : subsidence trough * rock mass * overlaying strata * longwall mining * tensor stress measurement Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 0.667, year: 2013 http://www.irsm.cas.cz/materialy/acta_content/2013_02/acta_170_08_Jirankova_189-195.pdf
International Nuclear Information System (INIS)
Chatal, J. F.
2000-01-01
The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)
On the theory of time dilation in chemical kinetics
Baig, Mirza Wasif
2017-10-01
The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.
Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At
Energy Technology Data Exchange (ETDEWEB)
Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics
2016-08-01
The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.
Energy Technology Data Exchange (ETDEWEB)
Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se
2005-08-01
Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.
The Role of Attachment in Body Weight and Weight Loss in Bariatric Patients
Nancarrow, Abigail; Hollywood, Amelia; Ogden, Jane; Hashemi, Majid
2017-01-01
Purpose The aim of this study is to explore the role of attachment styles in obesity. Material and Methods The present study explored differences in insecure attachment styles between an obese sample waiting for bariatric surgery (n = 195) and an age, sex and height matched normal weight control group (n = 195). It then explored the role of attachment styles in predicting change in BMI 1 year post bariatric surgery (n = 143). Results The bariatric group reported significant...
Learn on the Fly: Quiescent Routing in Wireless Sensor Networks
2005-02-01
quality solely based on data traf- fic without employing beacons. Using a realistic sensor network traffic trace and an 802.11b testbed of 195 Stargates ...testbed of 195 Stargates [1] with 802.11b radios. For instance, we investigate the validity of geographic uniformity which is assumed in literature [19...Figure 1), we deploy 29 Stargates in a straight line, with a 45-meter separation between any two consecutive Stargates . The Stargates run Linux with
DEFF Research Database (Denmark)
Andersen, Lars Bo; Anderssen, Sigmund Alfred; Wisløff, Ulrik
2014-01-01
Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers.......Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers....
Nuclear medicine technology. Progress report, quarter ending March 31, 1980
International Nuclear Information System (INIS)
Knapp, F.F. Jr.
1980-10-01
The successful detection of experimentally produced myocardial infarctions in rats and dogs using /sup 123m/Te-9-telluraheptadecanoic acid (9-[/sup 123m/Te]-THDA) is described. Preferential localization of radioactivity in normal myocardial tissue of rats that had experimentally produced infarctions was also demonstrated by tissue distribution studies following injection of 9-[/sup 123m/Te]-THDA. The effects of chain length on the myocardial uptake of 75 Se-labeled long-chain fatty acids was also studied further. Selenium-75-labeled 13-selenaheneicosonic acid [H 3 C-(CH 2 ) 7 - 75 Se-(CH 2 ) 11 -COOH, 13-[ 75 Se]-SHCA] shows the highest heart uptake in rats of the agents studied. These results indicate that myocardial imaging may be possible with 13-[ 75 Se]-SHCA and also suggest that potential positron emission tomography of the myocardium with the 73 Se-labeled agent should be explored. The results of continuing studies with 11 C and /sup 195m/Pt-labeled agents are also described. A variety of 11 C-labeled amino acids were prepared and tested as pancreas and tumor localizing agents in a Medical Cooperative Program with the Oak Ridge Associated Universities. The microscale synthesis of /sup 195m/Pt-labeled cis-dichloro-trans-dihydroxy-bis-(isopropylamine)platinum(IV) (/sup 195m/Pt-CHIP) was developed further and preliminary tissue distribution studies with this important second-generation antitumor drug were completed in rats. Platinum-195m-labeled cis-dichlorodiammineplatinum(II) (/sup 195m/Pt-cis-DDP) was supplied for testing to a number of Medical Cooperative Programs. Studies of arsenic trioxide (As 2 O 3 ) toxicity for human cells in the diffusion chamber assay system have continued. Further investigation of this arsenic-induced cytotoxicity has demonstrated a linear dose-response relationship and a difference in the permanence of the growth inhibitory effect using different doses
Precise measurements of the thick target neutron yields of the {sup 7}Li(p,n) reaction
Energy Technology Data Exchange (ETDEWEB)
Matysiak, W., E-mail: matysiw@mcmaster.ca [Department of Medical Physics and Applied Radiation Sciences, McMaster University, Hamilton, Ont., L8S 4K1 (Canada); Prestwich, W.V.; Byun, S.H. [Department of Medical Physics and Applied Radiation Sciences, McMaster University, Hamilton, Ont., L8S 4K1 (Canada)
2011-07-01
Thick target neutron yield of the {sup 7}Li(p,n){sup 7}Be reaction was measured in the proton energy range from 1.95 to 2.3 MeV by determining induced activity of the {sup 7}Be. A HPGe detector was used to detect the 478 keV gamma-rays emitted through {sup 7}Be decay. A series of irradiations with nominal proton energies of 1.95, 2.0, 2.1, 2.2, and 2.3 MeV were carried out. In an independent experiment, raw neutron spectra were collected by a {sup 3}He ion chamber for the same series of proton energies. From the raw neutron spectra, it was noted, that the effective proton energies were lower than the nominal by 50-58 keV. After corrections for the proton energy offsets were applied, the measured neutron yields matched the analytically calculated yields within 20%. Long term stability of neutron yield was tested at two nominal proton energies, 2.1 and 1.95 MeV over an experimental period of one year. The results show that the yield at 2.1 MeV was stable within rmse variation coefficient of 4.7% and remained consistent even when the lithium target was replaced, whereas at 1.95 MeV, the maximum fluctuations reached a factor of 10.
Doping effects of carbon and titanium on the critical current density of MgB2
International Nuclear Information System (INIS)
Shen, T M; Li, G; Cheng, C H; Zhao, Y
2006-01-01
MgB 2 bulks doped with Ti or/and C were prepared by an in situ solid state reaction method to determine the combined effect of C and Ti doping and to probe the detailed mechanism. The magnetization measurement shows that Mg 0.95 Ti 0.05 B 1.95 C 0.05 sample has significantly improved flux pinning compared to the MgB 1.95 C 0.05 sample at 20 K, indicating that C and Ti are largely cooperative in improving the J c (H) behaviour. No TiC phase was detected in the x-ray diffraction (XRD) patterns. Moreover, the overlap of the (100) peaks of MgB 1.95 C 0.05 and Mg 0.95 Ti 0.05 B 1.95 C 0.05 showed that Ti doping does not reduce the amount of C in MgB 2 . Microstructural analyses revealed that the addition of Ti eliminated the porosity present in the carbon-doped MgB 2 pellet, resulting in an improved intergrain connectivity and an increase of effective current pass. Further, MgB 2 doped with C and Ti, which mainly consists of spherical grains about 200-300 nm in size, shows an higher grain homogeneity than the C-doped sample, suggesting that the Ti doping in MgB 1-x C x has played an important role in obtaining uniform grains
Safety considerations in the clinical setting
International Nuclear Information System (INIS)
de Jong, R.
1985-01-01
Safe, everyday use of /sup 195m/Hg→/sup 195m/Au generators requires strict adherence to a handling protocol to ensure a minimal radiation risk to the patient. This protocol involves preparatory washings of the generator, as well as frequent washings between patient administrations. The design of the generator makes massive breakthrough of parent isotope extremely improbable. Because the possibility of quality control on individual administered doses is not feasible, a check on parent-isotope leakage must be performed very regularly
Thermal degradation of polyoxymethylene produced by solid-state polymerization
International Nuclear Information System (INIS)
Pearson, A.W.N.; Groves, G.W.
1976-01-01
The thermal degradation of polyoxymethylene produced by the solid-state polymerization of trioxane crystals was studied. Changes in small-angle and wide-angle x-ray patterns, weight loss, and density were measured in specimens heated in air at 175, 185, and 195 0 C. The polyoxymethylene contained materials in two different crystallographic orientations which behaved differently. Material in the so-called ''twin'' orientation melted preferentially at 185 and 195 0 C, and at 185 0 C resolidified on cooling in parallel to the main orientation, in a lamellar structure. At 195 0 C, randomly oriented material was produced on resolidification. At 175 0 C, there was no evidence of melting or the formation of a lamellar structure, but the twin material was preferentially degraded so that only material in the main orientation remained after a time of 1500 min. The more rapid loss by degradation of the twin material was attributed to its having a lower molecular weight than the material in the main orientation
Low temperature oxidation of hydrocarbons using an electrochemical reactor
DEFF Research Database (Denmark)
Ippolito, Davide
conversion was a complex function of multiple variables: the microstructure of the backbone, the polarization resistance of the electrodes, both at OCV and under polarization, the electrical and morphological properties of the infiltrated material and the specific reaction conditions like the propene......This study investigated the use of a ceramic porous electrochemical reactor for the deep oxidation of propene. Two electrode composites, La0.85Sr0.15MnO3±d/Ce0.9Gd0.1O1.95 (LSM/CGO) and La0.85Sr0.15FeMnO3/Ce0.9Gd0.1O1.95 (LSF/CGO), were produced in a 5 single cells stacked configuration and used...... prolonged polarization was able to partially counteract the instability of the infiltrated Ce0.9Gd0.1O1.95. This project demonstrated the possibility to enhance the oxidation of propene by polarization in a porous ceramic reactor. The infiltration of different active materials helped to increase...
Directory of Open Access Journals (Sweden)
Mayumi Kamada
Full Text Available De novo microbial genome sequencing reached a turning point with third-generation sequencing (TGS platforms, and several microbial genomes have been improved by TGS long reads. Bacillus subtilis natto is closely related to the laboratory standard strain B. subtilis Marburg 168, and it has a function in the production of the traditional Japanese fermented food "natto." The B. subtilis natto BEST195 genome was previously sequenced with short reads, but it included some incomplete regions. We resequenced the BEST195 genome using a PacBio RS sequencer, and we successfully obtained a complete genome sequence from one scaffold without any gaps, and we also applied Illumina MiSeq short reads to enhance quality. Compared with the previous BEST195 draft genome and Marburg 168 genome, we found that incomplete regions in the previous genome sequence were attributed to GC-bias and repetitive sequences, and we also identified some novel genes that are found only in the new genome.
People’s Republic of China Scientific Abstracts, Number 195.
1978-08-01
76 15 CHIH-WU HSUEH-PAO [ACTA BOTANICA SINICA] No 1, March 1978 16 TI-CHEN CHAN-HSIEN [EARTHQUAKE FRONT] No 2, April 1978 26 K-HSUEH...steril^UMs! and Consolidate the contradiction between the hsien and 6168 CSO: 8111/1528 15 ACTA BOTANICA SINICA AUTHOR: CHANG Te-i [l72B 1795...of Cultured Tobacco Cells" SOURCE: Peking CHIH-WU H5UEH-PA0 [_ACTA BOTANICA SINICÄ] in Chinese No 1, Mar 78 pp 1-5 TEXT OF ENGLISH ABSTRACT
40 CFR 267.195 - What are the secondary containment requirements?
2010-07-01
... wastes or accumulated liquid out of the system to the soil, groundwater, or surface water at any time... the failure of either the primary or secondary containment structure or the presence of any release of... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What are the secondary containment...
Role of microRNA-195 in cardiomyocyte apoptosis induced by ...
Indian Academy of Sciences (India)
drinking water and sterilized standard diet. The mice were ... was performed with the in situ cell death detection kit ... facturer's protocol to detect apoptotic cardiomyocytes. The ..... ulate the leakage of Cyt-c and initiate apoptosis through the.
Transfer in the light Hg isotopes and the U(6/12) models
International Nuclear Information System (INIS)
Vergnes, M.; Grafeuille, S.; Rotbard, G.
1985-01-01
It was suggested recently that the level schemes of the odd Hg isotopes with 193 200 Hg, 198 Hg, 196 Hg(p,d) 199 Hg, 197 Hg, 195 Hg. The comparison of the experimental spectroscopic factors with the ones computed using the U(6/12) model shows that, among the three nuclei studied, 195 Hg and 197 Hg can be considered as reasonably described. The agreement in this case with U(6/12) is better in the U(5) limit than in the O(6) limit
Structural characteristics of marine sedimentary humic acids by CP/MAS sup(13)C NMR spectroscopy
Digital Repository Service at National Institute of Oceanography (India)
Sardessai, S.; Wahidullah, S.
quino- nes or semiquinones which exhibit 13C resonance at around 195 ppm. Free radicals of semiquinone type have been reported from the aquatic environment [2]. Spectra of all the four samples show absorption at 195 ppm. The total acidity of marine..., significant resonance at 55 ppm (8.9) from aromatic methoxy carbon suggests that phenol is present mostly as methyl ether and not as free phenol. The signal at 55 ppm is also attributed to aliphatic carbon adjacent to the amino functional group as in amino...
ORF Alignment: NC_002162 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available CHRLDLNTSGLIVAAKTANALRVITEMFKNNDVIRIYKCLTYNQLPKNNDVIY 195 ... SAFVPSLCHRLDLNTSGLIVAAKTANALRVITEMFKNNDVIRIYKCLTYNQLPKNNDVI...Y Sbjct: 121 SAFVPSLCHRLDLNTSGLIVAAKTANALRVITEMFKNNDVIRIYKCLTYNQLPKNNDVIY 180 ... Query: 25
Evaluation of the filler packing structures in dental resin composites: From theory to practice.
Wang, Ruili; Habib, Eric; Zhu, X X
2018-07-01
The aim of this study is to evaluate the packing properties of uniform silica particles and their mixture with secondary particles yielding maximally loaded dental composites. We intend to verify the difference between the idealized models (the close-packed structures and the random-packed structures) and the actual experimental results, in order to provide guidance for the preparation of dental composites. The influence of secondary particle size and the resin composition on the physical-mechanical properties and the rheological properties of the experimental dental composites was also investigated. Silica particles (S-920, S-360, and S-195) with average diameters of 920, 360, and 195nm were synthesized via the Stöber process. Their morphology and size distribution were determined by field-emission scanning electron microscopy and laser particle sizer. A series of silica fillers, S-920, S-920+195, S-920+360, and S-920+360+195, were then formulated with two Bis-GMA/TEGDMA resins (weight ratios of 70:30 and 50:50). For these experimental dental composites, their maximum filler loadings were assessed and compared to the theory. The mechanical properties, degree of conversion, depth of cure, and polymerization shrinkage of these composites were then evaluated. Their rheological behaviors were measured with a rheometer. Unimodal S-920 had the maximally filler loading of 70.80wt% with the 5B5T resin, close to the theoretical estimation of the random loose packing (71.92wt%). The maximum loading of the S-920+360+195 filled composite was 72.92wt% for the same resin, compared to the theoretical estimation of 89.29wt% obtained for the close-packed structures. These findings indicate that random loose packing matches more closely to the real packing state for the filler formulations used. When maximally loaded, the composite with S-920+360+195 produced the best mechanical properties and the lowest polymerization shrinkage. The degree of conversion and depth of cure were
Bègue, Nelson; Mbatha, Nkanyiso; Bencherif, Hassan; Tato Loua, René; Sivakumar, Venkataraman; Leblanc, Thierry
2017-11-01
In this investigation a statistical analysis of the characteristics of mesospheric inversion layers (MILs) over tropical regions is presented. This study involves the analysis of 16 years of lidar observations recorded at Réunion (20.8° S, 55.5° E) and 21 years of lidar observations recorded at Mauna Loa (19.5° N, 155.6° W) together with SABER observations at these two locations. MILs appear in 10 and 9.3 % of the observed temperature profiles recorded by Rayleigh lidar at Réunion and Mauna Loa, respectively. The parameters defining MILs show a semi-annual cycle over the two selected sites with maxima occurring near the equinoxes and minima occurring during the solstices. Over both sites, the maximum mean amplitude is observed in April and October, and this corresponds to a value greater than 35 K. According to lidar observations, the maximum and minimum mean of the base height ranged from 79 to 80.5 km and from 76 to 77.5 km, respectively. The MILs at Réunion appear on average ˜ 1 km thinner and ˜ 1 km lower, with an amplitude of ˜ 2 K higher than Mauna Loa. Generally, the statistical results for these two tropical locations as presented in this investigation are in fairly good agreement with previous studies. When compared to lidar measurements, on average SABER observations show MILs with greater amplitude, thickness and base altitudes of 4 K, 0.75 and 1.1 km, respectively. Taking into account the temperature error by SABER in the mesosphere, it can therefore be concluded that the measurements obtained from lidar and SABER observations are in significant agreement. The frequency spectrum analysis based on the lidar profiles and the 60-day averaged profile from SABER confirms the presence of the semi-annual oscillation where the magnitude maximum is found to coincide with the height range of the temperature inversion zone. This connection between increases in the semi-annual component close to the inversion zone is in agreement with most previously
El-Naggar, Mehrez E; Radwan, Emad K; El-Wakeel, Shaimaa T; Kafafy, Hany; Gad-Allah, Tarek A; El-Kalliny, Amer S; Shaheen, Tharwat I
2018-07-01
Recently, naturally occurring biopolymers have attracted the attention as potential adsorbents for the removal of water contaminants. In this work, we present the development of microcrystalline cellulose (MCC)-based nanogel grafted with acrylamide and acrylic acid in the presence of methylene bisacrylamide and potassium persulphate as a crosslinking agent and initiator, respectively. World-class facilities such as X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FT-IR), surface analysis, field emission scanning electron microscopy (FE-SEM), high resolution transmission electron microscopy (HR-TEM) and zeta sizer were used to characterize the synthesized MCC based nanogel. The prepared nanogel was applied to remove reactive red 195 (RR195) dye and Cd (II) from aqueous medium at different operational conditions. The adsorption experiments showed that the feed concentration of monomers has a significant effect on the removal of RR195 which peaked (93% removal) after 10min of contact time at pH2 and a dose of 1.5g/L. On contrary, the feed concentration has insignificant effect on the removal of Cd (II) which peaked (97% removal) after 30min of contact time at pH6 and a dose of 0.5g/L. The adsorption equilibrium data of RR195 and Cd (II) was best described by Freundlich and Langmuir, respectively. Conclusively, the prepared MCC based nanogels were proved as promising adsorbents for the removal of organic pollutants as well as heavy metals. Copyright © 2018 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
De Barros, S M [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1966-04-01
The assignment of spins has been made for 120 levels of 239 detected. From these data we have deduced that: - The ratio of average spacing of each state of spin obeys the law of 2 J + 1. - The values of the strength function of {sup 195}Pt and {sup 169}Tm are in agreement with the model of Chase et Al and has the same values for the two states of spin. - The fluctuations of total radiation widths of resonances are observed in the case of {sup 195}Pt for the two spin-states. - The neutron widths are governed by the distributions of Porter and Thomas with one degree of freedom; the observed spacings are consistent with the Wigner distribution for two populations. (author) [French] L'attribution de spin a ete faite pour 120 niveaux sur 239 detectes. On en deduit: - Le rapport des espacements moyens pour chaque etat de spin qui obeit a la loi en (2j + 1). - Les valeurs des fonctions densites de {sup 195}Pt et {sup 169}Tm sont en accord avec le modele du noyau deforme de Chase et al. et ont la meme valeur pour les deux etats de spin. - Des fluctuations, dans les largeurs radiatives totales des resonances sont observees dans le cas de {sup 195}Pt pour les deux etats de spin. - Les largeurs de diffusion suivent les distributions de Porter et Thomas a un degre de liberte; les espacements celles de Wigner a deux populations. (auteur)
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ALPRGTFTAVMGPSGSGKSTFLQCAAGLDRPSAGS 60 ... Query: 136 DVLAQVGLADKARRRPGELSGGQQQRVAVARALVTAPDVIFADEPTGALDTGTAAEV...LGL 195 ... DVLAQVGLADKARRRPGELSGGQQQRVAVARALVTAPDVIFADEPTGALDTGTAAEVLGL Sbjct: 121 DVLAQVGLADKARRRPGELSGGQQQRVAVARALVTAPDVIFADEPTGALDTGTAAEVLGL 180 ...
ORF Alignment: NC_003062 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 57 ... Query: 139 KGEKTEVPENPMSADRVRWEHIQRVYEMCERNVSETARRLNMHRRTLQRILAKRAPK 195 ... KGEK...TEVPENPMSADRVRWEHIQRVYEMCERNVSETARRLNMHRRTLQRILAKRAPK Sbjct: 1 ... KGEKTEVPENPMSADRVRWEHIQRVYEMCERNVSETARRLNMHRRTLQRILAKRAPK 57
ORF Alignment: NC_003304 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 57 ... Query: 139 KGEKTEVPENPMSADRVRWEHIQRVYEMCERNVSETARRLNMHRRTLQRILAKRAPK 195 ... KGEK...TEVPENPMSADRVRWEHIQRVYEMCERNVSETARRLNMHRRTLQRILAKRAPK Sbjct: 1 ... KGEKTEVPENPMSADRVRWEHIQRVYEMCERNVSETARRLNMHRRTLQRILAKRAPK 57
ORF Alignment: NC_002936 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 195] ... Length = 180 ... Query: 32 ... TPFEMLVATILSAQSTDKMINKITPALFKKYPGVQAFADASLAELEQDIKSSGFFHNKAL 91 ... TPFEM...LVATILSAQSTDKMINKITPALFKKYPGVQAFADASLAELEQDIKSSGFFHNKAL Sbjct: 1 ... TPFEM
ORF Alignment: NC_004557 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available INKDIIKRRSGYNIEIKKVLVKDINKKRDLKIPEDLITTDVDEILEDPSIDIVVE 75 ... Query: 139 IHGLTESLTANKINEVIGIINGTTNYILTKMTLDGLSFEEALKEAQQKGYAEADPTSD...IE 198 ... IHGLTESLTANKINEVIGIINGTTNYILTKMTLDGLSFEEALKEAQQKGYAEADPTSDIE Sbjct: 136 IHGLTESLTANKINEVIGIINGTTNYILTKMTLDGLSFEEALKEAQQKGYAEADPTSDIE 195 ...
Dynamic response of physisorbed hydrogen molecules on lanthanide-modified zirconia nanoparticles
International Nuclear Information System (INIS)
Loong, C.K.; Trouw, F.; Ozawa, Masakuni; Suzuki, Suguru
1997-01-01
Ultrafine lanthanide (Ln = Ce and Nd)-modified zirconia powders synthesized by a coprecipitation method exhibit high surface areas and adsorption sites that are essential for catalytic applications. We report a study of the surface chemistry of Ce 0.1 Zr 0.9 O 2 and Nd 0.1 Zr 0.9 O 1.95 powders. First, the specific surface area and porosity are characterized by nitrogen isotherm-adsorption measurements. Second, the motion of hydrogen molecules physisorbed on Ce- and Nd-doped zirconias is studied by inelastic neutron scattering. Nitrogen adsorption-desorption isotherm measurements yield a BET surface area (26.1 m 2 /g) and mesopore size (∼5 nm radius) in Ce 0.1 Zr 0.9 O 2 as compared to those (72.3 m 2 /g and ∼3 nm) in Nd 0.1 Zr 0.9 O 1.95 . The vibrational densities of states of H 2 on Ce 0.1 Zr 0.9 O 2 and Nd 0.1 Zr 0.9 O 1.95 were measured at 20 K over the 0-200 meV energy range for three hydrogen coverage. The spectra for both samples consist of two parts: a sharp peak at ∼14.5 meV and a broad component extending beyond 200 meV. The sharp peak corresponds to transitions from the J=0 to J=1 rotational states of bulk hydrogen molecules, and its intensity decreases with decreasing H 2 coverage. The broad component corresponds to overdamped motion of surface adsorbed hydrogen molecules. The major difference in the latter component between the Ce- and Nd-doped samples is an excess of intensities in the 5-14 meV region in Nd 0.1 Zr 0.9 O 1.95 . The confined motion of adsorbed H 2 on the different micropore and mesopore surfaces of Ce 0.1 Zr 0.9 O 2 and Nd 0.1 Zr 0.9 O 1.95 is discussed
Directory of Open Access Journals (Sweden)
K. Kamala Bharathi
2012-03-01
Full Text Available The structure and electrical characteristics of Gd doped Ni ferrite materials, namely NiFe1.95Gd0.05O4 and NiFe1.925Gd0.075O4, are reported to demonstrate their improved electrical properties compared to that of pure NiFe2O4. NiFe1.95Gd0.05O4 and NiFe1.925Gd0.075O4 compounds crystallize in the cubic inverse spinel phase with a very small amount of GdFeO3 additional phase while pure NiFe2O4 crystallize in inverse spinel phase without any impurity phase. The back scattered electron imaging analysis indicate the primary and secondary formation in NiFe1.95Gd0.05O4 and NiFe1.925Gd0.075O4 compounds. Atomic force microscopy measurements indicate that the bulk grains are ∼2-5 micron size while the grain boundaries are thin compared to bulk grains. Impedance spectroscopic analysis at different temperature indicates the different relaxation mechanisms and their variation with temperature, bulk grain and grain-boundary contributions to the electrical conductivity (Rg and capacitance (Cg of these materials. The conductivity in pure NiFeO4 is found to be predominantly due to intrinsic bulk contribution (Rg=213 kΩ and Cg=4.5 x 10-8 F. In the case of NiFe1.95Gd0.05O4 and NiFe1.925Gd0.075O4 compounds, grain and grain-boundary contributions to the conductivity are clearly observed. The DC conductivity values (at 300 K of NiFe2O4, NiFe1.95Gd0.05O4 and NiFe1.925Gd0.075O4 compounds are found to be 1.06 x 10-7 Ω-1 cm-1, 5.73 x 10-8 Ω-1 cm-1 and 1.28 x 10-8 Ω-1 cm-1 respectively.
Energy Technology Data Exchange (ETDEWEB)
Nestor, Marika, E-mail: marika.nestor@bms.uu.s [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden); Sundstroem, Magnus [Unit of Molecular Pathology, Department of Genetics and Pathology, Uppsala University (Sweden); Anniko, Matti [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden)
2011-01-15
Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ({sup 211}At-cMAb U36). Effects on {sup 211}At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with {sup 211}At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced {sup 211}At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.
International Nuclear Information System (INIS)
Adelstein, S.J.; Zalutsky, M.; Bloomer, W.
1981-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131 I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211 At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211 At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated
Energy Technology Data Exchange (ETDEWEB)
Adelstein, S.J.; Zalutsky, M.; Bloomer, W.
1981-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.
International Nuclear Information System (INIS)
Nestor, Marika; Sundstroem, Magnus; Anniko, Matti; Tolmachev, Vladimir
2011-01-01
Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ( 211 At-cMAb U36). Effects on 211 At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211 At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211 At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.
Proceedings of transuranium elements
International Nuclear Information System (INIS)
Anon.
1992-01-01
The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium
Incidence of death from congenital toxoplasmosis in 0-4-year-old children in Japan.
Hoshino, Tatsuji; Kita, Masato; Imai, Yukihiro; Yamakawa, Masaru
2014-08-01
Congenital toxoplasmosis is caused by Toxoplasma gondii. The incidence of death due to congenital toxoplasmosis in Japan from 1974 to 2007 was calculated using the autopsy database of the Japanese Society of Pathology and vital statistics from the Ministry of Health, Labour and Welfare. Two neonatal deaths due to congenital toxoplasmosis were reported during that time. As there were 161,195 neonatal deaths during this period and 32,465 autopsies were performed, the yearly neonatal death from congenital toxoplasmosis was calculated as 2 × 161,195/32,465/34 = 0.29 and the autopsy rate as 32,465/161,195 = 0.2014 (20.14%). The calculated number of annual deaths in infants was 0.82 and in children aged 1-4 years it was 2.09; thus, although few, deaths from congenital toxoplasmosis do still occur in neonates, infants, and young children. Therefore, obstetricians and pediatricians should be aware of the potential for congenital toxoplasmosis, and pregnant women should make every effort to avoid T. gondii infection. © 2014 Japan Pediatric Society.
VizieR Online Data Catalog: Mid-infrared-X-ray correlation for local AGNs (Asmus+, 2015)
Asmus, D.; Gandhi, P.; Honig, S. F.; Smette, A.; Duschl, W. J.
2018-01-01
We start with the total sample from the AGN MIR atlas of 253 objects (Asmus et al. 2014, J/MNRAS/439/1648). Note that sample is a combination of a hard X-ray (14-195 keV) selected and a quasi-MIR selected sample as explained in Asmus et al. (2014, J/MNRAS/439/1648). The MIR continuum fluxes are the unresolved nuclear fluxes extracted from ground-based multifilter photometry obtained with the instruments VISIR (Lagage et al. 2004Msngr.117...12L), T-ReCS (Telesco et al. 1998SPIE.3354..534T), Michelle (Glasse, Atad-Ettedgui & Harris 1997SPIE.2871.1197G), and COMICS; (Kataza et al. 2000SPIE.4008.1144K). We collect observed 14-195 keV fluxes, Fobs(14-195 keV), measured with Swift/BAT (Burst Alert Telescope) by combining the data of the 54 and 70 month source catalogues with preference for the latter (Cusumano et al. 2010, J/A+A/524/A64; Baumgartner et al. 2013, J/ApJS/207/19). (2 data files).
ORF Alignment: NC_003197 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available LPRRGGDIELQQQSVNVGGCALNIAVALKRLGIDASNALPLGQGVWAERIRRRLAKEG 75 ... Query: 154 ASSCGEPLIQWLETVDDVTPFIDFGPRIGDITDDAMARIMA...CRPIVSLNRQEAIIAAERA 213 ... ASSCGEPLIQWLETVDDVTPFIDFGPRIGDITDDAMARIMACRPIVSLNRQEAIIAAERA Sbjct...: 136 ASSCGEPLIQWLETVDDVTPFIDFGPRIGDITDDAMARIMACRPIVSLNRQEAIIAAERA 195 ... Query: 27
Directory of Open Access Journals (Sweden)
Silvia Narikawa
2007-02-01
Full Text Available OBJETIVO: Avaliar a presença de alterações dos cílios em portadores de cavidade anoftálmica. MÉTODOS: Estudo observacional, procurando alterações ciliares em portadores de cavidade anoftálmica, atendidos na Faculdade de Medicina de Botucatu. RESULTADOS: Alterações dos cílios foram observadas em 70,7% dos portadores de cavidade anoftálmica. As alterações mais encontradas foram a ptose dos cílios (24,4%, diminuição do número (19,5%, tricomegalia (19,5%, triquíase (14,6% e entrópio (17,0%. CONCLUSÃO: Os portadores de cavidade anoftálmica possuem alterações ciliares, sendo as mais observadas: ptose de cílios, redução do número, tricomegalia e triquíase. O fator que leva a estas alterações necessita de maiores investigações.PURPOSE: To evaluate the eyelash alterations in anophthalmic cavity patients. METHODS: An observational study was done looking for eyelash alterations in anophthalmic cavity patients at "Faculdade de Medicina de Botucatu". RESULTS: Eyelash alterations were observed in 70.7% of the anophthalmic patients. The most frequently observed eyelash alterations were eyelash ptosis (24.4%, reduction in the quantity (19.5%, trichomegaly (19.5%, trichiasis (14.6% and entropium (17.0%. CONCLUSION: The anophthalmic cavity patients have eyelash alteration and ptosis, reduction in quantity, trichomegaly, trichiasis are the most common observed situations. Further studies are needed to know more about it.
Santos-Concejero, J; Granados, C; Irazusta, J; Bidaurrazaga-Letona, I; Zabala-Lili, J; Tam, N; Gil, S M
2013-09-01
The purpose of this study was to investigate the relationship between biomechanical variables and running economy in North African and European runners. Eight North African and 13 European male runners of the same athletic level ran 4-minute stages on a treadmill at varying set velocities. During the test, biomechanical variables such as ground contact time, swing time, stride length, stride frequency, stride angle and the different sub-phases of ground contact were recorded using an optical measurement system. Additionally, oxygen uptake was measured to calculate running economy. The European runners were more economical than the North African runners at 19.5 km · h(-1), presented lower ground contact time at 18 km · h(-1) and 19.5 km · h(-1) and experienced later propulsion sub-phase at 10.5 km · h(-1),12 km · h(-1), 15 km · h(-1), 16.5 km · h(-1) and 19.5 km · h(-1) than the European runners (P Running economy at 19.5 km · h(-1) was negatively correlated with swing time (r = -0.53) and stride angle (r = -0.52), whereas it was positively correlated with ground contact time (r = 0.53). Within the constraints of extrapolating these findings, the less efficient running economy in North African runners may imply that their outstanding performance at international athletic events appears not to be linked to running efficiency. Further, the differences in metabolic demand seem to be associated with differing biomechanical characteristics during ground contact, including longer contact times.
Ning, Nian-Zhi; Liu, Xiong; Bao, Chun-Mei; Chen, Su-Ming; Cui, En-Bo; Zhang, Ju-Ling; Huang, Jie; Chen, Fang-Hong; Li, Tao; Qu, Fen; Wang, Hui
2017-01-05
Carbapenem-resistant Acinetobacter baumannii poses a significant threat to hospitalized patients, as few therapeutic options remain. Thus, we investigated the molecular epidemiology and mechanism of resistance of carbapenem-resistant A.baumannii isolates in Beijing, China. Carbapenem-resistant A.baumannii isolates (n = 101) obtained between June 2009 and November 2014 were used. Multilocus sequence typing (MLST) and PCR assays for class C and D β-lactamase were performed on all isolates. S1 nuclease pulsed-field gel electrophoresis (PFGE) and Southern blot hybridization were performed to identify the resistance gene location. All 101 A.baumannii isolates were highly resistant to frequently used antimicrobials, and were considered multidrug resistant. A total of 12 sequence types (STs) were identified, including 10 reported STs and 2 novel STs. Eighty-seven isolates were classified to clonal complex 92 (CC92), among which ST191 and ST195 were the most common STs. The bla OXA-23 gene was positive in most (n = 95) of the A.baumannii isolates. Using S1-nuclease digestion PFGE and Southern blot hybridization, 3 patterns of plasmids carrying bla OXA-23 were confirmed. ST191 and ST195 (both harboring bla OXA-23 ) caused outbreaks during the study period, and this is the first report of outbreaks caused by ST191 and ST195 in north China. bla OXA-23 -producing A.baumannii ST191 and ST 195 isolates can disseminate in a hospital and are potential nosocomial outbreak strains. Surveillance of imipenem-resistant A.baumannii and antimicrobial stewardship should be strengthened.
Song, X; Kim, S-Y; Zhou, Z; Lagasse, E; Kwon, Y T; Lee, Y J
2013-04-04
Colorectal cancer is the third leading cause of cancer-related mortality in the world; the main cause of death of colorectal cancer is hepatic metastases, which can be treated with hyperthermia using isolated hepatic perfusion (IHP). In this study, we report that mild hyperthermia potently reduced cellular FLIP(long), (c-FLIP(L)), a major regulator of the death receptor (DR) pathway of apoptosis, thereby enhancing humanized anti-DR4 antibody mapatumumab (Mapa)-mediated mitochondria-independent apoptosis. We observed that overexpression of c-FLIP(L) in CX-1 cells abrogated the synergistic effect of Mapa and hyperthermia, whereas silencing of c-FLIP in CX-1 cells enhanced Mapa-induced apoptosis. Hyperthermia altered c-FLIP(L) protein stability without concomitant reductions in FLIP mRNA. Ubiquitination of c-FLIP(L) was increased by hyperthermia, and proteasome inhibitor MG132 prevented heat-induced downregulation of c-FLIP(L). These results suggest the involvement of the ubiquitin-proteasome system in this process. We also found lysine residue 195 (K195) to be essential for c-FLIP(L) ubiquitination and proteolysis, as mutant c-FLIP(L) lysine 195 arginine (arginine replacing lysine) was left virtually un-ubiquitinated and was refractory to hyperthermia-triggered degradation, and thus partially blocked the synergistic effect of Mapa and hyperthermia. Our observations reveal that hyperthermia transiently reduced c-FLIP(L) by proteolysis linked to K195 ubiquitination, which contributed to the synergistic effect between Mapa and hyperthermia. This study supports the application of hyperthermia combined with other regimens to treat colorectal hepatic metastases.
ORF Alignment: NC_006511 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available TLPRRGGDIELQQQSVNVGGCALNIAVALKQLGIDASNALPLGQGVWAERIRRRLAKEG 75 ... Query: 154 ASSCGEPMIQWLETVDDVTPFIDFGPRIGDITDDVMARIMA...CRPIVSLNRQEAIIAAERA 213 ... ASSCGEPMIQWLETVDDVTPFIDFGPRIGDITDDVMARIMA...CRPIVSLNRQEAIIAAERA Sbjct: 136 ASSCGEPMIQWLETVDDVTPFIDFGPRIGDITDDVMARIMACRPIVSLNRQEAIIAAERA 195 ... Query: 2
Electrochemical Removal of NOx-Gasses by Use of LSM-Cathodes Impregnated with a NOx Storage Compound
DEFF Research Database (Denmark)
Traulsen, Marie Lund; Kammer Hansen, Kent
2010-01-01
Electrochemical decomposition of NO on La0.85Sr0.15MnO3-- Ce0.90Gd0.10O1.95electrodes with and without KNO3 impregnation is investigated. The KNO3 is added as this compound is expected to work as a NOx-storage compound. Measurements are made in the temperature range 300-400 degree C and in three...... in the NO-conversion, when KNO3 is added to the La0.85Sr0.15MnO3-- Ce0.90Gd0.10O1.95electrodes. ©2010 COPYRIGHT ECS - The Electrochemical Society...
Cermets Ni-GDC para su uso como ánodos en IT-SOFC basadas en electrolitos GDC
Directory of Open Access Journals (Sweden)
Gil, V.
2008-08-01
Full Text Available The purpose of this work is to investigate the possible solid state reactions between the NiO-Ce0.9Gd0.1O1.95 (NiO-GDC composites with 50% wt NiO, and cermets Ni- Ce0.9Gd0.1O1.95 (Ni-GDC with 39 vol. % of Ni, and electrolyte solid solutions based on Ce0.9Gd0.1O1.95 (GDC employing the X-ray diffraction technique. At the same time the thermochemical and thermomechanical compatibility between these materials was established. Results obtained from SEM and EDAX analysis showed that the electrolyte based on ceria (GDC and the anode based on nickel-ceria cermet (Ni-GDC present good adhesion and well defined interfaces. No reactive phases and other type of defects were detected. This study showed that both materials, Ni-GDC and GDC are thermochemical and thermomechanically compatible.
El objetivo de este trabajo es estudiar en un amplio rango de temperaturas (1000-1450ºC y mediante difracción de rayos-X (DRX las posibles reacciones en estado sólido que pueden tener lugar en las regiones interfaciales de sistemas constituidos por composites NiO-Ce0.9Gd0.1O1.95 (NiO-GDC con un 50% en peso de NiO, y de Cermets Ni-Ce0.9Gd0.1O1.95 (Ni-GDC con un 39% en volumen Ni, y electrolitos basados en soluciones sólidas Ce0.9Gd0.1O1.95 (GDC. Y así mismo, estudiar la compatibilidad termoquímica y termomecánica entre los distintos materiales cerámicos que constituyen los sistemas electrolito/ánodo. Se confirma mediante MEB y análisis EDAX que los sistemas cosinterizados entre 1350 y 1400ºC durante 2h y constituidos por un electrolito basado en ceria (GDC y un ánodo basado en un cermet níquel-ceria (Ni-GDC, presentan una buena adherencia entre capas, sin la formación de defectos y sin la presencia de interdifusión de especies a lo
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... palustris CGA009] ... Length = 77 ... Query: 195 NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDS...MMKTARPPP 254 ... NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDSMMKTA...RPPP Sbjct: 1 ... NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDSMMKTARPPP 60 ...
ORF Alignment: NC_000913 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available DMSLNFSAFSDVLSP Sbjct: 1 ... PFKILFLADLHYSRFVPLSLISDAIALGIEQKPDLILLGGDYVLFDMSLNFSAFSDVLSP 60 ... Query: 145 WAGQCKPPPASEAN...LPRLVLAHNPDSKEVMRDEPWDLMLCGHTHGGQLRVP 195 ... WAGQCKPPPASEANLPRLV...LAHNPDSKEVMRDEPWDLMLCGHTHGGQLRVP Sbjct: 121 WAGQCKPPPASEANLPRLVLAHNPDSKEVMRDEPWDLMLCGHTHGGQLRVP 171
49 CFR 195.132 - Design and construction of aboveground breakout tanks.
2010-10-01
...) or more of liquefied petroleum gas (LPG) must be designed and constructed in accordance with API... constructed in accordance with API Standard 650. (4) High pressure steel tanks (i.e., internal gas or vapor...
Understanding the New Right and Its Impact on Education. Fastback 195.
Kincheloe, Joe L.
The Kanawha County textbook controversy of 1974 sparked profound changes in the American political landscape and American education. The roots of this controversy go back to the 1960's, when drug use, women's liberation, violence, and sex education convinced conservatives that America was in moral decline. Parents in Kanawha County fingered school…
195 Immigration Et Crise D'identite Dans L'Univers Romanesque De ...
African Journals Online (AJOL)
Tracie1
pour démontrer comment le jeune romancier togolais a abordé le ... deux mondes appartenant ni à l'un ni à l'autre. L'exile y est ..... m'a déjà été donné de visiter ailleurs dans le monde. Ces lieux qui sont comme les ventres des océans. Entrer dedans en explorateur, prendre tout son temps, avoir la patience nécessaire ...
People and things. CERN Courier, Jul-Aug 1979, v. 19(5)
International Nuclear Information System (INIS)
Anon.
1979-01-01
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events, for example the Polarized Target Material Workshop. This Workshop will be concerned with the chemical and physical processes involved in the preparation and use of polarized target materials with particular reference to the possibility of developing new materials with both a higher hydrogen content and a greater resistance to radiation damage than those currently available. On 23 June CERN's 25th Anniversary Ceremony took place on the CERN site in the presence of Ministers and other important personalities from the Member States, representatives of local authorities and distinguished friends of CERN
Asie du sud | Page 195 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
E-commerce in Asia has been receiving considerable attention as a result of the ... social, methodological, and security issues related to this emerging business ... the state-of-practice and trends in information and communication technologies ...
: tous les projets | Page 195 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Programme: Food, Environment, and Health. Financement total : CA$ 2,411,000.00. Changements climatiques, vulnérabilité et santé en Colombie et en Bolivie. Projet. Selon le quatrième rapport d'évaluation du Groupe d'experts intergouvernemental sur l'évolution du climat, les changements climatiques modifient les ...
Multilevel criticality computations in AREVA NP'S core simulation code artemis - 195
International Nuclear Information System (INIS)
Van Geemert, R.
2010-01-01
This paper discusses the multi-level critical boron iteration approach that is applied per default in AREVA NP's whole-core neutronics and thermal hydraulics core simulation program ARTEMIS. This multi-level approach is characterized by the projection of variational boron concentration adjustments to the coarser mesh levels in a multi-level re-balancing hierarchy that is associated with the nodal flux equations to be solved in steady-state core simulation. At each individual re-balancing mesh level, optimized variational criticality tuning formulas are applied. The latter drive the core model to a numerically highly accurate self-sustaining state (i.e. with the neutronic eigenvalue being 1 up to a very high numerical precision) by continuous adjustment of the boron concentration as a system-wide scalar criticality parameter. Due to the default application of this approach in ARTEMIS reactor cycle simulations, an accuracy of all critical boron concentration estimates better than 0.001 ppm is enabled for all burnup time steps in a computationally efficient way. This high accuracy is relevant for precision optimization in industrial core simulation as well as for enabling accurate reactivity perturbation assessments. The developed approach is presented from a numerical methodology point of view with an emphasis on the multi-grid aspect of the concept. Furthermore, an application-relevant verification is presented in terms of achieved coupled iteration convergence efficiency for an application-representative industrial core cycle computation. (authors)
People and things. CERN Courier, Jul-Aug 1979, v. 19(5)
Energy Technology Data Exchange (ETDEWEB)
Anon.
1979-07-15
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events, for example the Polarized Target Material Workshop. This Workshop will be concerned with the chemical and physical processes involved in the preparation and use of polarized target materials with particular reference to the possibility of developing new materials with both a higher hydrogen content and a greater resistance to radiation damage than those currently available. On 23 June CERN's 25th Anniversary Ceremony took place on the CERN site in the presence of Ministers and other important personalities from the Member States, representatives of local authorities and distinguished friends of CERN.
21 CFR 1.95 - Application for authorization to relabel and recondition.
2010-04-01
... to relabel and recondition. Application for authorization to relabel or perform other action to bring the article into compliance with the act or to render it other than a food, drug, device or cosmetic may be filed only by the owner or consignee, and shall: (a) Contain detailed proposals for bringing...
36 CFR 223.195 - Procedures for identifying and marking unprocessed timber.
2010-07-01
... procedures required herein. (f) Waiver of branding requirements. Regional Foresters may waive the branding... individual timber sale basis, all or a portion of the branding requirements pursuant to paragraph (c)(2) of...) Regions 5 and 6. On an individual timber sale basis, the branding requirement pursuant to paragraph (c)(2...
Atmospheric CO2 concentration effects on rice water use and biomass production.
Directory of Open Access Journals (Sweden)
Uttam Kumar
Full Text Available Numerous studies have addressed effects of rising atmospheric CO2 concentration on rice biomass production and yield but effects on crop water use are less well understood. Irrigated rice evapotranspiration (ET is composed of floodwater evaporation and canopy transpiration. Crop coefficient Kc (ET over potential ET, or ETo is crop specific according to FAO, but may decrease as CO2 concentration rises. A sunlit growth chamber experiment was conducted in the Philippines, exposing 1.44-m2 canopies of IR72 rice to four constant CO2 levels (195, 390, 780 and 1560 ppmv. Crop geometry and management emulated field conditions. In two wet (WS and two dry (DS seasons, final aboveground dry weight (agdw was measured. At 390 ppmv [CO2] (current ambient level, agdw averaged 1744 g m-2, similar to field although solar radiation was only 61% of ambient. Reduction to 195 ppmv [CO2] reduced agdw to 56±5% (SE, increase to 780 ppmv increased agdw to 128±8%, and 1560 ppmv increased agdw to 142±5%. In 2013WS, crop ET was measured by weighing the water extracted daily from the chambers by the air conditioners controlling air humidity. Chamber ETo was calculated according to FAO and empirically corrected via observed pan evaporation in chamber vs. field. For 390 ppmv [CO2], Kc was about 1 during crop establishment but increased to about 3 at flowering. 195 ppmv CO2 reduced Kc, 780 ppmv increased it, but at 1560 ppmv it declined. Whole-season crop water use was 564 mm (195 ppmv, 719 mm (390 ppmv, 928 mm (780 ppmv and 803 mm (1560 ppmv. With increasing [CO2], crop water use efficiency (WUE gradually increased from 1.59 g kg-1 (195 ppmv to 2.88 g kg-1 (1560 ppmv. Transpiration efficiency (TE measured on flag leaves responded more strongly to [CO2] than WUE. Responses of some morphological traits are also reported. In conclusion, increased CO2 promotes biomass more than water use of irrigated rice, causing increased WUE, but it does not help saving water. Comparability
International Nuclear Information System (INIS)
Li, Zhimin; Mori, Toshiyuki; Yan, Pengfei; Wu, Yuanyuan; Li, ZhiPeng
2012-01-01
Highlights: ► Gd 0.1 Ce 0.9 O 1.95 electrolyte had less density of oxygen vacancies ordering. ► Gd 0.2 Ce 0.8 O 1.9 fuel cell showed better performance than Gd 0.1 Ce 0.9 O 1.95 . ► The relationship between microstructures and performance for cells were discussed. ► Gd 0.2 Ce 0.8 O 1.9 electrolyte with higher grain boundary conductivity was concluded. - Abstract: In this work, the effect of two frequently used Gd x Ce 1−x O 2−x/2 electrolytes (x = 0.1 and x = 0.2) on the performance of fuel cells operated at intermediate temperature was studied. The microstructures of ceria electrolytes responsible for the performance were discussed. Electrochemical measurements of as-prepared cells showed that the cell with Gd 0.2 Ce 0.8 O 1.9 electrolyte had a better performance than that of Gd 0.1 Ce 0.9 O 1.95 . It can be concluded that the increase of grain boundary conductivity of Gd 0.2 Ce 0.8 O 1.9 electrolyte contributes to its better cell performance.
ORF Alignment: NC_004331 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available rase, ... putative [Plasmodium falciparum 3D7] ... Length = 195 ... Query: 71 ... YRSRAAYKLIELDNKYLFLKKNKIILDIGCYPGSWCQVILER...TKNYKNKIIGIDKKIMDP 130 ... YRSRAAYKLIELDNKYLFLKKNKIILDIGCYPGSWCQVILER...TKNYKNKIIGIDKKIMDP Sbjct: 1 ... YRSRAAYKLIELDNKYLFLKKNKIILDIGCYPGSWCQVILERTKNYKNKIIGIDKKIMD
Protein (Cyanobacteria): 653003418 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available WP_027255601.1 ... 1117:6743 ... 1150:53326 1301283:74640 ... 54304:943 1160:195 ... hypothetical protein Plankt...othrix agardhii MVQILNKTLSLEDFLNLPETKPANEYINGQIIQKPMPQGKHSKLQGKLVTVINNMAEEQAIALALPELRC
ORF Alignment: NC_005070 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available onse ... regulator [Synechococcus sp. WH 8102] ... Length = 90 ... Query: 136 YIDPVIAGVLRHSRLSRGHTST...SLNPELTVREEDVLRGICRGLSNQEIADQLNLSIETVK 195 ... YIDPVIAGVLRHSRLSRGHTSTSL...NPELTVREEDVLRGICRGLSNQEIADQLNLSIETVK Sbjct: 1 ... YIDPVIAGVLRHSRLSRGHTSTSLNPELTVREEDVLRGICRGLSNQEIADQLNLSIETVK 60 ...
International Nuclear Information System (INIS)
Leung, S.; Otmezguine, Y.; Calitchi, E.; Mazeron, J.J.; Le Bourgeois, J.P.; Pierquin, B.
1986-01-01
Locoregional recurrences are reported in 493 consecutive with T1 T2 N0 N1 breast cancer patients who were treated with radical external beam irradiation and interstitial 192 Ir implant between 1961 and 1979. Follow-up ranges from 5-23 years (mean 10 years) with 195 patients having 10-23 years follow up (mean 12 years). There were 51 (10%) locoregional recurrences with 34 mammary, 14 combined mammary/axillary and 3 isolated axillary recurrences. The 10 year relapse rate was 20/195 (10%). The results have been compared with other series in the literature and changes in the authors' current protocol are described. (Auth.)
Monoids of moduli spaces of manifolds
DEFF Research Database (Denmark)
Galatius, Søren; Randal-Williams, Oscar
2010-01-01
We study categories of d–dimensional cobordisms from the perspective of Tillmann [Invent. Math. 130 (1997) 257–275] and Galatius, Madsen, Tillman and Weiss [Acta Math. 202 (2009) 195–239]. There is a category C¿ of closed smooth (d - 1)–manifolds and smooth d–dimensional cobordisms, equipped...... with generalised orientations specified by a map ¿: X ¿ BO(d). The main result of [Acta Math. 202 (2009) 195–239] is a determination of the homotopy type of the classifying space BC¿. The goal of the present paper is a systematic investigation of subcategories D¿C¿ with the property that BD¿ BC¿, the smaller...
Enzymatic quantification of strand breaks of DNA induced by vacuum-UV radiation
International Nuclear Information System (INIS)
Ito, Takashi
1986-01-01
Hind3 digested plasmid DNA dried on an aluminum plate was irradiated by vacuum-UV at 160 and 195 nm using a synchrotron irradiation system. A change induced in the DNA, presumably a single strand break, was quantified by the aid of the strand break-derived stimulation of poly(ADP-ribose) synthetase activity. The end group of strand breaks so induced was recognized by the enzyme as effectively as that by DNase 1 treatment, suggesting a nicking as the major lesion inflicted on the DNA. The fluence (UV) dependent stimulation of poly(ADP-ribose) synthetase activity was much higher upon 160 nm irradiation than upon 195 nm irradiation. (Auth.)
ORF Alignment: NC_002689 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ylmutase [Thermoplasma volcanium GSS1] ... Length = 195 ... Query: 59 ... ARERYLFSKIVHAAGDFRLIDLIRMSPGFVDTV...AEKLRDGCRIVVDAKMVKAGIYNKNLL 118 ... ARERYLFSKIVHAAGDFRLIDLIRMSPGFVDTVAEKLRDGCRIVVDAKMVKAGIYNKNLL Sbjc...t: 23 ... ARERYLFSKIVHAAGDFRLIDLIRMSPGFVDTVAEKLRDGCRIVVDAKMVKAGIYNKNLL 82 ... Query: 17
Cancer therapy with alpha-emitters labeled peptides.
Dadachova, Ekaterina
2010-05-01
Actively targeted alpha-particles offer specific tumor cell killing action with less collateral damage to surrounding normal tissues than beta-emitters. During the last decade, radiolabeled peptides that bind to different receptors on the tumors have been investigated as potential therapeutic agents both in the preclinical and clinical settings. Advantages of radiolabeled peptides over antibodies include relatively straightforward chemical synthesis, versatility, easier radiolabeling, rapid clearance from the circulation, faster penetration and more uniform distribution into tissues, and less immunogenicity. Rapid internalization of the radiolabeled peptides with equally rapid re-expression of the cell surface target is a highly desirable property that enhances the total delivery of these radionuclides into malignant sites. Peptides, such as octreotide, alpha-melanocyte-stimulating hormone analogues, arginine-glycine-aspartic acid-containing peptides, bombesin derivatives, and others may all be feasible for use with alpha-emitters. The on-going preclinical work has primarily concentrated on octreotide and octreotate analogues labeled with Bismuth-213 and Astatine-211. In addition, alpha-melanocyte-stimulating hormone analogue has been labeled with Lead-212/Bismuth-212 in vivo generator and demonstrated the encouraging therapeutic efficacy in treatment of experimental melanoma. Obstacles that continue to obstruct widespread acceptance of alpha-emitter-labeled peptides are primarily the supply of these radionuclides and concerns about potential kidney toxicity. New sources and methods for production of these medically valuable radionuclides and better understanding of mechanisms related to the peptide renal uptake and clearance should speed up the introduction of alpha-emitter-labeled peptides into the clinic. Copyright 2010 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Demartis, S.; Tarli, L.; Neri, D.; Borsi, L.; Zardi, L.
2001-01-01
Angiogenesis is a characteristic feature of many aggressive tumours and other disorders. Antibodies capable of binding to new blood vessels, but not to mature vessels, could be used as selective targeting agents for immunoscintigraphic and radioimmunotherapeutic applications. Here we show that scFv(L19), a recombinant human antibody fragment with sub-nanomolar affinity for the ED-B domain of fibronectin, a marker of angiogenesis, can be stably labelled with iodine-125 and astatine-211 with full retention of immunoreactivity, using a trimethyl-stannyl benzoate bifunctional derivative. Biodistribution studies in mice bearing two different types of tumour grafted subcutaneously, followed by ex vivo micro-autoradiographic analysis, revealed that scFv(L19) rapidly localises around tumour blood vessels, but not around normal vessels. Four hours after intravenous injection of the stably radioiodinated scFv(L19), tumour to blood ratios were 6:1 in mice bearing the F9 murine teratocarcinoma and 9:1 in mice bearing an FE8 rat sarcoma. As expected, all other organs (including kidney) contained significantly less radioactivity than the tumour. Since the ED-B domain of fibronectin has an identical sequence in mouse and man, scFv(L19) is a pan-species antibody and the results presented here suggest clinical utility of radiolabelled scFv(L19) for the scintigraphic detection of angiogenesis in vivo. Furthermore, it should now be possible to investigate scFv(L19) for the selective delivery of 211 At to the tumour neovasculature, causing the selective death of tumour endothelial cells and tumour collapse. (orig.)
Directory of Open Access Journals (Sweden)
N. Bègue
2017-11-01
Full Text Available In this investigation a statistical analysis of the characteristics of mesospheric inversion layers (MILs over tropical regions is presented. This study involves the analysis of 16 years of lidar observations recorded at Réunion (20.8° S, 55.5° E and 21 years of lidar observations recorded at Mauna Loa (19.5° N, 155.6° W together with SABER observations at these two locations. MILs appear in 10 and 9.3 % of the observed temperature profiles recorded by Rayleigh lidar at Réunion and Mauna Loa, respectively. The parameters defining MILs show a semi-annual cycle over the two selected sites with maxima occurring near the equinoxes and minima occurring during the solstices. Over both sites, the maximum mean amplitude is observed in April and October, and this corresponds to a value greater than 35 K. According to lidar observations, the maximum and minimum mean of the base height ranged from 79 to 80.5 km and from 76 to 77.5 km, respectively. The MILs at Réunion appear on average ∼ 1 km thinner and ∼ 1 km lower, with an amplitude of ∼ 2 K higher than Mauna Loa. Generally, the statistical results for these two tropical locations as presented in this investigation are in fairly good agreement with previous studies. When compared to lidar measurements, on average SABER observations show MILs with greater amplitude, thickness and base altitudes of 4 K, 0.75 and 1.1 km, respectively. Taking into account the temperature error by SABER in the mesosphere, it can therefore be concluded that the measurements obtained from lidar and SABER observations are in significant agreement. The frequency spectrum analysis based on the lidar profiles and the 60-day averaged profile from SABER confirms the presence of the semi-annual oscillation where the magnitude maximum is found to coincide with the height range of the temperature inversion zone. This connection between increases in the semi-annual component close to the
Pan, Lung Fa; Kittipayak, Samrit; Yen, Shan Lin; Pan, Lung Kwang; Lin, Cheng Hsun
2016-01-01
The occupational X-rays doses of medical staff in a cardiac catheterization laboratory were evaluated. Four customized acrylic phantoms were used to simulate a patient, medical doctor, assistant, and radiologist to evaluate the in-situ X-rays exposure dose using semiconductor dosimeters. The exposure dose was measured under three scenarios that were preset to imply: no shielding, moderate shielding and complete shielding for the medical staff in the laboratory. The doses were applied by changing the dose area product (DAP) from 11,000 to 500,000mGy·cm(2) in 14 increments. The estimated annual occupational doses for doctors, assistants and radiologists in scenarios I, II, and III were: I) 35.03, 7.78, 1.95; II) 1.95, 0.78, 0.06; and III) 0.19, 0.10, 0.05cSv, respectively. The derived linear regression line of the exposure dose with respect to the DAP were extrapolated to obtain the minimum detectable level (MDL) of DAP for triggering the staff dosimeters. Accordingly, the minimum annual dose was estimated as 0.05cSv. Additional shielding provided measurable protection to the staff. The protective clothing used in scenarios II and III can reduce the original dose from scenario I to ∼3% (scenario II) and ∼0.5% (scenario III). The annual occupational dose also changed with the various X-rays energy settings. The annual dose increased to 126% when the preset X-rays energy was changed from 70 to 100kVp. The semiconductor dosimeter proved to be an adequate tool for measuring low doses and low dose rates under these circumstances. The dose can be reduce of I) 35.03, 7.78, 1.95; to II) 1.95, 0.78, 0.06 (∼3%); or III) 0.19, 0.10, 0.05 (∼0.5%)cSv, respectively according to different protective scenarios.
Weiss, Glen J; Donehower, Ross C; Iyengar, Tara; Ramanathan, Ramesh K; Lewandowski, Karen; Westin, Eric; Hurt, Karla; Hynes, Scott M; Anthony, Stephen P; McKane, Scott
2013-02-01
This phase I study aims at assessing the safety and tolerability of LY2603618, a selective inhibitor of Checkpoint Kinase 1, in combination with pemetrexed and determining the maximum tolerable dose and the pharmacokinetic parameters. This was an open-label, multicenter, dose-escalation study in patients with advanced solid tumors. Increasing doses of LY2603618 (40-195 mg/m(2)) were combined with 500 mg/m(2) of pemetrexed. LY2603618 was administered on Days 1 and 9 and pemetrexed on Day 8 in a 28-day cycle. For all subsequent 21-day cycles, pemetrexed was administered on Day 1 and LY2603618 on Day 2. Antitumor activity was evaluated as per Response Evaluation Criteria in Solid Tumors 1.0. A total of 31 patients were enrolled into six cohorts (three at 40 mg/m(2) over 4.5-hour infusion, 1-hour infusion in subsequent cohorts: three each at 40 mg/m(2), 70 mg/m(2), and 195 mg/m(2); 13 at 105 mg/m(2); six at 150 mg/m(2)). Four patients experienced a dose-limiting toxicity: diarrhea (105 mg/m(2)); reversible infusion-related reaction (150 mg/m(2)); thrombocytopenia (195 mg/m(2)); and fatigue (195 mg/m(2)). The maximum tolerated dose was defined as 150 mg/m(2). The pharmacokinetic data demonstrated that the exposure of LY2603618 increased in a dose-dependent manner, displayed a suitable half-life for maintaining required human exposures while minimizing the intra- and inter-cycle accumulation, and was unaffected by the pemetrexed administration. The pharmacokinetic-defined biologically efficacious dose was achieved at doses ≥105 mg/m(2). LY2603618 administered approximately 24 h after pemetrexed showed acceptable safety and pharmacokinetic profiles.
Directory of Open Access Journals (Sweden)
Huan Zhang
Full Text Available OBJECTIVES: Lung adenocarcinoma is considered a unique disease for Asian female non-smokers. We investigated whether plasma microRNA (miRNA expression profiles are different by the EGFR status and are associated with survival outcomes of the patients. METHODS: Using real-time RT-PCR, we analyzed the expression of 20 miRNAs in the plasma of 105 female patients with lung adenocarcinoma. Kaplan-Meier survival analysis and Cox proportional hazards regression were performed to determine the association between miRNA expression and overall survival. Time dependent receiver operating characteristic (ROC analysis was also performed. RESULTS: In the 20 miRNAs, miR-122 were found differently expressed between wild and mutant EGFR carriers (P=0.018. Advanced disease stage and tumor metastasis were independently associated with poor prognosis of patients with lung adenocarcinoma (P=0.010 and 1.0×10(-4. Plasma levels of miR-195 and miR-122 expression were also associated with overall survival in the patients, especially in those with advanced stage (HR=0.23, 95%CI:0.07-0.84; and HR=0.22, 95%CI:0.06-0.77 and EGFR mutation (HR=0.27, 95%CI:0.08-0.96; and HR=0.23, 95%CI=0.06-0.81. Moreover, a model including miR-195, miR-122 may predict survival outcomes of female patients with lung adenocarcinoma (AUC=0.707. CONCLUSIONS: Circulating miR-195 and miR-122 may have prognostic values in predicting the overall survival as well as predicting EGFR mutation status in non-smoking female patients with lung adenocarcinoma. Measuring plasma levels of miR-195 and miR-122 may especially be useful in EGFR mutant patients with lung adenocarcinoma.
International Nuclear Information System (INIS)
Ni Haimin; Luo Laihui; Li Weiping; Zhu Yuejin; Luo Haosu
2011-01-01
Research highlights: → Bi 0.47 Na 0.47 Ba 0.06 TiO 3 -KNbO 3 ceramics exhibit excellent piezoelectric properties. → The optimized properties of the ceramics: d 33 = 195 pC/N; k t = 58.9; Q m = 113; E c = 19.5 kV/cm. → KNbO 3 has diffused into the Bi 0.47 Na 0.47 Ba 0.06 TiO 3 lattices to form a new solid solution. → Macro-micro domain switching occurs at depolarization temperature T d . - Abstract: Lead-free (1 - x)Bi 0.47 Na 0.47 Ba 0.06 TiO 3 -xKNbO 3 (BNBT-xKN, x = 0-0.08) ceramics were prepared by ordinary ceramic sintering technique. The piezoelectric, dielectric and ferroelectric properties of the ceramics are investigated and discussed. The results of X-ray diffraction (XRD) indicate that KNbO 3 (KN) has diffused into Bi 0.47 Na 0.47 Ba 0.06 TiO 3 (BNBT) lattices to form a solid solution with a pure perovskite structure. Moderate additive of KN (x ≤ 0.02) in BNBT-xKN ceramics enhance their piezoelectric and ferroelectric properties. Three dielectric anomaly peaks are observed in BNBT-0.00KN, BNBT-0.01KN and BNBT-0.02KN ceramics. With the increment of KN in BNBT-xKN ceramics, the dielectric anomaly peaks shift to lower temperature. BNBT-0.01KN ceramic exhibits excellent piezoelectric properties and strong ferroelectricity: piezoelectric coefficient, d 33 = 195 pC/N; electromechanical coupling factor, k t = 58.9 and k p = 29.3%; mechanical quality factor, Q m = 113; remnant polarization, P r = 41.8 μC/cm 2 ; coercive field, E c = 19.5 kV/cm.
International Nuclear Information System (INIS)
1985-01-01
Amendments: 1) Section 2, sub-section (2), no. 1 - Cr-51, Fe-59, Ga-67, In-111, J-123, J-125, J-13, Co-57, Co-58, P-32, Se-75, Th-201, Xe-127, Xe-133; 2) Section 3, sub-section (2), no. 2 - Mo-99, Hg-195m, Rb-81, Su-113, Tc-99m, Au-195m, Kr-81m, In-113m; 3) Section 3a: The prohibitory provisions of section 7, sub-section (1) of the Medical Preparation Act do not apply to radioactive medical preparations which are drugs within the purview of section 2, sub-section (2), no. 4, item (a) of said act. (HP) [de
Energy Technology Data Exchange (ETDEWEB)
Mantovani, Milene; Mecawi, Andre S.; Elias, Lucila L.K.; Antunes-Rodrigues, Jose, E-mail: llelias@fmrp.usp.b, E-mail: antunes@fmrp.usp.b [Universidade de Sao Paulo (FMRP/USP), Ribeirao Preto, SP (Brazil). Faculdade de Medicina
2011-10-26
This paper standardizes the radioimmunoassay (RIA) for dosage of ANG-II of rats, after experimental conditions of saline hypertonic (2%), treating with losartan (antagonist of ANG-II), hydric privation, and acute hemorrhage (25%). After that, the plasmatic ANG-II was extracted for dosage of RIA, whose sensitiveness was of 1.95 pg/m L, with detection of 1.95 to 1000 pg/m L. The treatment with saline reduced the concentration of ANG-II, while the administration pf losartan, the hydric administration and the hemorrhage increase the values, related to the control group. Those results indicate variations in the plasmatic concentration of ANG-II according to the experimental protocols, validating the method for evaluation of activity renin-angiotensin
High Power 1443.5 nm Laser with Nd:YAG Single Crystal Fiber
Directory of Open Access Journals (Sweden)
Han Rao
2017-07-01
Full Text Available A high-power eye-safe 1443.5 nm laser was demonstrated with an Nd:YAG single crystal fiber (SCF as the gain medium. For continuous wave (CW operation, a maximum output power of 13.3 W was obtained under an absorbed pump power of 95.0 W, corresponding to an optical-to-optical conversion efficiency of 14.0%. For acousto-optically (AO Q-switched regime, an output power of 1.95 W was obtained at a pulse repetition frequency (PRF of 10 kHz. The pulse duration was 69.5 ns. The pulse energy and peak power were calculated to be 195 µJ and 2.81 kW, respectively.
International Nuclear Information System (INIS)
Mantovani, Milene; Mecawi, Andre S.; Elias, Lucila L.K.; Antunes-Rodrigues, Jose
2011-01-01
This paper standardizes the radioimmunoassay (RIA) for dosage of ANG-II of rats, after experimental conditions of saline hypertonic (2%), treating with losartan (antagonist of ANG-II), hydric privation, and acute hemorrhage (25%). After that, the plasmatic ANG-II was extracted for dosage of RIA, whose sensitiveness was of 1.95 pg/m L, with detection of 1.95 to 1000 pg/m L. The treatment with saline reduced the concentration of ANG-II, while the administration pf losartan, the hydric administration and the hemorrhage increase the values, related to the control group. Those results indicate variations in the plasmatic concentration of ANG-II according to the experimental protocols, validating the method for evaluation of activity renin-angiotensin
Directory of Open Access Journals (Sweden)
Myra Wilson Schuster
1989-12-01
Full Text Available Se estudiaron 82 pacientes con uretritis para la búsqueda de Chlamydia trachomatis mediante inmunofluorescencia directa, Neisscria gonorrhoeae, Mycoplastna y Ureaplasma mediante métodos estándar. Se encontró un 19,5% de Chlamydia trachomatis y en 11 de ellos (68,8% se encontró asociada a otras bacterias y estos pacientes presentó una secreción escasa-gelatinosa.Em 82 doentes com uretrite foi pesquisada a presença de Chlamydia trachomatis, utilizando a prova da imunofluorescência direta, e de Neisseria gonorrhoeae, Mycoplasma e Ureaplasma, utilizando os métodos padrões. Ch. trachomatis foi encontrada em 19,5% dos casos, sendo que em 11 deles (68,8% observou-se associação entre Chlamydia e as outras bactérias pesquisadas. Nesses pacientes observou-se presença de secreção uretral escassa e de aspecto gelatinoso.The presence of Chlamydia trachomatis was studied by the direct immunofluorescence test, as also was that of Neisseria gonorrhoeae, Mycoplasma and Ureaplasma by the standard methods, in 82 patients with urethral discharge. Ch. trachomatis was found in 19.5% (16 of the cases and in 11 of them (68.8% there was association with the other bacteria investigated. This eleven patients presented a scanty gelatinous discharge.
HUBUNGAN KOMPETENSI DAN DISIPLINAN KERJA DOSEN TERHADAP MOTIVASI BELAJAR MAHASISWA
Directory of Open Access Journals (Sweden)
Tahrir Tahrir
2018-02-01
Full Text Available Background this research from fenomena at Psychologycal Faculty of UIN Sunan Gunung Djati Bandung, that student motivation to learn is very low, for example: student present is small then 75%. Beside, 65% educational background lectures was not from pure psychology. According to student opinion there are much lectures from Psychology Faculty do not competence in their job matter. Research design is suvey and research method is causality because the research goal is know how streng effect one variable to an other variable. Total sampling are 100 students. Hypotetis test with Product Momant from Pearson because scale of data is interval. The result is Lecture Competence have possitive correlation and significant with Student Motivation to Learn with rxy value: 0.629, rtable 0.195, and p=0.000 (p<0.05. So Lecture Dicipline to Work have possitive correlation and significant with Student Motivation to Learn with rxy value: 0.755, rtable 0.195, and p=0.000 (p<0.05. So Lecture Competence and Dicipline to Work have possitive correlation and significant with Student Motivation to Learn with rxy value:0.762, rtable : 0.195, and p=0.000 (p<0.05, and is 58%
Lai, Yenjung; Becker, Jennifer G
2013-02-05
The development of rational and effective engineered bioremediation approaches for sites contaminated with chlorinated solvents requires a fundamental understanding of the factors limiting the in situ activity of dehalorespiring bacteria. Frequently, multiple dehalorespiring bacteria are present at contaminated sites, particularly when bioaugmentation is applied. The ecological interactions between different dehalorespiring populations can-along with hydrodynamic and other environmental factors-affect their activity and thus the rates and extent of dehalorespiration. An integrated experimental and modeling approach was used to evaluate the ecological interactions between two hydrogenotrophic, dehalorespiring strains. A dual Monod model of dehalorespiration provided a good fit to the chlorinated ethene concentrations measured in a coculture of Dehalococcoides mccartyi 195 and Dehalobacter restrictus growing on tetrachloroethene (PCE) and excess H(2) in a continuous-flow reactor. Inhibition of dehalorespiration by chlorinated ethenes was previously observed in cultures containing Dehalococcoides or Dehalobacter strains. Therefore, inhibition coefficients were estimated for Dhc. mccartyi 195 and Dhb. restrictus. The inhibition effects of PCE and TCE on VC dechlorination by Dhc. mccartyi 195, and of VC on PCE and TCE dechlorination by Dhb. restrictus, were compounded when these strains were grown in coculture, and dehalorespiring population abundance and survival could be accurately predicted only by incorporating these complex interactions into the dual Monod model.
Eimuntas Nekroshiuse teatripoeetika / Ruta Mazheikiene ; tõlk. Tiina Kattel
Mazheikiene, Ruta
2004-01-01
E. Nekroshiuse lavastustele iseloomulikest joontest, toetudes tema lavastustele "Hamlet" "Macbeth", "Othello", "Onu Vanja", "Nina". Samuti näitlejatega töötamise strateegiast. Kasut. kirjandus, lk. 194-195
2017-11-01
The Global Burden of Diseases, Injuries, and Risk Factors (GBD) Study 2015 provides an up-to-date analysis of the burden of lower respiratory tract infections (LRIs) in 195 countries. This study assesses cases, deaths, and aetiologies spanning the past 25 years and shows how the burden of LRI has changed in people of all ages. We estimated LRI mortality by age, sex, geography, and year using a modelling platform shared across most causes of death in the GBD 2015 study called the Cause of Death Ensemble model. We modelled LRI morbidity, including incidence and prevalence, using a meta-regression platform called DisMod-MR. We estimated aetiologies for LRI using two different counterfactual approaches, the first for viral pathogens, which incorporates the aetiology-specific risk of LRI and the prevalence of the aetiology in LRI episodes, and the second for bacterial pathogens, which uses a vaccine-probe approach. We used the Socio-demographic Index, which is a summary indicator derived from measures of income per capita, educational attainment, and fertility, to assess trends in LRI-related mortality. The two leading risk factors for LRI disability-adjusted life-years (DALYs), childhood undernutrition and air pollution, were used in a decomposition analysis to establish the relative contribution of changes in LRI DALYs. In 2015, we estimated that LRIs caused 2·74 million deaths (95% uncertainty interval [UI] 2·50 million to 2·86 million) and 103·0 million DALYs (95% UI 96·1 million to 109·1 million). LRIs have a disproportionate effect on children younger than 5 years, responsible for 704 000 deaths (95% UI 651 000-763 000) and 60.6 million DALYs (95ÙI 56·0-65·6). Between 2005 and 2015, the number of deaths due to LRI decreased by 36·9% (95% UI 31·6 to 42·0) in children younger than 5 years, and by 3·2% (95% UI -0·4 to 6·9) in all ages. Pneumococcal pneumonia caused 55·4% of LRI deaths in all ages, totalling 1 517 388 deaths (95% UI 857 940
Hindemith: Symphonic Metamorphosis on Themes of Carl Maria von Weber / Jonathan Swain
Swain, Jonathan
1990-01-01
Uuest heliplaadist "Hindemith: Symphonic Metamorphosis on Themes of Carl Maria von Weber, Mathis der Maler - Symphony, Nobilissima visione - suite. Atlanta Symphony Orchestra, Yoel Levi" Telarc/ Conifer CD 80 195
14 CFR 121.195 - Airplanes: Turbine engine powered: Landing limitations: Destination airports.
2010-01-01
... such a weight that (allowing for normal consumption of fuel and oil in flight to the destination or... weight on arrival, allowing for normal consumption of fuel and oil in flight (in accordance with the... a point 50 feet above the intersection of the obstruction clearance plane and the runway. For the...
SU-E-T-195: Gantry Angle Dependency of MLC Leaf Position Error
Energy Technology Data Exchange (ETDEWEB)
Ju, S; Hong, C; Kim, M; Chung, K; Kim, J; Han, Y; Ahn, S; Chung, S; Shin, E; Shin, J; Kim, H; Kim, D; Choi, D [Department of Radiation Oncology, Samsung Medical Center, Sungkyunkwan University School of Medicine, Seoul (Korea, Republic of)
2014-06-01
Purpose: The aim of this study was to investigate the gantry angle dependency of the multileaf collimator (MLC) leaf position error. Methods: An automatic MLC quality assurance system (AutoMLCQA) was developed to evaluate the gantry angle dependency of the MLC leaf position error using an electronic portal imaging device (EPID). To eliminate the EPID position error due to gantry rotation, we designed a reference maker (RM) that could be inserted into the wedge mount. After setting up the EPID, a reference image was taken of the RM using an open field. Next, an EPID-based picket-fence test (PFT) was performed without the RM. These procedures were repeated at every 45° intervals of the gantry angle. A total of eight reference images and PFT image sets were analyzed using in-house software. The average MLC leaf position error was calculated at five pickets (-10, -5, 0, 5, and 10 cm) in accordance with general PFT guidelines using in-house software. This test was carried out for four linear accelerators. Results: The average MLC leaf position errors were within the set criterion of <1 mm (actual errors ranged from -0.7 to 0.8 mm) for all gantry angles, but significant gantry angle dependency was observed in all machines. The error was smaller at a gantry angle of 0° but increased toward the positive direction with gantry angle increments in the clockwise direction. The error reached a maximum value at a gantry angle of 90° and then gradually decreased until 180°. In the counter-clockwise rotation of the gantry, the same pattern of error was observed but the error increased in the negative direction. Conclusion: The AutoMLCQA system was useful to evaluate the MLC leaf position error for various gantry angles without the EPID position error. The Gantry angle dependency should be considered during MLC leaf position error analysis.
Healing arts radiation protection act: revised statutes of Ontario, 1980, chapter 195
International Nuclear Information System (INIS)
1990-09-01
An act published by the Government of Ontario by the Minister of Health to ensure public safety while subjected to the use of x-rays for the irradiation of human beings for therapeutic or diagnostic purposes
Victor Heinrich Riecke a Brno jako osvícenské srdce moravského protestantismu
Czech Academy of Sciences Publication Activity Database
Bolom-Kotari, Sixtus
2015-01-01
Roč. 28, [1] (2015), s. 195-225 ISSN 0524-689X Institutional support: RVO:67985963 Keywords : Protestantism * late Enlightenment * philanthropy * secret societies * Czech-German relations Subject RIV: AB - History
DEFF Research Database (Denmark)
Farup, Jean; Rahbek, Stine Klejs; Riis, Simon
2014-01-01
-specific association between emergence of satellite cells (SCs), muscle growth, and remodeling in response to 12 wk unilateral resistance training performed as eccentric (Ecc) or concentric (Conc) resistance training ± whey protein (Whey, 19.5 g protein + 19.5 g glucose) or placebo (Placebo, 39 g glucose......Skeletal muscle satellite cells (SCs) are involved in remodeling and hypertrophy processes of skeletal muscle. However, little knowledge exists on extrinsic factors that influence the content of SCs in skeletal muscle. In a comparative human study, we investigated the muscle fiber type......) supplementation. Muscle biopsies (vastus lateralis) were analyzed for fiber type-specific SCs, myonuclei, and fiber cross-sectional area (CSA). Following training, SCs increased with Conc in both type I and type II fibers (P
Lee, Ching-Ting; Wang, Chun-Chi
2018-04-01
To study the function of channel width in multiple-submicron channel array, we fabricated the enhancement mode GaN-based gate-recessed fin metal-oxide-semiconductor high-electron mobility transistors (MOS-HEMTs) with a channel width of 450 nm and 195 nm, respectively. In view of the enhanced gate controllability in a narrower fin-channel structure, the transconductance was improved from 115 mS/mm to 151 mS/mm, the unit gain cutoff frequency was improved from 6.2 GHz to 6.8 GHz, and the maximum oscillation frequency was improved from 12.1 GHz to 13.1 GHz of the devices with a channel width of 195 nm, compared with the devices with a channel width of 450 nm.
Energy Technology Data Exchange (ETDEWEB)
NONE
1990-09-01
An act published by the Government of Ontario by the Minister of Health to ensure public safety while subjected to the use of x-rays for the irradiation of human beings for therapeutic or diagnostic purposes.
14 CFR 21.191 - Experimental certificates.
2010-01-01
... techniques, or new uses for aircraft. (b) Showing compliance with regulations. Conducting flight tests and..., sales demonstrations, and customer crew training only as provided in § 21.195. (g) Operating amateur...
The Theory of Global Governance, Constitutionalization and Comparative Constitutional Law
Czech Academy of Sciences Publication Activity Database
Blahož, Josef
2013-01-01
Roč. 3, č. 3 (2013), s. 195-207 ISSN 1805-8396 Institutional support: RVO:68378122 Keywords : globalization of political culture * global constitutionalism * comparative constitutional law Subject RIV: AG - Legal Sciences
76 FR 70217 - Pipeline Safety: Information Collection Activities
2011-11-10
... combined comment from American Petroleum Institute (API) and American Oil Pipelines Association (AOPL) on... some rural low-stress hazardous liquid pipelines are not subject to part 195 although they are required...
Czech Academy of Sciences Publication Activity Database
Li, T.; Xu, G.; Rong, J.; Chen, H.; He, Ch.; Giordano, Mario; Wang, Q.
2016-01-01
Roč. 195, May (2016), s. 73-79 ISSN 0176-1617 Institutional support: RVO:61388971 Keywords : Acclimation * Biological NOx removal * Chlorella Subject RIV: EF - Botanics Impact factor: 3.121, year: 2016
Directory of Open Access Journals (Sweden)
Kênia Ferreira Rodrigues
2008-04-01
Full Text Available Objetivou-se avaliar o desempenho e as características de carcaça de frangos de corte no período de 22 a 42 dias alimentados com rações formuladas com diferentes relações lisina digestível:proteína bruta (PB. O delineamento foi inteiramente casualizado, segundo um modelo com dois critérios de classificação hierárquica. Foram utilizados 1.200 pintos de corte machos, linhagem Cobb, criados até 21 dias de idade. Depois desse período, as aves foram uniformizadas por peso (média de 879 ± 17 g e distribuídas nas parcelas experimentais. As dietas foram isonutritivas, exceto quanto aos níveis de PB e lisina digestível, formuladas com dois níveis de PB (17,0 e 19,5% e cinco relações lisina digestível:PB, correspondendo a 5,9; 6,4; 6,9; 7,4 e 7,9% em relação à ração com 17,0% de PB e 5,3; 5,7; 6,1; 6,5 e 6,9% em relação à ração com 19,5% de PB. Cada ração experimental foi fornecida a 20 aves em cada uma das seis repetições. Aos 42 dias, avaliaram-se as características de desempenho (ganho de peso, consumo de ração e conversão alimentar, quando duas aves de cada parcela foram abatidas para determinação dos rendimentos de carcaça, de cortes e de gordura abdominal. O consumo de ração diminuiu e a conversão alimentar melhorou linearmente de acordo com as relações avaliadas no nível de 17,0% PB. Não houve efeito significativo dos dois níveis de PB utilizados sobre o ganho de peso e os rendimentos de carcaça e de partes. A gordura abdominal reduziu linearmente no nível de 19,5% de PB. As relações ideais foram de 5,9% para 17,0% PB e 5,3% para 19,5% PB. O nível de PB da dieta pode ser reduzido para 17,0%, pois essa redução não afeta o desempenho das aves.This paper was developed to evaluate the performance and the carcass characteristics of broiler chickens over the period from 22 to 42 days, fed with diets formulated with different digestible lysine: crude protein (CP ratio. A completely randomized
CHEMICAL EQUIVALENCE ASSESSMENT OF THREE BRANDS ...
African Journals Online (AJOL)
User
Bayero Journal of Pure and Applied Sciences, 8(2): 192 - 195 ... 1- Department of Pharmacology, Bayero University, Kano, Nigeria ... 3- Department of Clinical Pharmacy and Pharmacy Practice, Ahmadu Bello University, Zaria, Nigeria.
Ruminal bacterial community changes during adaptation of goats to fresh alfalfa forage
Czech Academy of Sciences Publication Activity Database
Grilli, D. J.; Mrázek, Jakub; Fliegerová, Kateřina; Kopečný, Jan; Lama, S. P.; Cucchi, M. E. C.; Sosa, M. A.; Arenas, G. N.
2016-01-01
Roč. 191, č. 2 (2016), s. 191-195 ISSN 1871-1413 Institutional support: RVO:67985904 Keywords : bacteria * creole goats * QPCR Subject RIV: EE - Microbiology, Virology Impact factor: 1.377, year: 2016
Eight-Membered Cyclic 1,2,3-Trithiocane Derivatives from Perophora viridis, an Atlantic Tunicate
Czech Academy of Sciences Publication Activity Database
Řezanka, Tomáš; Dembitsky, V. M.
- (2002), s. 2400-2404 ISSN 1434-193X Institutional research plan: CEZ:AV0Z5020903 Keywords : natural * products * sulfur heterocycles Subject RIV: EE - Microbiology, Virology Impact factor: 2.195, year: 2002
Structuring mobile and contextual learning
Glahn, Christian; Specht, Marcus
2011-01-01
Glahn, C., & Specht, M. (2011). Structuring mobile and contextual learning. In Proceedings of the 10th World Conference on Mobile and Contextual Learning (pp. 188-195). October, 18-21, 2011, Beijing, China.
75 FR 71141 - Land Acquisitions; Suquamish Indian Tribe, Washington
2010-11-22
..., inclusive, as shown on volume 72 of surveys, pages 226 through 234, inclusive, auditor's file No... established in instruments recorded on December 8, 195, under auditor's file Nos. 1117923 and 1117924, records...
Indian Academy of Sciences (India)
AIIMS), Ph.D. (Panjab), FAMS. Date of birth: 4 April 1926. Specialization: Neurophysiology, Reproductive Biology and Nutrition Address: C-195, Ramprastha, P.O. Chandernagar, Ghaziabad 201 011, U.P.. Contact: Mobile: 99863 39224
Lampanyctodes hectoris, the “Cape onderbaaidjie”, is one of the ...
African Journals Online (AJOL)
denise
Kawasaki. 1992) ... structure of L. hectoris off southern Africa using a combination of morphological/meristic and genetic .... Population Structure of a Southern African Lanternfish. 2002. 195. Table II: Enzyme (commission numbers), locus ...
International Nuclear Information System (INIS)
Wilbur, D. Scott; Chyan, M.-K.; Hamlin, Donald K.; Perry, Matthew A.
2010-01-01
Introduction: In vivo deastatination of 211 At-labeled biomolecules can severely limit their use in endoradiotherapy. Our studies have shown that the use of closo-decaborate(2-) moiety for 211 At-labeling of biomolecules provides high in vivo stability towards deastatination. However, data from those studies have also been suggestive that some astatinated closo-decaborate(2-) catabolites may be retained in tissues. In this study, we investigated the in vivo distributions of several structurally simple closo-decaborate(2-) derivatives to gain information on the effects of functional groups if catabolites are released into the blood system from the carrier biomolecule. Methods: Thirteen closo-decaborate(2-) derivatives were synthesized and radioiodinated for evaluation. Tissue concentrations of the radioiodinated compounds were obtained in groups of five mice at 1 and 4 h postinjection (pi). Dual-label ( 125 I and 131 I) experiments permitted evaluation of two compounds in each set of mice. Results: All of the target compounds were readily synthesized. Radioiodination reactions were conducted with chloramine-T and Na[ 125/131 I]I in water to give high yields (75-96%) of the desired compounds. Biodistribution data at 1 and 4 h pi (representing catabolites released into the blood system) showed small differences in tissue concentrations for some compounds, but large differences for others. The results indicate that formal (overall) charge on the compounds could not be used as a predictor of tissue localization or retention. However, derivatives containing carboxylate groups generally had lower tissue concentrations. Acid cleavable hydrazone functionalities appeared to be the best candidates for further study. Conclusions: Further studies incorporating hydrazone functionalities into pendant groups for biomolecule radiohalogenation are warranted.
Energy Technology Data Exchange (ETDEWEB)
Samour, C [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1969-07-01
The radiative capture of resonance neutrons has been studied near the Saclay linac between 0.5 and 700 eV with time-of-flight method and a Ge(Li) detector. {sup 195}Pt + n and {sup 183}W + n allow the study of the distribution of partial radiative widths and their eventual correlation and also the variation of < {gamma}{sub {gamma}{sub i}} > with E{sub {gamma}}. The mean values of Ml and El transition intensities are compared in several tin isotopes. Interference effects, either between resonances or between direct capture and resonant capture are found in {sup 195}Pt + n, {sup 197}Au + n and {sup 59}Co + n. The excited level schemes of a great deal of nuclei are obtained and compared with theoretical predictions. This study has been completed by an analysis of thermal spectrum. (author) [French] La capture radiative des neutrons de resonance a ete etudiee pres de l'accelerateur lineaire de Saclay entre 0,5 et 700 eV a l'aide de la methode du temps-de-vol et d'un detecteur Ge(Li). Les noyaux {sup 195}Pt + n et {sup 183}W + n permettent l'analyse de la distribution de resonance en resonance des largeurs radiatives partielles {gamma}{sub {gamma}{sub i}} et de leur eventuelle correlation, ainsi que l'etude de la variation de < {gamma}{sub {gamma}{sub i}} > en fonction de E{sub {gamma}}. Les intensites moyennes des transitions Ml et El sont comparees pour quelques isotopes de l'etain. Des effets d'interference, soit entre resonances, soit entre capture directe et capture resonnante sont mis en evidence dans {sup 195}Pt + n, {sup 197}Au + n et {sup 59}Co + n. Enfin les schemas des etats excites d'un grand nombre de noyaux sont obtenus et compares avec les predictions theoriques. Cette etude a ete completee par une analyse des spectres thermiques. (auteur)
Energy Technology Data Exchange (ETDEWEB)
Samour, C. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1969-07-01
The radiative capture of resonance neutrons has been studied near the Saclay linac between 0.5 and 700 eV with time-of-flight method and a Ge(Li) detector. {sup 195}Pt + n and {sup 183}W + n allow the study of the distribution of partial radiative widths and their eventual correlation and also the variation of < {gamma}{sub {gamma}{sub i}} > with E{sub {gamma}}. The mean values of Ml and El transition intensities are compared in several tin isotopes. Interference effects, either between resonances or between direct capture and resonant capture are found in {sup 195}Pt + n, {sup 197}Au + n and {sup 59}Co + n. The excited level schemes of a great deal of nuclei are obtained and compared with theoretical predictions. This study has been completed by an analysis of thermal spectrum. (author) [French] La capture radiative des neutrons de resonance a ete etudiee pres de l'accelerateur lineaire de Saclay entre 0,5 et 700 eV a l'aide de la methode du temps-de-vol et d'un detecteur Ge(Li). Les noyaux {sup 195}Pt + n et {sup 183}W + n permettent l'analyse de la distribution de resonance en resonance des largeurs radiatives partielles {gamma}{sub {gamma}{sub i}} et de leur eventuelle correlation, ainsi que l'etude de la variation de < {gamma}{sub {gamma}{sub i}} > en fonction de E{sub {gamma}}. Les intensites moyennes des transitions Ml et El sont comparees pour quelques isotopes de l'etain. Des effets d'interference, soit entre resonances, soit entre capture directe et capture resonnante sont mis en evidence dans {sup 195}Pt + n, {sup 197}Au + n et {sup 59}Co + n. Enfin les schemas des etats excites d'un grand nombre de noyaux sont obtenus et compares avec les predictions theoriques. Cette etude a ete completee par une analyse des spectres thermiques. (auteur)
Directory of Open Access Journals (Sweden)
Jorge Enrique Villamil Carvajal
2014-12-01
Full Text Available Resumen. En Colombia, las pérdidas ocasionadas porMoniliophthora roreri Cif & Par en el cultivo de cacao continúansiendo considerables. El objetivo del presente estudio fue investigarla actividad antagónica de dos aislamientos autóctonos deTrichoderma sp. y uno de Bacillus sp. ante M. roreri, en condicionesde campo. Los tratamientos fueron: T1, hongo H5; T2, hongo H20;T3, bacteria B3 y T4, testigo. Se evaluó incidencia y severidadexterna e interna en los frutos. Los resultados de severidad externae interna mostraron que respecto al control la disminucióndel daño en los frutos fue del 19,5 y 11,2% en el T1, del 28 y19,5% en el T2 y del 13,5 y 8,5% en el T3, respectivamente condiferencias estadísticas a favor del T2. Se concluye que entre lostres antagonistas evaluados, el hongo H20 (Trichoderma sp. tieneel mayor potencial para el control de la moniliasis del cacao encondiciones de campo. / Abstract. In Colombia, the economic losses caused byMoniliophthora roreri Cif & Par in the cocoa cultivation continuebeing considerable. The objective of this study was to investigatethe antagonistic activity of two indigenous isolates of Trichodermasp and one of Bacillus sp. over M. roreri under field conditions. Thetreatments were: T1, fungus H5; T2, fungus H20; T3, bacteria B3; T4,control. The variables evaluated on the cocoa fruits were incidenceand external and internal severity. The results of the externaland internal severity showed that with respect to the control thedamage reduction on the cocoa fruits was 19,5 and 11,2% in T1,28 and 19,5% in T2, and 13,5 and 8,5% in T3, respectively withstatistical differences in favor of T2. It is concluded that amongthe three evaluated antagonists, the fungus H20 (Trichoderma sp.has the greatest potential for the biocontrol of frosty pod rot in thecocoa cultivation under field conditions.
Directory of Open Access Journals (Sweden)
Jian-Guo Sheng
2016-10-01
Full Text Available Objective: To study the relationship of thyroid ultrasound elasticity contrast index (ECI with serum autoantibody and Th1/Th2 cytokine levels in patients with Hashimoto's thyroiditis. Methods: A total of 68 patients diagnosed with Hashimoto's thyroiditis (HT in our hospitalas were selected as HT group, 60 healthy volunteers were selected as control group, ultrasound examination was performed to determine ECL, serum was collected to determine TPO-Ab, TG-Ab, IFN-γ, TNF-α, IL-2, IL-4 and IL-10 levels, and peripheral blood was collected to determine the positive expression rate of CD30 and CD195. Results: ECI of HT group was significantly higher than that of control group and the ECI of patients with small nodule type HT was significantly lower than that of patients with grid type HT; TPO-Ab, TG-Ab, IFN-γ, TNF-α and IL-2 levels in serum and positive expression rate of CD195 in peripheral blood of HT group were significantly higher than those of control group while IL-4 and IL-10 levels and positive expression rate of CD30 in peripheral blood were significantly lower than those of control group; TPO-Ab, TG-Ab, IFN-γ, TNF-α and IL-2 levels in serum and positive expression rate of CD195 in peripheral blood of patients with small nodule type HT were significantly lower than those of patients with grid type HT while IL-4 and IL-10 levels and positive expression rate of CD30 in peripheral blood were significantly higher than those of patients with grid type HT; ECI was positively correlated with TPO-Ab, TG-Ab, IFN-γ, TNF- α, IL-2b and CD195, and negatively correlated with IL-4, IL-10 and CD30. Conclusions: ECL significantly increases in patients with Hashimoto's thyroiditis and it can be used to evaluate the degree of immune dysfunction.
TU-H-CAMPUS-TeP3-03: Dose Enhancement by Gold Nanoparticles Around the Bragg Peak of Proton Beams
Energy Technology Data Exchange (ETDEWEB)
Kwon, J; Sutherland, K [Department of Medical Physics, Hokkaido University Graduate School of Medicine (Japan); Hashimoto, T [Department of Radiation Medicine, Hokkaido University Graduate School of Medicine (Japan); Peng, H; Xing, L [Department of Radiation Oncology, Stanford University and Global Station for Quantum Medical Science and Engineering, Global Institution for Collaborative Research and Education (GI-CoRE), Hokkaido University (Japan); Shirato, H [Department of Radiation Medicine, Hokkaido University Graduate School of Medicine and Global Station for Quantum Medical Science and Engineering, Global Institution for Collaborative Research and Education (GI-CoRE), Hokkaido University (Japan); Date, H [Faculty of Health Sciences, Hokkaido University (Japan)
2016-06-15
Purpose: To make clear the spatial distribution of dose enhancement around gold nanoparticles (GNPs) located near the proton Bragg peak, and to evaluate the potential of GNPs as a radio sensitizer. Methods: The dose enhancement by electrons emitted from GNPs under proton irradiation was estimated by Geant4 Monte Carlo simulation toolkit in two steps. In an initial macroscopic step, 100 and 195 MeV proton beams were incident on a water cube, 30 cm on a side. Energy distributions of protons were calculated at four depths, 50% and 75% proximal to the Bragg peak, 100% peak, and 75% distal to the peak (P50, P75, Peak, and D75, respectively). In a subsequent microscopic step, protons with the energy distribution calculated above were incident on a 20 nm diameter GNP in a nanometer-size water box and the spatial distribution of dose around the GNP was determined for each energy distribution. The dose enhancement factor (DEF) was also deduced. Results: The dose enhancement effect was spread to several tens of nanometers in the both depth and radial directions. The enhancement area increased in the order of P50, P75, Peak, and D75 for both cases with 100 and 195 MeV protons. In every position around the Bragg peak, the 100 MeV beam resulted in a higher dose enhancement than the 195 MeV beam. At P75, the average and maximum DEF were 3.9 and 17.0 for 100 MeV, and 3.5 and 16.2 for 195 MeV, respectively. These results indicate that lower energy protons caused higher dose enhancement in this incident proton energy range. Conclusion: The dose enhancement around GNPs spread as the position in the Bragg peak region becomes deeper and depends on proton energy. It is expected that GNPs can be used as a radio sensitizer with consideration of the location and proton beam energy.
Wisconsin Gravity Data for the Rhinelader Area
National Oceanic and Atmospheric Administration, Department of Commerce — The gravity station data (195 records) were compiled by Barbara Eckstein. This data base was received in January 1987. Principal gravity parameters include Free-Air...
... Materials Working with the Media Fire Protection Technology Smoking fire safety outreach materials As a member of ... Not reported 7% In transport 1% 195 incidents Smoking fire safety messages to share It is important ...
Czech Academy of Sciences Publication Activity Database
Morani, A.; Nowak, D.; Hirabayashi, S.; Guidolotti, G.; Medori, M.; Muzzini, V.; Fares, S.; Scarascia-Mugnozza, G.; Calfapietra, Carlo
2014-01-01
Roč. 195, DEC 2014 (2014), s. 202-209 ISSN 0269-7491 Institutional support: RVO:67179843 Keywords : Ball–Berry * ozone flux * mediterranean region Subject RIV: EH - Ecology, Behaviour Impact factor: 4.143, year: 2014
2013-02-08
... overall sequence similarity or identity at the level of eight contiguous amino acid residues, the level of... inhibitors of amino acid biosynthesis and herbicide-tolerant crops. Amino Acids 30: 195-204. 13. Locke, M...
Czech Academy of Sciences Publication Activity Database
Mikuláš, Radek
2008-01-01
Roč. 87, č. 3 (2008), s. 194-195 ISSN 0042-4544 Institutional research plan: CEZ:AV0Z30130516 Keywords : scientometry * impact factor * scientists evaluation * polemic Subject RIV: AF - Documentation, Librarianship, Information Studies
International Nuclear Information System (INIS)
Larsen, R.H.; Bruland, O.S.; Hoff, P.; Alstad, J.; Lindmo, T.; Rofstad, E.K.
1994-01-01
The potential usefulness of α-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) 211 At-TP-3 of different specific activities, (b) 211 At-labeled bovine serum albumin (BSA), (c) free 211 At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, 211 At-BSA or free 211 At. The D o 's were lower for free 211 At than for 211 At-BSA. The survival curves for 211 At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to 211 At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to 211 At-TP-3 treatment was the antigen expression. Cell inactivation after 211 At-TP-3 treatment increased substantially with increasing specific activity of the 211 At-TP-3. At high specific activities, the cytotoxic effect of 211 At-TP-3 was significantly higher than that of 211 At-BSA. In conclusion, 211 At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs
The Role of Attachment in Body Weight and Weight Loss in Bariatric Patients.
Nancarrow, Abigail; Hollywood, Amelia; Ogden, Jane; Hashemi, Majid
2018-02-01
The aim of this study is to explore the role of attachment styles in obesity. The present study explored differences in insecure attachment styles between an obese sample waiting for bariatric surgery (n = 195) and an age, sex and height matched normal weight control group (n = 195). It then explored the role of attachment styles in predicting change in BMI 1 year post bariatric surgery (n = 143). The bariatric group reported significantly higher levels of anxious attachment and lower levels of avoidant attachment than the control non-obese group. Baseline attachment styles did not, however, predict change in BMI post surgery. Attachment style is different in those that are already obese from those who are not. Attachment was not related to weight loss post surgery.
E2 and M1 Transition Probabilities in Odd Mass Hg Nuclei
Energy Technology Data Exchange (ETDEWEB)
Berg, V; Baecklin, A; Fogelberg, B; Malmskog, S G
1969-10-15
L- and M-subshell ratios have been measured for the 39.5 keV transition in {sup 193}Hg and the 37.1 and 16.2 keV transitions in {sup 195}Hg yielding 0.38 {+-} 0.12 , <0.02 and 0.08 {+-} 0.03 per cent E2, respectively. The half-lives of the 39.5 keV level in {sup 193}Hg and the 53.3 and 37.1 keV levels in {sup 195}Hg have been measured by the delayed coincidence method, yielding values of 0.63 {+-} 0.03, 0.72 {+-} 0.03 and <0.05 nsec respectively. A systematic compilation of reduced E2 and M1 transition probabilities in odd mass Pt, Hg and Pb nuclei is given and compared to theoretical predictions.
Electrochemical Oxidation of Propene with a LSF15/CGO10 Electrochemical Reactor
DEFF Research Database (Denmark)
Ippolito, Davide; Kammer Hansen, Kent
2014-01-01
A porous electrochemical reactor, made of La0.85Sr0.15FeO3 (LSF) as electrode and Ce0.9Gd0.1O1.95 (CGO) as electrolyte, was studied for the electrochemical oxidation of propene over a wide range of temperatures. Polarization was found to enhance propene oxidation rate. Ce0.9Gd0.1O1.95 was used...... as infiltration material to enhance the effect of polarization on propene oxidation rate, especially at low temperatures. The influence of infiltrated material, as a function of heat treatment, on the reactor electrochemical behavior has been evaluated by using electrochemical impedance spectroscopy...... in suppressing the competing oxygen evolution reaction and promoting the oxidation of propene under polarization, with faradaic efficiencies above 70% at 250◦C. © 2014 The Electrochemical Society....
Partial radiative capture of resonance neutrons
International Nuclear Information System (INIS)
Samour, C.
1969-01-01
The radiative capture of resonance neutrons has been studied near the Saclay linac between 0.5 and 700 eV with time-of-flight method and a Ge(Li) detector. 195 Pt + n and 183 W + n allow the study of the distribution of partial radiative widths and their eventual correlation and also the variation of γ i > with E γ . The mean values of Ml and El transition intensities are compared in several tin isotopes. Interference effects, either between resonances or between direct capture and resonant capture are found in 195 Pt + n, 197 Au + n and 59 Co + n. The excited level schemes of a great deal of nuclei are obtained and compared with theoretical predictions. This study has been completed by an analysis of thermal spectrum. (author) [fr
Vaeste ja rikaste vahel püsib kuuekordne vahe / Helga Koger
Koger, Helga, 1945-
2008-01-01
Statistikaameti uuringu järgi oli 2006. aastal Eesti elanikkonna suhtelise vaesuse määr 19,5 protsenti ning rikkaima ja vaeseima viiendiku sissetulek erines ligi kuus korda. Diagramm: Allpool vaesuspiiri elavate inimeste arv (%)
2012-10-18
... and address global climate change. Need for Correction As published, the final regulations... 2014 2015 2016 2017-2025 Passenger Cars 150,922 177,238 177,366 178,652 180,497 182,134 195,264 Light...
Phylogeny and biogeography of Alyssum (Brassicaceae) based on ...
Indian Academy of Sciences (India)
The genus Alyssum consists of about 195 species native to Europe, Asia and northern ... In this study, the phylogenetic relationships within the genus Alyssum were studied ... Journal of Genetics, Vol. ...... Academic Press, New York, USA.
Czech Academy of Sciences Publication Activity Database
Vítek, Tomáš
2015-01-01
Roč. 36, č. 2 (2015), s. 195-233 ISSN 0392-7342 Institutional support: RVO:67985955 Keywords : Heraclitus * mysteries * death * fire * Clement Alexandrinus Subject RIV: AA - Philosophy ; Religion http://www.bibliopolis.it/rivis2.html
Tench broodstock management in breeding station under conditions of pond culture: a review
Czech Academy of Sciences Publication Activity Database
Gela, David; Flajšhans, Martin; Kocour, Martin; Rodina, Marek; Linhart, Otomar
2006-01-01
Roč. 14, 2 (2006), s. 195-203 ISSN 0967-6120 Institutional research plan: CEZ:AV0Z50450515 Keywords : broodstock * farming cycle * fish identification Subject RIV: GL - Fishing Impact factor: 0.943, year: 2006
Immobilization of industrial waste in cement–bentonite clay matrix
Indian Academy of Sciences (India)
Unknown
Immobilization of industrial waste in cement–bentonite clay matrix. I B PLECAS* and S ... high structural integrity and minimizing the risk of escape by leaching. ..... Radioactive Waste Management and Nuclear Fuel Cycle 14. 195. Plecas I ...
Czech Academy of Sciences Publication Activity Database
Ponec, Robert
2015-01-01
Roč. 1053, SI (2015), s. 195-213 ISSN 2210-271X Institutional support: RVO:67985858 Keywords : binuclear metal carbonyls * DAFH analysis * 18-electron rule Subject RIV: CC - Organic Chemistry Impact factor: 1.403, year: 2015
AIDS awareness and VCT behaviour: An application of the ...
African Journals Online (AJOL)
2013-05-24
May 24, 2013 ... the Ndlovu Medical Trust in Elandsdoorn uses VCT in their intervention ... (e.g. the acceptance of colorectal cancer screening tests) ...... behavior: Studying cannabis use', British Journal of Social Psychology 38, 195–222.
Czech Academy of Sciences Publication Activity Database
Sabuni, C. A.; Van Houtte, N.; Maganga, S. L. S.; Makundi, R. H.; Leirs, H.; Goüy de Bellocq, Joëlle
2015-01-01
Roč. 7, č. 1 (2015), s. 193-195 ISSN 1877-7252 Institutional support: RVO:68081766 Keywords : Rhynchocyon petersi * Vulnerable afrotherian * Microsatellites * 454 Sequencing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.446, year: 2015
Porphyridium purpureum (formerly P. cruenium) contains Beta-carotenc but no Alfa-carotenc
Czech Academy of Sciences Publication Activity Database
Kopecký, Jiří; Riederer, M.; Pfundel, E.
2003-01-01
Roč. 104, - (2003), s. 189-195 ISSN 0342-1120 R&D Projects: GA MŠk ME 168 Institutional research plan: CEZ:AV0Z5020903 Keywords : carotene * porphyridium * red alga Subject RIV: EE - Microbiology, Virology
Magnetic properties of ion beam mixed and annealed Ag/Fe/Ag-(001)-layers
Czech Academy of Sciences Publication Activity Database
Kurowski, D.; Brand, K.; Pelzl, J.; Frait, Zdeněk
198/199, - (1999), s. 360-362 ISSN 0304-8853. [MML`98. Vancouver, 00.00.1998] Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.195, year: 1999
Upper Limits on O VI Emission from Voyager Observations
Indian Academy of Sciences (India)
R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22
., Bowyer, C. S., Korpela, E., Lampton, M., Trapero, J., Gomez, J. F., Morales, C.,. Orozco, V. 1999, American Astronomical Society Meeting, 195, 5302. Holberg, J. B., Watkins, R. 1992, Voyager Ultraviolet Spectrometer Guest Observer and Data.
African Journals Online (AJOL)
Femi
completed the routine immunization schedule. Despite its proven ... Immunization Days(NID) (19.5%), mother travelled (14.6%), forgot(9.8%), and reaction to previous vaccine(6.1%). ..... which probably accounted for the attitude of some of.
Czech Academy of Sciences Publication Activity Database
Čižmárová, Libuše
2010-01-01
Roč. 3, č. 1 (2010), s. 183-195 ISSN 1855-6302 Institutional research plan: CEZ:AV0Z90610518 Keywords : onomastics, dialectology * electronic dictionary * anoikonyms * digitization * Moravia * Silesia * minor place names Subject RIV: AI - Linguistics
Czech Academy of Sciences Publication Activity Database
Verkhratsky, Alexei
2009-01-01
Roč. 195, č. 1 (2009), s. 111-122 ISSN 1748-1708 Institutional research plan: CEZ:AV0Z50390512 Keywords : gliotransmitters * neurotransmitters * history of neuroscience Subject RIV: FH - Neurology Impact factor: 2.810, year: 2009
‘Special forest’: educational intervention in environmental education for visually impaired students
Israel Sánchez-Osorio; Asunción Moya Maya
2017-01-01
Sánchez-Osorio, I y Moya, A. (2017): “‘Bosque especial’: intervención educativa en educación medioambiental para escolares con discapacidad visual”. Revista Española de Discapacidad, 5 (2): 195-210.
Afrika Statistika ISSN 2316-090X Uniform in Bandwidth Law of the ...
African Journals Online (AJOL)
simple mathematical correction to remove the boundary bias. More recently .... 2) The uniformity in h allows us to apply various bandwidth selection rules such as plug-in, ...... Journal of Statistical Planning and Inference, 46 (2), 195-214.
Prevalence and correlates of aggression among psychiatric in ...
African Journals Online (AJOL)
Results: A total of 300 subjects satisfied the inclusion criteria, but only 298 were assessed because two ... The prevalence of aggression in this study was 19.5%. ... Most of the aggressive behavior occurred without provocation (63.3%).
The influence of attitudes toward immigrants on international migration
Czech Academy of Sciences Publication Activity Database
Gorinas, C.; Pytliková, Mariola
2017-01-01
Roč. 51, č. 2 (2017), s. 416-451 ISSN 0197-9183 Institutional support: RVO:67985998 Keywords : international migration * attitudes toward immigrants Subject RIV: AH - Economics OBOR OECD: Applied Economics, Econometrics Impact factor: 2.195, year: 2016
Tanzania Journal of Health Research - Vol 9, No 3 (2007)
African Journals Online (AJOL)
-school adolescents in Kilimanjaro, Tanzania · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. S Siziya, P R Ntata, E Rudatsikira, C M Makupe, E Umar, A S Muula, 190-195.
Proof of Causation in Medical Malpractice Cases in the Czech Republic
Czech Academy of Sciences Publication Activity Database
Doležal, Adam; Doležal, Tomáš
2015-01-01
Roč. 5, č. 3 (2015), s. 195-205 ISSN 1805-8396 R&D Projects: GA ČR GAP408/12/2574 Institutional support: RVO:68378122 Keywords : causation * liability * medical malpractice cases Subject RIV: AG - Legal Sciences
Kosík, Kalivoda, Sviták a Pražské jaro 1968
Czech Academy of Sciences Publication Activity Database
Mervart, Jan
2012-01-01
Roč. 60, Suppl. 2 (2012), s. 195-209 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : Marxist humanism * Prague spring 1968 * Karel Kosík * Robert Kalivoda * Ivan Sviták Subject RIV: AA - Philosophy ; Religion
Abnormal fetal head shape: aetiology and management
DEFF Research Database (Denmark)
Petersen, Olav Bjørn; David, Anna; Thomasson, Louise
2007-01-01
(lemon-shaped), 18.4% with aneuploidy (mostly strawberry-shaped). 19.5% were dolicocephalic, most secondary to fetal position or oligohydramnios (see table). 13 had confirmed craniosynostosis, including thanatophoric dysplasia, Craniofrontonasal dysplasia, Aperts syndrome, Baller-Gerold syndrome, I...
Exploring Pan-Africanism's theories: from race-based solidarity to political unity and beyond
Czech Academy of Sciences Publication Activity Database
Kasanda, Albert
2016-01-01
Roč. 28, č. 2 (2016), s. 179-195 ISSN 1369-6815 Institutional support: RVO:67985955 Keywords : solidarity * unity * sovereignty * race * Africa * Afropolitanism * Pan-Africanism * colonization Subject RIV: AA - Philosophy ; Religion Impact factor: 0.917, year: 2016
STUDYING FAINT ULTRA-HARD X-RAY EMISSION FROM AGN IN GOALS LIRGS WITH SWIFT/BAT
International Nuclear Information System (INIS)
Koss, Michael; Casey, Caitlin M.; Mushotzky, Richard; Veilleux, Sylvain; Baumgartner, Wayne; Tueller, Jack; Markwardt, Craig
2013-01-01
We present the first analysis of the all-sky Swift Burst Alert Telescope (BAT) ultra-hard X-ray (14-195 keV) data for a targeted list of objects. We find that the BAT data can be studied at three-times-fainter limits than in previous blind detection catalogs based on prior knowledge of source positions and using smaller energy ranges for source detection. We determine the active galactic nucleus (AGN) fraction in 134 nearby (z IR /L ☉ > 11.8) detected. The BAT AGN classification shows 97% (37/38) agreement with Chandra and XMM-Newton AGN classification using hardness ratios or detection of an iron Kα line. This confirms our statistical analysis and supports the use of the Swift/BAT all-sky survey to study fainter populations of any category of sources in the ultra-hard X-ray band. BAT AGNs in LIRGs tend to show higher column densities with 40% ± 9% showing 14-195 keV/2-10 keV hardness flux ratios suggestive of high or Compton-thick column densities (log N H > 24 cm –2 ), compared to only 12% ± 5% of non-LIRG BAT AGNs. We also find that using specific energy ranges of the BAT detector can yield additional sources over total band detections with 24% (5/21) of detections in LIRGs at 24-35 keV not detected at 14-195 keV.
Nuclear medicine technology. Progress report for quarter ending December 31, 1978
International Nuclear Information System (INIS)
Knapp, F.F. Jr.
1979-05-01
Of special interest is the recent synthesis of /sup 117m/Sn-labeled 12,12-dimethyl-12-stannahexadecanoic acid. Although tissue distribution studies with this potential myocardial imaging agent demonstrated only marginal heart uptake of radioactivity, these studies are important since they clearly demonstrate that tissue-specific /sup 117m/Sn-labeled agents can be prepared. High-quality heart scans in rats that have been obtained following intravenous administration of /sup 123m/Te-labeled 9-tellurahepta-decanoic acid are also illustrated. Continuing studies with 11 C and /sup 195m/Pt are described. Additional patient studies with 11 C-DL-tryptophan and 11 C-1-aminocyclobutanecarboxylic acid ( 11 C-ACBC) have further illustrated the usefulness of these agents for the positron emission tomographic imaging studies of the pancreas and tumor tissue, respectively. Studies of the reactor production of /sup 195m/Pt by the Szilard-Chalmers process have been completed. These studies have demonstrated that the preparation of high specific activity /sup 195m/Pt by the Szilard-Chalmers process using this technique is impractical. Finally, continued studies with the KB tumor cell diffusion chamber technique have shown that a dose-response relationship can be demonstrated following injection of both cyclophosphamide and cis-dichlorodiammineplatinum (II). These results suggest that the diffusion chamber technique could be an important tool to study the uptake and effects on cell growth of radiopharmaceuticals and other agents
Romain, Gabrielle; Senyukov, Vladimir; Rey-Villamizar, Nicolas; Merouane, Amine; Kelton, William; Liadi, Ivan; Mahendra, Ankit; Charab, Wissam; Georgiou, George; Roysam, Badrinath; Lee, Dean A.
2014-01-01
The efficacy of most therapeutic monoclonal antibodies (mAbs) targeting tumor antigens results primarily from their ability to elicit potent cytotoxicity through effector-mediated functions. We have engineered the fragment crystallizable (Fc) region of the immunoglobulin G (IgG) mAb, HuM195, targeting the leukemic antigen CD33, by introducing the triple mutation Ser293Asp/Ala330Leu/Ile332Glu (DLE), and developed Time-lapse Imaging Microscopy in Nanowell Grids to analyze antibody-dependent cell-mediated cytotoxicity kinetics of thousands of individual natural killer (NK) cells and mAb-coated target cells. We demonstrate that the DLE-HuM195 antibody increases both the quality and the quantity of NK cell-mediated antibody-dependent cytotoxicity by endowing more NK cells to participate in cytotoxicity via accrued CD16-mediated signaling and by increasing serial killing of target cells. NK cells encountering targets coated with DLE-HuM195 induce rapid target cell apoptosis by promoting simultaneous conjugates to multiple target cells and induce apoptosis in twice the number of target cells within the same period as the wild-type mAb. Enhanced target killing was also associated with increased frequency of NK cells undergoing apoptosis, but this effect was donor-dependent. Antibody-based therapies targeting tumor antigens will benefit from a better understanding of cell-mediated tumor elimination, and our work opens further opportunities for the therapeutic targeting of CD33 in the treatment of acute myeloid leukemia. PMID:25232058
Digital Repository Service at National Institute of Oceanography (India)
Sharma, R.
investment of $1.95 billion as capital expenditure and $9 billion as operating expenditure for a single deep-sea mining venture. In view of high investment, technological challenges and economic considerations, private-public cooperation could be an effective...
Expression of human erythropoietin gene in the mammary gland of a transgenic mouse
Czech Academy of Sciences Publication Activity Database
Mikuš, Tomáš; Malý, Petr; Poplštein, M.; Landa, Vladimír; Trefil, P.; Lidický, J.
2001-01-01
Roč. 47, č. 6 (2001), s. 187-195 ISSN 0015-5500 Institutional research plan: CEZ:AV0Z5052915 Keywords : erythropoietin, mammary gland, transgenic mouse Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.519, year: 2001
Aged mice have increased inflammatory monocyte concentration ...
Indian Academy of Sciences (India)
monocytes from old as compared with those from young mice. The increased classic .... several instances where the isotype control antibodies stained in a similar position but at a ..... responses in young and older adults. J. Infect. Dis. 195.
CERN'S Fire and Rescue Group Gets New Ambulance
2000-01-01
The ambulance is to replace another based on the off-road vehicle design which was originally acquired for the civil engineering phase of LEP construction. Just one figure, in 1999, the CERN ambulance was called out 195 times.
Czech Academy of Sciences Publication Activity Database
Šolcová, Iva; Kebza, V.
2001-01-01
Roč. 45, č. 2 (2001), s. 127-134 ISSN 0009-062X R&D Projects: GA AV ČR IAA8025902 Keywords : unemployment * mental health * somatic health Subject RIV: AN - Psychology Impact factor: 0.195, year: 2001
Czech Academy of Sciences Publication Activity Database
Kletetschka, Günther; Hooke, R. L.; Ryan, A.; Fercana, G.; McKinney, E.; Schwebler, K. P.
2013-01-01
Roč. 195, 1 August (2013), s. 110-117 ISSN 0169-555X Institutional support: RVO:67985831 Keywords : Endorheic * Finite element modeling * hydrogeology * Racetrack playa * sliding stones Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.577, year: 2013
Jít s sebou a podobná spojení v ČNK a na internetu
Czech Academy of Sciences Publication Activity Database
Giger, Markus
2007-01-01
Roč. 90, č. 4 (2007), s. 195-202 ISSN 0027-8203 R&D Projects: GA AV ČR 1ET101120503 Institutional research plan: CEZ:AV0Z90610521 Keywords : collocation * corpus linguistics Subject RIV: AI - Linguistics
Computing and Automation Division quarterly report 30 June -28 September 1975
International Nuclear Information System (INIS)
Walkinshaw, W.; Lea, A.T.
1975-10-01
The work of the Division is reported under the following heads: 360/195 operations; workload; remote facilities; system development (HASP, graphics support, ELECTRIC); user support; applications (GEC 4080); film measuring (HPD measurement, operation, and system development). (U.K.)
Czech Academy of Sciences Publication Activity Database
Niazi, A.; Yazdanipour, A.; Ghasemi, J.; Amini, A.; Bozorgzad, S.; Kubista, Mikael
2008-01-01
Roč. 195, č. 10 (2008), s. 1257-1268 ISSN 0098-6445 Institutional research plan: CEZ:AV0Z50520701 Keywords : Acid ionization constant * acidy * fluorecein Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.585, year: 2008
Food Security in Africa and Asia: Strategies for Small-scale ...
African Journals Online (AJOL)
GGBT_2
chapters. The focus is on small-scale agricultural development. It identifies ... Asia through a system of producer and consumer subsidies (pp. 195-196). ... Doha Round of the WTO and the position of African countries. In what ways will.
Parity May Determine Levels of Some Antioxidant Minerals in ...
African Journals Online (AJOL)
as pregnancy progressed while manganese increased significantly (P < 0.001; F = 18.370; r2 = 0.195), and remained ... birth weight, suggesting that manganese may affect fetal ... vitamins C and B‑complex, folic acid and fesolate (as iron.
Screw scale measurement requirements and test methods%螺旋秤的计量要求和试验方法
Institute of Scientific and Technical Information of China (English)
刘炜
2012-01-01
Through to the electronic spiral weighing feeder test, this article describes in detail on the basis of continuous totalizing automatic weighing instrument (belt) national standard (GBfF7721-2007) and test procedures (JJG195-2D02) corresponding to the terms of the screw scale test measurement requirements and test methods.%本文通过对电子螺旋称重给料机进行试验,详细地阐述了依据连续累计自动衡器(皮带秤)的国家标准(GB/T7721—2007)和检定规程~G195—2002)相应的条款对螺旋秤进行试验的计量要求和试验方法。
32 CFR Appendix A to Part 195 - Programs to Which This Part Applies
2010-07-01
... whose primary purpose is the conduct of scientific research, wherein title to equipment purchased with... schools (50 United States Code App. 2281(e)). 12. Office of Civil Defense loans of equipment or materials... States Code 9441). 15. Research grants made under the authority of Pub. L. 85-934 (42 United States Code...
Current and Historical Antecedents of Individual Value Differences Across 195 Regions in Europe
van Herk, H.; Poortinga, Y.H.
2012-01-01
This study analyzes differences on two value dimensions, conservation and self-enhancement, at both the individual and regional level across Europe. Within-country regions represent "cultunits" that often have belonged to different nation-states in history. Eight antecedent variables are explored.
26 CFR 1.195-1T - Election to amortize start-up expenditures (temporary).
2010-04-01
... business, or $5,000 (reduced (but not below zero) by the amount by which the start-up expenditures exceed... beginning with the month in which the active trade or business begins. All start-up expenditures that relate to the active trade or business are considered in determining whether the start-up expenditures...
Sexospécificités | Page 195 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
In the dim light of a makeshift beer hall in Phillipi township, South Africa, tourist Rob Denhom is introduced to a taste like no other. A man passes him a rusty can full of Umqomboti, a traditional bitter-sour millet beer. It is more than the British teacher has bargained for. His face puckers at the taste and he eagerly passes the ...
Indian Academy of Sciences (India)
2012-12-16
Dec 16, 2012 ... and improved cognitive performance under stressful condi- tions (Liu et al. 2000; Weaver ..... (Orlando: Academic Press) pp 195–221. Heim C and ... campus in major depression: a primer on neuron death. Biol. Psychiatry 48 ...
Czech Academy of Sciences Publication Activity Database
Láska, K.; Chládová, Zuzana; Ambrožová, K.; Husák, J.
2013-01-01
Roč. 3, č. 2 (2013), s. 184-195 ISSN 1805-0689 Institutional support: RVO:68378289 Keywords : atmospheric circulation * climate * cloudiness * weather * Svalbard * Arctic Subject RIV: DO - Wilderness Conservation http://www.sci.muni.cz/CPR/6cislo/Laska.pdf