WorldWideScience

Sample records for astatine 195

  1. Organic chemistry of astatine

    International Nuclear Information System (INIS)

    The paper surveys the investigations on the chemical behaviour of astatine in organic systems and deals with the preparation and identification of its organic compounds. A discussion is given on some of the physico-chemical properties of these compounds determined by extrapolation techniques as well as by direct measurement. The biomedical importance of 211At-labelled compounds is briefly referred to. (authors)

  2. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  3. Astatine-211: production and availability.

    Science.gov (United States)

    Zalutsky, Michael R; Pruszynski, Marek

    2011-07-01

    The 7.2-h half life radiohalogen (211)At offers many potential advantages for targeted α-particle therapy; however, its use for this purpose is constrained by its limited availability. Astatine-211 can be produced in reasonable yield from natural bismuth targets via the (209)Bi(α,2n)(211)At nuclear reaction utilizing straightforward methods. There is some debate as to the best incident α-particle energy for maximizing 211At production while minimizing production of (210)At, which is problematic because of its 138.4-day half life α-particle emitting daughter, (210)Po. The intrinsic cost for producing (211)At is reasonably modest and comparable to that of commercially available (123)I. The major impediment to (211)At availability is attributed to the need for a medium energy α-particle beam for its production. On the other hand, there are about 30 cyclotrons in the world that have the beam characteristics required for (211)At production. PMID:22201707

  4. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211At species, 211At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  5. Dosimetrical considerations in astatine-211 radioimmunotherapy

    International Nuclear Information System (INIS)

    Several dosimetrical quantities have been suggested for use in alpha-particle dosimetry. To evaluate the expected biological effect when using these quantities, a Monte Carlo program was set to register the single-event distribution of both specific energy and alpha-particle track length to a cell nucleus (r=5.6 μm). Distributions were acquired for both 'bound' (simulating the effect of 211At-labelled antibodies bound to antigens on cell surfaces (r=7.0 μm)) as well as 'non-bound' (simulating 211At-labelled antibodies that have not bound to a cell) astatine-211. From these distributions, various theoretical cell survival curves were established for 3 different dosimetrical quantities, i.e. specific energy, number of alpha-particle hits and total track length. The survival curves for all quantities are presented for the corresponding mean absorbed dose in order to facilitate comparisons of the expected effects of using the 3 different quantities for both distributions of 211At decays. The theoretical survival curves presented here could, combined with experiments using 'bound' and 'non-bound' 211At in a single-cell suspension, reveal which dosimetrical quantity is most suitable for 211 At-radioimmunotherapy. (author)

  6. Discovery of the astatine, radon, francium, and radium isotopes

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  7. Extraction of astatine isotopes for development of radiopharmaceuticals using a 211Rn-211At generator

    International Nuclear Information System (INIS)

    In order to utilize a 211At isotope, a promising α-emitter for radionuclide therapy, the chemical properties of astatine isotopes are studied. We have examined wet chemistry methods through the distribution ratios of astatine in liquid-liquid extraction. The astatine isotopes have been found to be well extracted into DIPE and MIBK. We observed that the distribution ratio of astatine isotopes increases with concentrations of HCl greater than 3 M, while it decreases with the HCl concentration less than 2 M. The results will be useful for development of the 211Rn-211At generator. (author)

  8. Astatine-211-Labeled Targeted Radiotherapeutics: An Update

    International Nuclear Information System (INIS)

    The heavy halogen 211At was first proposed for use in α-particle targeted radiotherapy more than 30 years ago and continues to be one of the most promising radionuclides for this purpose. Although its 7.2-h half life is not ideal for intravenously administered whole antibodies, it is compatible with the pharmacokinetics of antibody fragments, peptides, aptamers and organic molecules. Its diverse chemistry allows its incorporation into a wide array of targeting vehicles, relying on its chemical similarity to iodine to provide a useful point of departure. On the other hand, the relatively low carbon-astatine bond strength is challenging. In common with the other α-emitters being discussed at this symposium, lack of reliable availability is one of the biggest hurdles in the use of 211At for targeted radiotherapy. However, in the case of 211At, it is not a question of production cost or availability of target material, because 211At can be produced in reasonable yield from natural bismuth targets. Rather, the difficulty is the lack of cyclotrons equipped with the medium energy α-particle beams required for its production. If the infrastructure for producing 211At is to be improved to the stage where 211At-labeled radiopharmaceuticals can have a meaningful impact, several developments must occur. First, the ability to produce clinically relevant levels of 211At that can be shipped to remote locations in chemically tractable form must be demonstrated. Approaches under consideration include compensating for radiolysis-mediated effects and the consideration of alternative chemistries. Second, strategies for compensating for heterogeneities in dose deposition must be developed, hopefully in a way that is compatible with approval for human use. And third, it is essential that more clinical trials be performed with 211At-labeled therapeutics, particularly in settings of minimum residual disease where the radiobiological advantages of α-particles can be best exploited. Our

  9. Scrutinizing "Invisible" astatine: A challenge for modern density functionals.

    Science.gov (United States)

    Sergentu, Dumitru-Claudiu; David, Grégoire; Montavon, Gilles; Maurice, Rémi; Galland, Nicolas

    2016-06-01

    The main-group 6p elements did not receive much attention in the development of recent density functionals. In many cases it is still difficult to choose among the modern ones a relevant functional for various applications. Here, we illustrate the case of astatine species (At, Z = 85) and we report the first, and quite complete, benchmark study on several properties concerning such species. Insights on geometries, transition energies and thermodynamic properties of a set of 19 astatine species, for which reference experimental or theoretical data has been reported, are obtained with relativistic (two-component) density functional theory calculations. An extensive set of widely used functionals is employed. The hybrid meta-generalized gradient approximation (meta-GGA) PW6B95 functional is overall the best choice. It is worth noting that the range-separated HSE06 functional as well as the old and very popular B3LYP and PBE0 hybrid-GGAs appear to perform quite well too. Moreover, we found that astatine chemistry in solution can accurately be predicted using implicit solvent models, provided that specific parameters are used to build At cavities. © 2016 Wiley Periodicals, Inc. PMID:27059181

  10. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  11. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates.

    Science.gov (United States)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Svedhem, Sofia; Lindegren, Sture

    2016-03-16

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single cancer cells. A promising radioactive nuclide for this type of therapy is astatine-211. Astatine-211 attached to tumor-specific antibodies as carrier molecules is a system currently under investigation for use in targeted alpha therapy. In the common radiolabeling procedure, astatine is coupled to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies. PMID:26791409

  12. Astatine-211: production, injection into monoclonal antibodies radiological effect, possible application to cancer treatment

    International Nuclear Information System (INIS)

    Methods developed in the Laboratory of Nuclear Problems, JINR, for producing astatine-211 and injecting it into monoclonal antibodies are described. The use of its diethylene triamine penta-acetic acid complex is shown to be the most effective method of injecting astatine into a biomolecules. The biological effect of the α-particles emitted from the astatine-211 is investigated using Chinese hamster fibroblasts and Ehrlich carcinoma cells. It is established that the mitotic activity depression, number of degenerating cells, number of cells with chromosome aberrations, and cellular surviving fraction depend on the concentration of the radionuclide in the medium 'in vitro'. The RBE of α-particles in comparison with 60Co γ-rays is 3. Injection of astatine-211 absorbed on tellurium particles into mice with ascitic tumors resulted in prolongation of their life or elimination of the tumors. (author). 39 refs, 7 figs

  13. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    OpenAIRE

    Rothe, S.; A. N. Andreyev; Antalic, S; Borschevsky, A.; Capponi, L.; Cocolios, T.E.; Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the io...

  14. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    Science.gov (United States)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-07-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and physical properties for use in targeted therapies for cancer. Due to the very short range of the emitted α-particles, this therapy is particularly suited to treating occult, disseminated cancers. Astatine is not intrinsically tumour-specific; therefore, it requires an appropriate tumour-specific targeting vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method that combines dry distillation of astatine-211 and a synthesis module for producing radiopharmaceuticals into a process platform. This platform will standardize production of astatinated radiopharmaceuticals, and hence, it will facilitate large clinical studies focused on this promising, but chemically challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies.

  15. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-01-01

    vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method......To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  16. Study of Astatine (III) reactions with O, S and N ligands in solution

    International Nuclear Information System (INIS)

    Full text of publication follows. Astatine (At, Z=85: [Xe]4f145d106s26p5) belongs to the halogen group and is located below iodine in the periodic table. One of its isotopes (211At) appears promising as a therapeutic agent in nuclear medicine (Ref.1) owing to the energy of the alpha particles emitted during the disintegration of its nucleus and its short physical half-life (7.2 h). Since there are no stable isotopes of astatine, the chemistry of this element remains poorly understood. Generally, At is supposed to behave as a halogen (Ref.2) but it has been shown recently in our group that astatine presents a metallic behaviour in aqueous solution: it notably exists as At+ and AtO+ species under the oxidation states +I and +III (Ref.3). At the present time, the number of studies dealing with the complexation properties of the cationic forms of astatine remains limited (Ref.4), owing to its low availability. In this work, we have investigated the reactions of AtO+ species with different hetero-atomic (N, S, O) model ligands. A combined approach based on experimental and theoretical studies has been used (Ref.5). On account of the difficulties of experimental investigations of astatine species, the reactivity of AtO+ was explored using a competition method founded on astatine distributions between two distinct phases. Furthermore, for each AtO+/ ligand complex, the nature of the species formed and the associated thermodynamic constants were determined by computational modeling (DFT calculations). In this framework, an original computational methodology was developed to take into account the specificities of astatine, notably the associated relativistic effects. The computed equilibrium constants have been confronted with the experimental results. This comparison demonstrates an outstanding coherence between experience and theory. Furthermore, the analysis of the results shows a key role of solvent effects on astatine chemistry. Lastly, a specific reactivity for the

  17. 49 CFR 195.114 - Used pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Used pipe. 195.114 Section 195.114 Transportation... PIPELINE Design Requirements § 195.114 Used pipe. Any used pipe installed in a pipeline system must comply with § 195.112 (a) and (b) and the following: (a) The pipe must be of a known specification and...

  18. 32 CFR 195.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 195.5 Section 195.5 National... RIGHTS ACT OF 1964 § 195.5 Responsibilities. (a) The Assistant Secretary of Defense (Manpower) shall be...) to fulfill this responsibility in accordance with § 195.2(b). (c) The Assistant Secretary of...

  19. 49 CFR 195.54 - Accident reports.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Accident reports. 195.54 Section 195.54... PIPELINE Annual, Accident, and Safety-Related Condition Reporting § 195.54 Accident reports. (a) Each operator that experiences an accident that is required to be reported under § 195.50 shall as soon...

  20. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments (209At, 210At, 211At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  1. Astatine-211 Pathway from Radiochemistry to Clinical Investigation

    International Nuclear Information System (INIS)

    Particularly in clinical settings where tumour burden is low and cancers are located in close proximity to essential normal tissue structures, α-particle emitting radionuclides can offer significant advantages for targeted radionuclide therapy. One of the first alpha emitters to be evaluated for this purpose is the 7.2-h half-life radiohalogen Astatine-211 (211At). From a commercialization-potential perspective 211At, is less appealing than the longer half-life alpha particle emitters Radium-223, Actinium-225 and Thorium-227, which have become the focus of many laboratories. However, if methods for providing a better supply of 211At could be developed, this alpha emitter would be the radionuclide of choice for many potential therapeutic applications. With regard to the production of 211At, this can be readily be accomplished by bombarding natural bismuth targets with 28−29.5 MeV alpha particles via the 209Bi(α,2n)211At reaction. The goal is to utilize an alpha particle beam energy that provides the required balance for maximizing 211At production while minimizing creation of 210At, which is problematic because of its 138.4-day half life alpha-particle emitting daughter, 210Po. For most intended clinical applications, alpha particle beam energy of about 29 MeV offers the best compromise between maximizing yield and providing 211At with sufficient radionuclidic purity for clinical use. Clinically relevant levels of 211At have been produced at several institutions using both internal and external cyclotron targets

  2. 32 CFR 195.12 - Judicial review.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Judicial review. 195.12 Section 195.12 National... RIGHTS ACT OF 1964 § 195.12 Judicial review. Action taken pursuant to section 602 of the Act is subject to judicial review as provided in section 603 of the Act....

  3. 49 CFR 195.112 - New pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false New pipe. 195.112 Section 195.112 Transportation... PIPELINE Design Requirements § 195.112 New pipe. Any new pipe installed in a pipeline system must comply with the following: (a) The pipe must be made of steel of the carbon, low alloy-high strength, or...

  4. 32 CFR 195.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... CFR part 70, shall be consistent with those standards and shall be coordinated with the U.S. Civil... 32 National Defense 2 2010-07-01 2010-07-01 false Policy. 195.4 Section 195.4 National Defense... RIGHTS ACT OF 1964 § 195.4 Policy. (a) General. No person in the United States shall, on the ground...

  5. 49 CFR 195.262 - Pumping equipment.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Pumping equipment. 195.262 Section 195.262... PIPELINE Construction § 195.262 Pumping equipment. (a) Adequate ventilation must be provided in pump... warn of the presence of hazardous vapors in the pumping station building. (b) The following must...

  6. 21 CFR 137.195 - Crushed wheat.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Crushed wheat. 137.195 Section 137.195 Food and... Related Products § 137.195 Crushed wheat. Crushed wheat, coarse ground wheat, is the food prepared by so crushing cleaned wheat other than durum wheat and red durum wheat that, when tested by the...

  7. 49 CFR 195.108 - External pressure.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false External pressure. 195.108 Section 195.108... PIPELINE Design Requirements § 195.108 External pressure. Any external pressure that will be exerted on the pipe must be provided for in designing a pipeline system....

  8. 49 CFR 195.420 - Valve maintenance.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Valve maintenance. 195.420 Section 195.420 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... PIPELINE Operation and Maintenance § 195.420 Valve maintenance. (a) Each operator shall maintain each...

  9. 49 CFR 195.111 - Fracture propagation.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Fracture propagation. 195.111 Section 195.111... PIPELINE Design Requirements § 195.111 Fracture propagation. A carbon dioxide pipeline system must be designed to mitigate the effects of fracture propagation....

  10. 49 CFR 195.408 - Communications.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Communications. 195.408 Section 195.408... PIPELINE Operation and Maintenance § 195.408 Communications. (a) Each operator must have a communication... system. (b) The communication system required by paragraph (a) of this section must, as a...

  11. 49 CFR 195.440 - Public awareness.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Public awareness. 195.440 Section 195.440 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... PIPELINE Operation and Maintenance § 195.440 Public awareness. (a) Each pipeline operator must develop...

  12. 32 CFR 195.7 - Compliance information.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Compliance information. 195.7 Section 195.7... TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 195.7 Compliance information. (a) Cooperation and assistance... at such times, and in such form and containing such information, as the responsible...

  13. 49 CFR 195.224 - Welding: Weather.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Welding: Weather. 195.224 Section 195.224 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... PIPELINE Construction § 195.224 Welding: Weather. Welding must be protected from weather conditions...

  14. 49 CFR 195.102 - Design temperature.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Design temperature. 195.102 Section 195.102... PIPELINE Design Requirements § 195.102 Design temperature. (a) Material for components of the system must be chosen for the temperature environment in which the components will be used so that the...

  15. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  16. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  17. 27 CFR 1.95 - General.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false General. 1.95 Section 1.95 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BASIC PERMIT REQUIREMENTS UNDER THE FEDERAL ALCOHOL ADMINISTRATION ACT, NONINDUSTRIAL...

  18. Labelling prospects of astatine-211 with immunoglobulins (IgG): some general considerations

    International Nuclear Information System (INIS)

    The tumour therapeutic potential of the short lived alpha emitting radiohalogen 211At has been already been well recognised in the field of radioimmuno therapy. There is no evidence as such to show that astatine itself is a tumour seeking isotope. Therefore it has to be tagged to tumour seeking compound such as a drug or a protein preferably an antibody (IgG). In this communication, the labelling parameters which are required to be investigated for obtaining a stable product which could be useful as radioimmuno therapeutic agent, are described. (author). 6 refs

  19. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron anity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photodetachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral linewidth of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in o-line tests by the clear observation of the photodetachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148 [1].

  20. Extraction of 211At-astatine from hydrochloric acid solutions by means of TOPO, TBP, and triphenylphosphine

    International Nuclear Information System (INIS)

    The extraction behaviour of astatine was studied under defined conditions from hydrochloride acid solutions (cHCl>0.1 M or 1 and 2M). Therefore other effects like adsorption, reduction or hydrolysis can be excluded. The present work describes the extraction with tri- n- octylphosphinoxide (TOPO), tri- n-butylphosphate (TBP) and tri-phenylphosphine in chloroform. (orig.)

  1. No-carrier-added astatination of N-succinimidyl-3-(tri-n-butylstannyl) benzoate (ATE) via electrophilic destannylation

    International Nuclear Information System (INIS)

    The no-carrier-added synthesis of N-succinimidyl 3-[211At]astato-benzoate from N-succinimidyl 3-(tri-n-butylstannyl)benzoate (ATE) is described. The nature of the solvent in which the 211At was isolated from the target was an important factor influencing both the radiochemical yields and the nature of the incorporated astatine activity. (orig.)

  2. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    211At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At- to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At- anions, but first of all because of the kinetic inertness of low spin rhodium(III) d6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh3+. The experiments related to optimization of the reaction conditions were performed with the 131I, basing on a chemical similarity of I- to At-. The experiments with 211At were then carried out under the conditions found optimal for I-. The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211At-Rh(16-S4-diol) complex

  3. 49 CFR 195.214 - Welding procedures.

    Science.gov (United States)

    2010-10-01

    ... accordance with welding procedures qualified under Section 5 of API 1104 or Section IX of the ASME Boiler and Pressure Vessel Code (incorporated by reference, see § 195.3) . The quality of the test welds used...

  4. Dicty_cDB: SLB195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB195 (Link to dictyBase) - - - Contig-U16455-1 SLB195Z (Link... to Original site) - - SLB195Z 709 - - - - Show SLB195 Library SL (Link to library) Clone ID SLB195 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLB1-D/SLB195Q.Seq.d/ Representative seq. ID SLB19...5Z (Link to Original site) Representative DNA sequence >SLB195 (SLB195Q) /CSM/SL/SLB1-D/SLB195Q.Seq.d/ XXXXX... ) Dictyostelium discoideum slug cDNA, clone SLE193. 1298 0.0 1 ( AU034146 ) Dictyostelium discoideum slug cDNA, clone SLB

  5. 49 CFR 195.208 - Welding of supports and braces.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Welding of supports and braces. 195.208 Section 195.208 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS... HAZARDOUS LIQUIDS BY PIPELINE Construction § 195.208 Welding of supports and braces. Supports or braces...

  6. 49 CFR 195.226 - Welding: Arc burns.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Welding: Arc burns. 195.226 Section 195.226 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... PIPELINE Construction § 195.226 Welding: Arc burns. (a) Each arc burn must be repaired. (b) An arc burn...

  7. 49 CFR 195.212 - Bending of pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Bending of pipe. 195.212 Section 195.212... PIPELINE Construction § 195.212 Bending of pipe. (a) Pipe must not have a wrinkle bend. (b) Each field bend must comply with the following: (1) A bend must not impair the serviceability of the pipe. (2)...

  8. 49 CFR 195.207 - Transportation of pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Transportation of pipe. 195.207 Section 195.207... PIPELINE Construction § 195.207 Transportation of pipe. (a) Railroad. In a pipeline operated at a hoop stress of 20 percent or more of SMYS, an operator may not use pipe having an outer diameter to...

  9. 49 CFR 195.406 - Maximum operating pressure.

    Science.gov (United States)

    2010-10-01

    ... pressure that exceeds any of the following: (1) The internal design pressure of the pipe determined in... 49 Transportation 3 2010-10-01 2010-10-01 false Maximum operating pressure. 195.406 Section 195... HAZARDOUS LIQUIDS BY PIPELINE Operation and Maintenance § 195.406 Maximum operating pressure. (a) Except...

  10. 46 CFR 195.05-1 - Installation and details.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Installation and details. 195.05-1 Section 195.05-1... § 195.05-1 Installation and details. (a) The installation of all systems of an electrical engineering or interior communication nature, together with the details of design, construction, and installation shall...

  11. 49 CFR 195.404 - Maps and records.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Maps and records. 195.404 Section 195.404... PIPELINE Operation and Maintenance § 195.404 Maps and records. (a) Each operator shall maintain current maps and records of its pipeline systems that include at least the following information: (1)...

  12. 42 CFR 84.195 - Breathing tubes; minimum requirements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Breathing tubes; minimum requirements. 84.195 Section 84.195 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL... Cartridge Respirators § 84.195 Breathing tubes; minimum requirements. Flexible breathing tubes used...

  13. 49 CFR 195.308 - Testing of tie-ins.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Testing of tie-ins. 195.308 Section 195.308 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... PIPELINE Pressure Testing § 195.308 Testing of tie-ins. Pipe associated with tie-ins must be...

  14. Unexpected Behavior of the Heaviest Halogen Astatine in the Nucleophilic Substitution of Aryliodonium Salts.

    Science.gov (United States)

    Guérard, François; Lee, Yong-Sok; Baidoo, Kwamena; Gestin, Jean-François; Brechbiel, Martin W

    2016-08-22

    Aryliodonium salts have become precursors of choice for the synthesis of (18) F-labeled tracers for nuclear imaging. However, little is known on the reactivity of these compounds with heavy halides, that is, radioiodide and astatide, at the radiotracer scale. In the first comparative study of radiohalogenation of aryliodonium salts with (125) I(-) and (211) At(-) , initial experiments on a model compound highlight the higher reactivity of astatide compared to iodide, which could not be anticipated from the trends previously observed within the halogen series. Kinetic studies indicate a significant difference in activation energy (Ea =23.5 and 17.1 kcal mol(-1) with (125) I(-) and (211) At(-) , respectively). Quantum chemical calculations suggest that astatination occurs via the monomeric form of an iodonium complex whereas iodination occurs via a heterodimeric iodonium intermediate. The good to excellent regioselectivity of halogenation and high yields achieved with diversely substituted aryliodonium salts indicate that this class of compounds is a promising alternative to the stannane chemistry currently used for heavy radiohalogen labeling of tracers in nuclear medicine. PMID:27305065

  15. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  16. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  17. Usefulness and performance of the Au-195m generator

    International Nuclear Information System (INIS)

    Clinical usefulness of the Au-195m generator has been confirmed in several countries. The principal advantages are the reduction of patient radiation exposure and the possibilities of multiple, background-free, sequential evaluations of left and right ventricular function, both at rest and during exercise. Gold-195m has a half-life of 30.5 sec and is generator-produced from Hg-195m (T 1/2 = 41.6 hr). Mercury-195m is cyclotron produced from an Au-197 target by the (p,3n) reaction during bombardment with 28.5 Mev protons. Mercury-195m decays by electron capture 45.8% of the time to Au-195m; 262 keV gammas are used for imaging. Breakthrough of the parent Hg-195m has two negative effects, since it increases patient exposure and degrades image quality due to high energy gammas. The breakthrough is 0.75 + or - 0.09 μCi of Hg/mCi of Au-195m. The reproducibility of elution has a coefficient of variation of 2.5 + or - 0.3%. The eluates were sterile and pyrogen-free. The yield of the generator is 20-30 mCi of Au-195m from 155 mCi of Hg-195m generator. The short half-life of Au-195m offers the potential of frequent background-free determinations of left ventricular function which offer additional use for evaluation of left ventricular ejection fraction and volume indices. Rapid acquisition of data from varying levels of exercise, frequent assessment of pharmacologic and physiologic interventions and simultaneous acquisitions of data using more than one radionuclide become readily feasible with agents such as Au-195m

  18. Dicty_cDB: CHP195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP195 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) CHP195F 138 - - - - - - Show CHP195 Library CH (Link to library) Clone ID CHP195 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...qilkvstnk**IKNYYVNRVYEIIIIINICTYKKK--- Translated Amino Acid sequence (All Frames) Frame A: tvgllvfsnt*gink*...iin*kllck*sl*nnnynkymyi*kk--- Frame B: llaywffqilkvstnk**IKNYYVNRVYEIIIIINICTYKKK--- Frame C: cwptgffkylryqq

  19. Dicty_cDB: AFI195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFI195 (Link to dictyBase) - - - Contig-U16373-1 AFI195P (Link to Original ... VLIRVGTIHTFITFGAGCRIGKNLILVSKHVXHHSTFPQDKIIFNVGIXIPS KW --- ---DQTDLALLEIIDYDSIHHLNSNNNSISSSGSINSKESIKSSGG ... VLIRVGTIHTFITFGAGCRIGKNLILVSKHVXHHSTFPQDKIIFNVGIXIPS KW --- ---ikli*ly*kllimiqfii*iliiivlvvvvvlivknq*kvvvv ... fnssfkf****y***w*y***rinkk*www**i**qi*kskttt **kr**skw ***q****kfk*kpyck***iyitii*lssfr*irkgkretrl*nhl*y*t ...

  20. 19 CFR 10.195 - Country of origin criteria.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Country of origin criteria. 10.195 Section 10.195... Country of origin criteria. (a) Articles produced in a beneficiary country—(1) General. Except as provided... the country of origin of the article or material. (b) Commonwealth of Puerto Rico and U.S....

  1. 46 CFR 174.195 - Bulkheads in machinery spaces.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Bulkheads in machinery spaces. 174.195 Section 174.195... in machinery spaces. (a) The bulkhead in each machinery space of each OSV must be watertight to the bulkhead deck. (b) Each penetration of, and each opening in, a bulkhead in a machinery space must— (1)...

  2. 46 CFR 195.03-1 - Installation and details.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Installation and details. 195.03-1 Section 195.03-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS VESSEL... details. (a) The installation of all systems of a marine engineering nature, together with the details...

  3. 46 CFR 154.195 - Aluminum cargo tank: Steel enclosure.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Aluminum cargo tank: Steel enclosure. 154.195 Section... Equipment Hull Structure § 154.195 Aluminum cargo tank: Steel enclosure. (a) An aluminum cargo tank and its... the aluminum cargo tank must meet the steel structural standards of the American Bureau of...

  4. 40 CFR 160.195 - Retention of records.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Retention of records. 160.195 Section 160.195 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS GOOD... used to support an application for a research or marketing permit approved by EPA, the period...

  5. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  6. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  7. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  8. Dipole bands in the oblate-shaped {sup 195}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Kaci, M. [Paris-11 Univ., 91 - Orsay (France). Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse; Porquet, M.G. [Paris-11 Univ., 91 - Orsay (France). Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse; Hannachi, F. [Paris-11 Univ., 91 - Orsay (France). Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse; Aiche, M. [Paris-11 Univ., 91 - Orsay (France). Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse; Bastin, G. [Paris-11 Univ., 91 - Orsay (France). Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse; Deloncle, I. [Paris-11 Univ., 91 - Orsay (France). Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse; Gall, B.J.P. [Paris-11 Univ., 91 - Orsay (France). Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse; Schueck, C. [Paris-11 Univ., 91 - Orsay (France). Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse; Azaiez, F. [Institut de Physique Nucleaire (IPN), 91 - Orsay (France); Beausang, C.W. [Liverpool Univ. (United Kingdom). Oliver Lodge Lab.; Bourgeois, C. [Institut de Physique Nucleaire (IPN), 91 - Orsay (France); Clark, R.M. [York Univ. (United Kingdom). Dept. of Physics; Duffait, R. [Lyon-1 Univ., 69 - Villeurbanne (France). Inst. de Physique Nucleaire; Duprat, J. [Institut de Physique Nucleaire (IPN), 91 - Orsay (France); Hauschild, K. [York Univ. (United Kingdom). Dept. of Physics; Joyce, M.J. [Liverpool Univ. (United Kingdom). Oliver Lodge Lab.; Korichi, A. [Institut de Physique Nucleaire (IPN), 91 - Orsay (France); Le Coz, Y. [Lyon-1 Univ., 69 - Villeurbanne (France). Inst. de Physique Nucleaire; Meyer, M. [Lyon-1 Univ., 69 - Villeurbanne (France). Inst. de Physique Nucleaire; Paul, E.S. [Liverpool Univ. (United Kingdom). Oliver Lodge Lab.; Perrin, N. [Institut de Physique Nucleaire (IPN), 91 - Orsay (France); Poffe, N. [Institut de Physique Nucleaire (IPN), 91 - Orsay (France)]|[Oxford Univ. (United Kingdom). Dept. of Physics

    1996-04-01

    The nucleus {sup 195}Pb has been populated with the {sup 184}W+{sup 16}O reaction at 113 MeV. Two dipole {gamma}-ray cascades have been observed using the EUROGAM spectrometer. A comprehensive level scheme related to these structures has been established. Multiparticle configurations are attributed to these high-spin structures from detailed comparison with the neighbouring nuclei, {sup 193}Hg, {sup 194}Pb and {sup 195}Tl. Band crossings due to i13/2 neutron pair breaking are observed in {sup 195}Pb at about the same frequencies as in the isotone {sup 193}Hg. (orig.)

  9. Dipole bands in the oblate-shaped 195Pb

    International Nuclear Information System (INIS)

    The nucleus 195Pb has been populated with the 184W+16O reaction at 113 MeV. Two dipole γ-ray cascades have been observed using the EUROGAM spectrometer. A comprehensive level scheme related to these structures has been established. Multiparticle configurations are attributed to these high-spin structures from detailed comparison with the neighbouring nuclei, 193Hg, 194Pb and 195Tl. Band crossings due to i13/2 neutron pair breaking are observed in 195Pb at about the same frequencies as in the isotone 193Hg. (orig.)

  10. Dicty_cDB: VSF195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s**tncikkshrkwytnfggf*ren f*ifn*rikk*rssskirdsftrpiyersydnt*iiypti*nw*tncwicyw*sy...791( CP001022 |pid:none) Exiguobacterium sibiricum 255-15... 184 2e-60 AM295250_1683( AM295250 |pid:none) St...Contig-U14685-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSF1-...ksrls ikvfsr*lhygsftmai*ihlqfkqsick*nrynisaigiiplsfgyg--- ---rrtktr*nhgnqrcsrcsrsigrsnw*nqrlqscryrrfrredkihrr*ir... Sequences producing significant alignments: (bits) Value VSF195 (VSF195Q) /CSM/VS/VSF1-D/VSF195Q.Seq.d/ 185

  11. Development of a reliable Hg-195m--Au-195m generator for the production of Au-195m, a short-lived nuclide for vascular imaging.

    Science.gov (United States)

    Brihaye, C; Guillaume, M; Lavi, N; Cogneau, M

    1982-12-01

    A new mercury-195m (T1/2: 41 hr) leads to gold-195m (T1/2: 30.6 sec) generator suitable for first-pass as well as steady-state radionuclide angiography studies has been developed. The distribution coefficients, Kd, for mercury (Hg-195m) and gold (Au-196), experimentally evaluated on chelating resin Chelex 100, showed this resin to be suitable as the column packing. Mercury-195m in a Trisma buffer solution at pH 7.40 was loaded on a chelating resin Chelex 100 column, together with gold carrier. Au-195m was eluted with an aqueous solution of 5% glucose in a 0.01M Trisma buffer at pH 7.70 (25 degrees C). Chemical assessment of the eluate has ensured that the eluted carrier-free gold is by no means colloidal: 80% is found in an ionic form, 20% as an uncharged species. Safe clinical use for routine diagnosis in humans is possible. PMID:7143093

  12. Electrolyte Assisted Sono-Electrochemical Decomposition of Reactive Red 195

    International Nuclear Information System (INIS)

    Untreated textile wastewater causes serious environmental impacts due to the presence of unfixed dyes. A commonly used Reactive Red (RR) 195 dye is significantly discharged in textile effluents thus enhancing water pollution. Therefore, the current research was conducted for the treatment of reactive dye RR 195 by electrolyte assisted electrochemical process at various process conditions i.e, initial dye concentrations, pH, and concentration of supporting electrolyte (NaCl). The decomposition of dye and color removal was analyzed using UV-Vis spectrophotometer. The results indicated that pH and NaCl were playing an important role in the degradation of RR 195. It was observed that 95.4% of dye was decomposed using 1.5 g/L NaCl at pH 3 after 25 min. Kinetics studies showed that degradation of RR195 apparently followed second order reaction. The electrical energy consumption was found to be 6.11 Whm/sup -3/ for dye effluent at 100 Am/sup -2/ current density. For the justification of findings in experimental results Bayesian regression analysis was used to determine the effect of NaCl, pH and dye concentration on degeneration of RR195. It was observed that NaCl had positive impact whereas pH and dye concentration had negative impact on degeneration of RR195. (author)

  13. Ressonância magnética nuclear de platina-195 em compostos organometálicos Platinum-195 nuclear magnetic resonance of organometallic compounds

    Directory of Open Access Journals (Sweden)

    Cleber Vinicius Ursini

    1997-02-01

    Full Text Available A brief review of 195Pt NMR is presented, focusing organometallic compounds. This article gives initially basic information of NMR processes involving 195Pt nucleus. It is followed by a discussion of the factors which affect the chemical shifts and coupling constants. Finally, some aspects of 195Pt NMR of solids are commented.

  14. Stability and in vivo behavior of Rh[16aneS4-diol]211At complex: A potential precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Introduction: The heavy halogen 211At is of great interest for targeted radiotherapy because it decays by the emission of short-range, high-energy α-particles. However, many astatine compounds that have been synthesized are unstable in vivo, providing motivation for seeking other 211At labeling strategies. One relatively unexplored approach is to utilize prosthetic groups based on astatinated rhodium (III) complex stabilized with a tetrathioether macrocyclic ligand – Rh[16aneS4-diol]211At. The purpose of the current study was to evaluate the in vitro and in vivo stability of this complex in comparison to its iodine analog – Rh[16aneS4-diol]131I. Methods: Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I complexes were synthesized and purified by HPLC. The stability of both complexes was evaluated in vitro by incubation in phosphate-buffered saline (PBS) and human serum at different temperatures. The in vivo behavior of the two radiohalogenated complexes was assessed by a paired-label biodistribution study in normal Balb/c mice. Results: Both complexes were synthesized in high yield and purity. Almost no degradation was observed for Rh[16aneS4-diol]131I in PBS over a 72 h incubation. The astatinated analog exhibited good stability in PBS over 14 h. A slow decline in the percentage of intact complex was observed for both tracers in human serum. In the biodistribution study, retention of 211At in most tissues was higher than that of 131I at all time points, especially in spleen and lungs. Renal clearance of Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I predominated, with 84.1 ± 2.3% and 94.6 ± 0.9% of injected dose excreted via the urine at 4 h. Conclusions: The Rh[16aneS4-diol]211At complex might be useful for constructing prosthetic groups for the astatination of biomolecules and further studies are planned to evaluate this possibility

  15. 14 CFR 61.195 - Flight instructor limitations and qualifications.

    Science.gov (United States)

    2010-01-01

    ... Instructors Other than Flight Instructors With a Sport Pilot Rating § 61.195 Flight instructor limitations and...) Training for night vision goggle operations. A flight instructor may not conduct training for night vision... his or her pilot certificate for the aircraft; (3) Is pilot in command qualified for night...

  16. 49 CFR 195.446 - Control room management.

    Science.gov (United States)

    2010-10-01

    ... by performing each of the following: (1) Implement API RP 1165 (incorporated by reference, see § 195... certain provisions of API RP 1165 are not practical for the SCADA system used; (2) Conduct a point-to...; (3) Test and verify an internal communication plan to provide adequate means for manual operation...

  17. A new high-spin isomer in 195Bi

    Science.gov (United States)

    Roy, T.; Mukherjee, G.; Madhavan, N.; Rana, T. K.; Bhattacharya, Soumik; Asgar, Md. A.; Bala, I.; Basu, K.; Bhattacharjee, S. S.; Bhattacharya, C.; Bhattacharya, S.; Bhattacharyya, S.; Gehlot, J.; Ghugre, S. S.; Gurjar, R. K.; Jhingan, A.; Kumar, R.; Muralithar, S.; Nath, S.; Pai, H.; Palit, R.; Raut, R.; Singh, R. P.; Sinha, A. K.; Varughese, T.

    2015-11-01

    A new high-spin isomer has been identified in 195Bi at the focal plane of the HYbrid Recoil mass Analyser (HYRA) used in the gas-filled mode. The fusion evaporation reactions 169Tm (30Si, x n) 193, 195Bi were used with the beam energies on targets of 168 and 146MeV for 6n and 4n channels, respectively. The evaporation residues, separated from the fission fragments, and their decays were detected at the focal plane of HYRA using MWPC, Si-Pad and clover HPGe detectors. The half-life of the new isomer in 195Bi has been measured to be 1.6(1)μs. The configuration of the new isomer has been proposed and compared with the other isomers in this region. The Total Routhian Surface (TRS) calculations for the three-quasiparticle configurations corresponding to the new isomer suggest an oblate deformation for this isomeric state. The same calculations for different configurations in 195Bi and for the even-even 194Pb core indicate that the proton i 13/2 orbital has a large shape driving effect towards oblate shape in these nuclei.

  18. 49 CFR 195.248 - Cover over buried pipeline.

    Science.gov (United States)

    2010-10-01

    ... MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Construction § 195.248 Cover over buried pipeline. (a) Unless specifically... the pipe and the ground level, road bed, river bottom, or underwater natural bottom (as determined...

  19. A new high-spin isomer in {sup 195}Bi

    Energy Technology Data Exchange (ETDEWEB)

    Roy, T.; Mukherjee, G.; Rana, T.K.; Bhattacharya, Soumik; Asgar, Md.A.; Bhattacharya, C.; Bhattacharya, S.; Bhattacharyya, S.; Pai, H. [Variable Energy Cyclotron Centre, Kolkata (India); Madhavan, N.; Bala, I.; Gehlot, J.; Gurjar, R.K.; Jhingan, A.; Kumar, R.; Muralithar, S.; Nath, S.; Singh, R.P.; Varughese, T. [Inter University Acclerator Centre, New Delhi (India); Basu, K.; Bhattacharjee, S.S.; Ghugre, S.S.; Raut, R.; Sinha, A.K. [UGC-DAE-CSR Kolkata Centre, Kolkata (India); Palit, R. [Tata Institute of Fundamental Research, Department of Nuclear and Atomic Physics, Mumbai (India)

    2015-11-15

    A new high-spin isomer has been identified in {sup 195}Bi at the focal plane of the HYbrid Recoil mass Analyser (HYRA) used in the gas-filled mode. The fusion evaporation reactions {sup 169}Tm ({sup 30}Si, x n) {sup 193,} {sup 195}Bi were used with the beam energies on targets of 168 and 146MeV for 6n and 4n channels, respectively. The evaporation residues, separated from the fission fragments, and their decays were detected at the focal plane of HYRA using MWPC, Si-Pad and clover HPGe detectors. The half-life of the new isomer in {sup 195}Bi has been measured to be 1.6(1) μs. The configuration of the new isomer has been proposed and compared with the other isomers in this region. The Total Routhian Surface (TRS) calculations for the three-quasiparticle configurations corresponding to the new isomer suggest an oblate deformation for this isomeric state. The same calculations for different configurations in {sup 195}Bi and for the even-even {sup 194}Pb core indicate that the proton i{sub 13/2} orbital has a large shape driving effect towards oblate shape in these nuclei. (orig.)

  20. Production and clinical use of 195Ausup(m)

    International Nuclear Information System (INIS)

    A practical 195Hgsup(m)/195Ausup(m) generator has been developed, primarily for first-pass nuclear angiography from a peripheral intravenous injection but which can be used also for myocardial perfusion studies by a catheter technique. The parent 195Hgsup(m) is prepared by the 197Au(p,3n)195Hgsup(m) reaction, the bombarding energy being 34 MeV and the yield being approximately 170 MBq/μA.h at the end of bombardment. The 195Hgsup(m) is separated by evaporation and collection in 10% nitric acid and is buffered with sodium acetate. The generator is of the chromatographic column design, currently using a controlled pore glass support lipoamide column with 2.5 mmol sodium cyanide solution as the eluant; the elution efficiency is approximately 25%. For specific activities above 40 MBq/mg, the elution efficiency decreases markedly as a function of time after column preparation; this has been shown to be the result of radiolytic reactions and may be suppressed by the addition of radical scavengers. Following administration of up to 20 mL of eluate to patients, no changes were found in heart rate, blood pressure, electrocardiogram or blood gases. Plasma cyanide, red cell cyanide and plasma thiocyanate levels did not rise above the normal ranges for non-smokers. The radiation doses received from six first-pass angiograms (a total of 4800 MBq of 195Ausup(m)) are 1 mSv to the heart and 1.9 mSv to the kidneys (of which 1.7 mSv is due to 195Hgsup(m) breakthrough). The whole-body dose is estimated to be 0.08 mSv. The generator has been used to carry out rapid sequential first-pass studies during physiological and pharmacological stress of the cardiovascular system. Ejection fractions from 8 to 67% have been measured, with an excellent correlation against 99Tcsup(m) values. Over 1500 patient studies have been carried out without any demonstrable side-effects. (author)

  1. 49 CFR 195.587 - What methods are available to determine the strength of corroded pipe?

    Science.gov (United States)

    2010-10-01

    ... strength of corroded pipe? 195.587 Section 195.587 Transportation Other Regulations Relating to... methods are available to determine the strength of corroded pipe? Under § 195.585, you may use the... Pipe (with RSTRENG disk),” to determine the strength of corroded pipe based on actual remaining...

  2. 49 CFR 195.557 - Which pipelines must have coating for external corrosion control?

    Science.gov (United States)

    2010-10-01

    ... corrosion control? 195.557 Section 195.557 Transportation Other Regulations Relating to Transportation...) PIPELINE SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Corrosion Control § 195.557 Which pipelines must have coating for external corrosion control? Except bottoms of aboveground breakout tanks,...

  3. 49 CFR 195.561 - When must I inspect pipe coating used for external corrosion control?

    Science.gov (United States)

    2010-10-01

    ... corrosion control? 195.561 Section 195.561 Transportation Other Regulations Relating to Transportation...) PIPELINE SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Corrosion Control § 195.561 When must I inspect pipe coating used for external corrosion control? (a) You must inspect all external pipe...

  4. 28 CFR 0.195 - Procedure with respect to jurisdictional disagreements.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Procedure with respect to jurisdictional disagreements. 0.195 Section 0.195 Judicial Administration DEPARTMENT OF JUSTICE ORGANIZATION OF THE DEPARTMENT OF JUSTICE Jurisdictional Disagreements § 0.195 Procedure with respect to...

  5. 28 CFR 19.5 - Report to the Office of Juvenile Justice and Delinquency Prevention.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Report to the Office of Juvenile Justice and Delinquency Prevention. 19.5 Section 19.5 Judicial Administration DEPARTMENT OF JUSTICE USE OF PENALTY MAIL IN THE LOCATION AND RECOVERY OF MISSING CHILDREN § 19.5 Report to the Office of...

  6. 26 CFR 1.195-1 - Election to amortize start-up expenditures.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Election to amortize start-up expenditures. 1.195-1 Section 1.195-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Itemized Deductions for Individuals and Corporations (continued) § 1.195-1 Election to amortize...

  7. 26 CFR 1.195-1T - Election to amortize start-up expenditures (temporary).

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Election to amortize start-up expenditures (temporary). 1.195-1T Section 1.195-1T Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Itemized Deductions for Individuals and Corporations (continued) § 1.195-1T Election to...

  8. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D., Scott

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  9. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    International Nuclear Information System (INIS)

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET α-emitter astatine-211 (211At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 (123I), 340-fold for technetium-99m pertechnetate (99mTcO4-) and 60-fold for 211At. Cellular 211At accumulation was found to be dependent on extracellular Na+ ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and 99mTcO4- uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated 211At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and 211At were rapidly (apparent t1/2 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times (123I), 25 times (99mTcO4-) and 10 times (211At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of 123I and 211At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for 123I, 5.2 h for 211At) and preliminary dosimetric calculations indicate high tumour absorbed doses (3.5 Gy/MBqtumour for 131I and 50.3 Gy/MBqtumour for 211At). In

  10. A new generator for production of short-lived Au-195m radioisotope

    International Nuclear Information System (INIS)

    A generator has been developed to produce multimillicurie amounts of 30.6 second Au-195m. Gold-195m, a daughter isotope of 41.6 hour Hg-195m, is eluted as neutral and sterile sodium thiosulphatoaurate(I) complex, and as such, is indicated for dynamic studies in cardiology. Mercury-195m is produced by irradiation of gold targets with 28 MeV protons, yielding by the (p,3n) nuclear reaction Hg-195m and Hg-195 (9.9 hours) at rates of 4.6 and 12 mCi/μAh, respectively. Mercury is separated from irradiated gold by distillation and collection in nitric acid. This solution is neutralized and loaded on a column of silica gel modified with metallic sulphide. Columns are eluted at 3-5 minute intervals with a solution containing 29.8 mg/ml sodium thiosulphate, pentahydrate and 10 mg/ml sodium nitrate. Yields of Au-195m vary between 24-45% of theory, depending on the total Hg activity and the generator production method. Gold-195m is obtained in 3-4 seconds by eluting with 2 ml under pressure. Contamination of the eluate with mercury isotopes decreases after about 20 elutions to 0.4 - 0.8 μCi Hg-195m/ mCi Au-195m

  11. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    Energy Technology Data Exchange (ETDEWEB)

    Petrich, T.; Helmeke, H.-J.; Meyer, G.J.; Knapp, W.H.; Poetter, E. [Department of Nuclear Medicine, Medizinische Hochschule Hannover (Germany)

    2002-07-01

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET {alpha}-emitter astatine-211 ({sup 211}At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 ({sup 123}I), 340-fold for technetium-99m pertechnetate ({sup 99m}TcO{sub 4}{sup -}) and 60-fold for {sup 211}At. Cellular {sup 211}At accumulation was found to be dependent on extracellular Na{sup +} ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and {sup 99m}TcO{sub 4}{sup -} uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated {sup 211}At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and {sup 211}At were rapidly (apparent t{sub 1/2} 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times ({sup 123}I), 25 times ({sup 99m}TcO{sub 4}{sup -}) and 10 times ({sup 211}At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of {sup 123}I and {sup 211}At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for {sup 123}I, 5.2 h for {sup 211}At) and

  12. Studies of {sup 194,195,197}Po

    Energy Technology Data Exchange (ETDEWEB)

    Carpenter, M.P.; Ahmad, I.; Crowell, B. [and others

    1995-08-01

    The energy systematics of low-lying polonium states show sudden changes near N = 114. The observed drops in the low-lying levels of {sup 196,198}Po relative to the heavier isotopes indicate significant changes in the underlying structure of these nuclei. It is thought that this change is due to the onset of vibrational collectivity brought about by the quadrupole interaction between neutron and proton-pairs. In order to extend the Po systematics even further, we measured, for the first time, states in {sup 194,195,197}Po using the {sup 28}Si + {sup 170}Yb reaction at a beam energy of 142 MeV. The beam was supplied by ATLAS, and the data were taken with 10 Compton-suppressed Ge detectors placed at the target position of the Fragment Mass Analyzer. Preliminary level schemes were constructed for {sup 194,195,197}Po based on {gamma}-{gamma} and {gamma}-FMA coincidences. The results for {sup 194}Po show that the 2{sup +} - 0{sup +} transition energy decreased in energy by 140 keV relative to {sup 196}Po suggesting that this nucleus moved beyond the vibrational limit to more collective motion. An extrapolation of the systematics predicts that the 2{sup +} energy could drop another 140 keV between {sup 194}Po and {sup 192}Po which would indicate the onset of rotational motion. Currently, we have an approved experiment to investigate the decay of yrast isomers in {sup 194}Po which will allow us to (1) confirm our earlier level scheme of {sup 194}Po, and (2) assess the experimental conditions needed for a future study of {sup 192}Po.

  13. 49 CFR 195.583 - What must I do to monitor atmospheric corrosion control?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false What must I do to monitor atmospheric corrosion control? 195.583 Section 195.583 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY TRANSPORTATION OF...

  14. 46 CFR 195.07-10 - Lakes, bays, and sounds, or river service.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Lakes, bays, and sounds, or river service. 195.07-10 Section 195.07-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH... Lakes, bays, and sounds, or river service. (a) Vessels in lakes, bays, and sounds, or river...

  15. 46 CFR 195.07-5 - Ocean, coastwise, or Great Lakes service.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Ocean, coastwise, or Great Lakes service. 195.07-5 Section 195.07-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH... Ocean, coastwise, or Great Lakes service. (a) Vessels in ocean, coastwise, or Great Lakes service...

  16. 49 CFR 195.579 - What must I do to mitigate internal corrosion?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false What must I do to mitigate internal corrosion? 195... SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Corrosion Control § 195.579 What must I do to mitigate internal corrosion? (a) General. If you transport any hazardous liquid or carbon dioxide...

  17. 49 CFR 195.4 - Compatibility necessary for transportation of hazardous liquids or carbon dioxide.

    Science.gov (United States)

    2010-10-01

    ... hazardous liquids or carbon dioxide. 195.4 Section 195.4 Transportation Other Regulations Relating to... necessary for transportation of hazardous liquids or carbon dioxide. No person may transport any hazardous liquid or carbon dioxide unless the hazardous liquid or carbon dioxide is chemically compatible with...

  18. Development of a reliable /sup 195m/Hg--/sup 195m/Au, generator for the production of /sup 195m/Au, a short-lived nuclide for vascular imaging

    International Nuclear Information System (INIS)

    A new /sup 195m/Hg (T1/2: 41 hr) leads to /sup 195m/Au (T1/2: 30.6 sec) generator suitable for first-pass as well as steady-state radionuclide angiography studies has been developed. The distribution coefficients, Kd, for mercury (/sup 195m/Hg) and gold (/sup 196m/Au), experimentally evaluated on chelating resin Chelex 100, showed this resin to be suitable as the column packing. /sup 195m/Hg in a Trisma buffer solution at pH 7.40 was loaded on a chelating resin Chelex 100 column, together with gold carrier. /sup 195m/Au was eluted with an aqueous solution of 5% glucose in a 0.01M Trisma buffer at pH 7.70 (25 degrees C). Chemical assessment of the eluate has ensured that the eluted carrier-free gold is by no means colloidal: 80% is found in an ionic form, 20% as an uncharged species. Safe clinical use for routine diagnosis in humans is possible

  19. Role of microRNA-195 in cardiomyocyte apoptosis induced by myocardial ischaemia–reperfusion injury

    Indian Academy of Sciences (India)

    Chang-Kui Gao; Hui Liu; Cheng-Ji Cui; Zhao-Guang Liang; Hong Yao; Ye Tian

    2016-03-01

    This study aims to investigate microRNA-195 (miR-195) expression in myocardial ischaemia–reperfusion (I/R) injury and the roles of miR-195 in cardiomyocyte apoptosis though targeting Bcl-2. A mouse model of I/R injury was established. MiR-195 expression levels were detected by real-time quantitative PCR (qPCR), and the cardiomyocyte apoptosis was detected by TUNEL assay. After cardiomyocytes isolated from neonatal rats and transfected with miR-195 mimic or inhibitor, the hypoxia/reoxygenation (H/R) injury model was established. Cardiomyocyte apoptosis and mitochondrial membrane potential were evaluated using flow cytometry. Bcl-2 and Bax mRNA expressions were detected by RT-PCR. Bcl-2, Bax and cytochrome c (Cyt-c) protein levels were determined by Western blot. Caspase-3 and caspase-9 activities were assessed by luciferase assay. Compared with the sham group, miR-195 expression levels and rate of cardiomyocyte apoptosis increased significantly in I/R group (both < 0.05). Compared to H/R + negative control (NC) group, rate of cardiomyocyte apoptosis increased in H/R + miR-195 mimic group while decreased in H/R + miR-195 inhibitor group (both < 0.05). MiR-195 knockdown alleviated the loss of mitochondrial membrane potential ( < 0.05). MiR-195 overexpression decreased Bcl-2 mRNA and protein expression, increased BaxmRNA and protein expression, Cyt-c protein expression and caspase-3 and caspase-9 activities (all < 0.05). While, downregulated MiR-195 increased Bcl-2 mRNA and protein expression, decreased Bax mRNA and protein expression, Cyt-c protein expression and caspase-3 and caspase-9 activities (all < 0.05). Our study identified that miR-195 expression was upregulated in myocardial I/R injury, and miR-195 overexpression may promote cardiomyocyte apoptosis by targeting Bcl-2 and inducing mitochondrial apoptotic pathway.

  20. Generalized immunological recognition of the major merozoite surface antigen (gp195) of Plasmodium falciparum

    Energy Technology Data Exchange (ETDEWEB)

    Chang, S.P.; Hui, G.S.N.; Kato, A.; Siddiqui, W.A. (Univ. of Hawaii, Honolulu (USA))

    1989-08-01

    The antibody response to the Plasmodium falciparum major merozoite surface antigen (gp195) of congenic mouse strains differing in H-2 haplotype has been examined. All seven strains of mice were capable of producing gp195-specific antibodies. Generalized immune recognition of gp195 by mice of diverse H-2 haplotypes distinguished gp195 from the P. falciparum circumsporozoite protein and the 230-kDa and 48/45-kDa gamete surface antigens. However, the H-2 genetic locus appeared to influence the specificity of gp105-specific antibodies. Immunoblot patterns of mouse sera with parasite antigens revealed a complex pattern of reactivity with terminal and intermediate processing fragments of gp195. The majority of immunoblot bands observed were similar for all of the mouse strains; however, there were several strains that additionally recognized a few unique fragments or displayed more intense reactivities with specific processing fragments. These results suggest that while individuals of diverse major histocompatibility complex makeup are capable of recognizing the gp195 antigen, the recognition of specific gp195 B-cell and T-cell epitopes may be under control of the major histocompatibility complex.

  1. 41 CFR 102-37.195 - Does a SASP have to have a donee in mind to request surplus property?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Does a SASP have to have a donee in mind to request surplus property? 102-37.195 Section 102-37.195 Public Contracts and...) Screening and Requesting Property § 102-37.195 Does a SASP have to have a donee in mind to request...

  2. 49 CFR 195.581 - Which pipelines must I protect against atmospheric corrosion and what coating material may I use?

    Science.gov (United States)

    2010-10-01

    ... corrosion and what coating material may I use? 195.581 Section 195.581 Transportation Other Regulations... Corrosion Control § 195.581 Which pipelines must I protect against atmospheric corrosion and what coating... atmosphere, except pipelines under paragraph (c) of this section. (b) Coating material must be suitable...

  3. Comparative genomics of "Dehalococcoides ethenogenes" 195 and an enrichment culture containing unsequenced "Dehalococcoides" strains.

    Science.gov (United States)

    West, Kimberlee A; Johnson, David R; Hu, Ping; DeSantis, Todd Z; Brodie, Eoin L; Lee, Patrick K H; Feil, Helene; Andersen, Gary L; Zinder, Stephen H; Alvarez-Cohen, Lisa

    2008-06-01

    Tetrachloroethene (PCE) and trichloroethene (TCE) are prevalent groundwater contaminants that can be completely reductively dehalogenated by some "Dehalococcoides" organisms. A Dehalococcoides-organism-containing microbial consortium (referred to as ANAS) with the ability to degrade TCE to ethene, an innocuous end product, was previously enriched from contaminated soil. A whole-genome photolithographic microarray was developed based on the genome of "Dehalococcoides ethenogenes" 195. This microarray contains probes designed to hybridize to >99% of the predicted protein-coding sequences in the strain 195 genome. DNA from ANAS was hybridized to the microarray to characterize the genomic content of the ANAS enrichment. The microarray results revealed that the genes associated with central metabolism, including an apparently incomplete carbon fixation pathway, cobalamin-salvaging system, nitrogen fixation pathway, and five hydrogenase complexes, are present in both strain 195 and ANAS. Although the gene encoding the TCE reductase, tceA, was detected, 13 of the 19 reductive dehalogenase genes present in strain 195 were not detected in ANAS. Additionally, 88% of the genes in predicted integrated genetic elements in strain 195 were not detected in ANAS, consistent with these elements being genetically mobile. Sections of the tryptophan operon and an operon encoding an ABC transporter in strain 195 were also not detected in ANAS. These insights into the diversity of Dehalococcoides genomes will improve our understanding of the physiology and evolution of these bacteria, which is essential in developing effective strategies for the bioremediation of PCE and TCE in the environment. PMID:18359838

  4. Durable donor engraftment after radioimmunotherapy using α-emitter astatine-211-labeled anti-CD45 antibody for conditioning in allogeneic hematopoietic cell transplantation.

    Science.gov (United States)

    Chen, Yun; Kornblit, Brian; Hamlin, Donald K; Sale, George E; Santos, Erlinda B; Wilbur, D Scott; Storer, Barry E; Storb, Rainer; Sandmaier, Brenda M

    2012-02-01

    To reduce toxicity associated with external γ-beam radiation, we investigated radioimmunotherapy with an anti-CD45 mAb labeled with the α-emitter, astatine-211 ((211)At), as a conditioning regimen in dog leukocyte antigen-identical hematopoietic cell transplantation (HCT). Dose-finding studies in 6 dogs treated with 100 to 618 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) without HCT rescue demonstrated dose-dependent myelosuppression with subsequent autologous recovery, and transient liver toxicity in dogs treated with (211)At doses less than or equal to 405 μCi/kg. Higher doses of (211)At induced clinical liver failure. Subsequently, 8 dogs were conditioned with 155 to 625 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) before HCT with dog leukocyte antigen-identical bone marrow followed by a short course of cyclosporine and mycophenolate mofetil immunosuppression. Neutropenia (1-146 cells/μL), lymphopenia (0-270 cells/μL), and thrombocytopenia (1500-6560 platelets/μL) with prompt recovery was observed. Seven dogs had long-term donor mononuclear cell chimerism (19%-58%), whereas 1 dog treated with the lowest (211)At dose (155 μCi/kg) had low donor mononuclear cell chimerism (5%). At the end of follow-up (18-53 weeks), only transient liver toxicity and no renal toxicity had been observed. In conclusion, conditioning with (211)At-labeled anti-CD45 mAb is safe and efficacious and provides a platform for future clinical trials of nonmyeloablative transplantation with radioimmunotherapy-based conditioning. PMID:22134165

  5. Radionuclide first-pass angiography using gold-195m and a digital mobile gamma camera

    International Nuclear Information System (INIS)

    This paper describes the evaluation of ventricular function in 25 patients by first-pass radionuclide angiography with the ultrashort-lived radionuclide gold-195m produced by a bedside, mobile /sup 195m/Au//sup 195m/Au generator. A comparison has been made between a stationary, large-field-of-view gamma camera and a digital, mobile, small-field-of-view camera. The suitability of this technique to assess rapid evolutionary changes of ventricular performance is discussed. With examples of applications of nitroglycerin and hydralazine, the ability of this method to monitor the physiological time sequence of ventricular function after interventions is illustrated noninvasively and with lower radiation burden than with conventional techniques

  6. Knockdown of microRNA-195 contributes to protein phosphatase-2A inactivation in rats with chronic brain hypoperfusion.

    Science.gov (United States)

    Liu, Cheng-Di; Wang, Qin; Zong, De-Kang; Pei, Shuang-Chao; Yan, Yan; Yan, Mei-Ling; Sun, Lin-Lin; Hao, Yang-Yang; Mao, Meng; Xing, Wen-Jing; Ren, Huan; Ai, Jing

    2016-09-01

    Reduction of protein phosphatase-2A (PP2A) activity is a common clinical feature of Alzheimer's disease and vascular dementia. In this study, we observed that chronic brain hypoperfusion induced by bilateral common carotid artery occlusion of rats led to PP2A inactivation based on the increase in tyrosine-307 phosphorylation and leucine-309 demethylation of PP2AC and the depression in PP2ABα. Knockdown of miR-195 using overexpression of its antisense molecule oligonucleotide (pre-AMO-miR-195) delivered by a lentivirus (lenti-pre-AMO-miR-195) increased tyrosine-307 phosphorylation and decreased both PP2ABα expression and leucine-309 methylation; these effects were prevented by the overexpression of miR-195 using lenti-pre-miR-195 and controlled by an increase in methylesterase (PME-1) and a decrease in leucine carboxyl methyltransferase-1. In vitro studies demonstrated that miR-195 regulated PME-1 expression by binding to the Ppme1 gene 3'-untranslated region (3'UTR) domain. Masking the miR-195 binding sites in the amyloid precursor protein (APP) and β-site APP cleaving enzyme 1 genes prevented miR-195-induced leucine carboxyl methyltransferase-1 elevation. We concluded that the miR-195 downregulation in chronic brain hypoperfusion involved PP2A inactivity, which was mediated by the post-transcriptional regulation PME-1, APP, and β-site APP cleaving enzyme 1 expression. PMID:27459928

  7. Abrogation of Age-Induced MicroRNA-195 Rejuvenates the Senescent Mesenchymal Stem Cells by Reactivating Telomerase.

    Science.gov (United States)

    Okada, Motoi; Kim, Ha Won; Matsu-ura, Kaoru; Wang, Yi-Gang; Xu, Meifeng; Ashraf, Muhammad

    2016-01-01

    Previously, we reported that a novel subpopulation of young mesenchymal stem cells (YMSCs) existed in old bone marrow, which possessed high antiaging properties as well as excellent efficacy for cardiac repair. MicroRNAs (miRNAs) have emerged as key regulators in post-transcriptional gene expression programs, and however, it is unknown whether miRNAs directly control stem cell senescence. Here we present the first evidence that miR-195 overexpressed in old MSCs (OMSCs) induces stem cell senescence deteriorating their regenerative ability by directly deactivating telomerase reverse transcriptase (Tert), and abrogation of miR-195 can reverse stem cell aging. MiRNAs profiling analysis in YMSCs and OMSCs by microarray showed that miR-140, miR-146a/b, and miR-195 were significantly upregulated in OMSCs, which led us to hypothesize that these are age-induced miRNAs involved in stem cell senescence. Of these miRNAs, we found miR-195 directly targeted 3'-untranslated region of Tert gene by computational target prediction analysis and luciferase assay, and knockdown of miR-195 significantly increased Tert expression in OMSCs. Strikingly, miR-195 inhibition significantly induced telomere relengthening in OMSCs along with reduced expression of senescence-associated β-galactosidase. Moreover, silencing miR-195 in OMSCs by transfection of miR-195 inhibitor significantly restored antiaging factors expression including Tert and Sirt1 as well as phosphorylation of Akt and FOXO1. Notably, abrogation of miR-195 markedly restored proliferative abilities in OMSCs. Transplantation of OMSCs with knocked out miR-195 reduced infarction size and improved LV function. In conclusion, rejuvenation of aged stem cells by miR-195 inhibition would be a promising autologous therapeutic strategy for cardiac repair in the elderly patients. PMID:26390028

  8. Unusual foreign body in the vesico-urethral; 195 cm liquid pipe

    OpenAIRE

    Sökmen, Doğukan; Törer, Buğra Doğukan; Kargı, Taner; Yavuzsan, Abdullah Hızır; Şahin, Selçuk; Tuğcu, Volkan

    2014-01-01

    Insertion of foreign bodies into the genitourinary system is a pathological action believed to increase sexual gratification usually for psychiatric patients and mentally retarded cases especially during masturbation. In this report, we represented a male case who is inserted a 195 cm cannula by himself into the bladder through the urethra because of his psychiatric disorder.

  9. Unusual foreign body in the vesico-urethral; 195 cm liquid pipe.

    Science.gov (United States)

    Sökmen, Doğukan; Törer, Buğra Doğukan; Kargı, Taner; Yavuzsan, Abdullah Hızır; Şahin, Selçuk; Tuğcu, Volkan

    2014-12-01

    Insertion of foreign bodies into the genitourinary system is a pathological action believed to increase sexual gratification usually for psychiatric patients and mentally retarded cases especially during masturbation. In this report, we represented a male case who is inserted a 195 cm cannula by himself into the bladder through the urethra because of his psychiatric disorder. PMID:26328187

  10. 49 CFR 195.585 - What must I do to correct corroded pipe?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false What must I do to correct corroded pipe? 195.585... pipe? (a) General corrosion. If you find pipe so generally corroded that the remaining wall thickness... pipe. However, you need not replace the pipe if you— (1) Reduce the maximum operating...

  11. 49 CFR 195.101 - Qualifying metallic components other than pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Qualifying metallic components other than pipe... components other than pipe. Notwithstanding any requirement of the subpart which incorporates by reference an edition of a document listed in § 195.3, a metallic component other than pipe manufactured in...

  12. 49 CFR 195.573 - What must I do to monitor external corrosion control?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false What must I do to monitor external corrosion... SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Corrosion Control § 195.573 What must I do to monitor external corrosion control? (a) Protected pipelines. You must do the following to...

  13. 33 CFR 110.195 - Mississippi River below Baton Rouge, LA, including South and Southwest Passes.

    Science.gov (United States)

    2010-07-01

    ... cargos of particular hazard as defined in 33 CFR 126.10 or cargos of petroleum products in bulk may not... citations affecting § 110.195, see the List of CFR Sections Affected, which appears in the Finding Aids... pipeline areas may be obtained from the District Engineer, Corps of Engineers, New Orleans, LA. (6)...

  14. 14 CFR 121.195 - Airplanes: Turbine engine powered: Landing limitations: Destination airports.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplanes: Turbine engine powered: Landing... Performance Operating Limitations § 121.195 Airplanes: Turbine engine powered: Landing limitations: Destination airports. (a) No person operating a turbine engine powered airplane may take off that airplane...

  15. The establishment of the Blacknest seismological database on the Rutherford Laboratory system 360/195 computer

    International Nuclear Information System (INIS)

    In order to assess the problems which might arise from monitoring a comprehensive test ban treaty by seismological methods, an experimental monitoring operation is being conducted. This work has involved the establishment of a database on the Rutherford Laboratory 360/195 system computer. The database can be accessed in the UK over the public telephone network and in the USA via ARPANET. (author)

  16. Murine Extracellular Superoxide Dismutase Is Converted into the Inactive Fold by the Ser195Cys Mutation

    DEFF Research Database (Denmark)

    Scavenius, Carsten; Petersen, Jane Savskov; Thomsen, Line Rold; Poulsen, Ebbe Toftgaard; Valnickova Hansen, Zuzana; Bowler, Russel D; Oury, Tim D; Petersen, Steen Vang; Enghild, Jan Johannes

    2013-01-01

    lack Cys195 (human EC-SOD sequence numbering), which is essential for the formation of iEC-SOD. However, cultured hamster cells and transgenic mice expressing human EC-SOD were able to produce both human a- and iEC-SOD variants, which led us to hypothesize that the folding was sequence-dependent rather...

  17. Classifications,symptoms and imaging findings of 195 cases confirmed by biopsy or postoperative pathology

    Institute of Scientific and Technical Information of China (English)

    董秦雯

    2014-01-01

    Objective To summarize and analyze the classifications,symptoms,imaging findings of the cerebral space occupying lesions which confirmed by biopsy or postoperative pathology.Methods The classifications,symptoms,imaging findings of 195 cases who visited the Neurology Department of Naval General Hospital were analyzed by retrospective study.Results Classifications:among the 86 neoplastic lesions(NL),there were 49

  18. 49 CFR 195.559 - What coating material may I use for external corrosion control?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false What coating material may I use for external...) PIPELINE SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Corrosion Control § 195.559 What coating material may I use for external corrosion control? Coating material for external corrosion control...

  19. 46 CFR 195.30-15 - Self-contained breathing apparatus.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Self-contained breathing apparatus. 195.30-15 Section... Self-contained breathing apparatus. (a) Each vessel must have a self-contained breathing apparatus for use as protection against gas leaking from a refrigeration unit. (b) The self-contained...

  20. Note on some quasielastic neutron scattering analysis programs on the Rutherford Laboratory IBM 360/195

    International Nuclear Information System (INIS)

    A suite of programs for analysing neutron scattering data from time-of-flight spectrometers has been implemented on the Rutherford Laboratory IBM 360/195 computer system. The programs are intended for near inelastic and quasielastic data and operate by convoluting the measured instrumental resolution function with a model scattering function before fitting to the measured sample scattering law. (author)

  1. 40 CFR 267.195 - What are the secondary containment requirements?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What are the secondary containment... UNDER A STANDARDIZED PERMIT Tank Systems § 267.195 What are the secondary containment requirements? To... secondary containment that meets the requirements of this section for all new and existing tank systems....

  2. 49 CFR 173.195 - Hydrogen cyanide, anhydrous, stabilized (hydrocyanic acid, aqueous solution).

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Hydrogen cyanide, anhydrous, stabilized... Hazardous Materials Other Than Class 1 and Class 7 § 173.195 Hydrogen cyanide, anhydrous, stabilized (hydrocyanic acid, aqueous solution). (a) Hydrogen cyanide, anhydrous, stabilized, must be packed...

  3. Procedure for preparation of a Ausup(195m) containing liquid, procedure for the execution of a radiodiagnostic examination, and a radioisotope generator for generating a Ausup(195m) containing liquid

    International Nuclear Information System (INIS)

    A procedure is described for the preparation of an Ausup(195m) containing fluid by adsorbing the parent isotope Hgsup(195m) onto an adsorption material and then eluting the radioactive daughter isotope Ausup(195m). The packing materials for the chromatographic column are silica gel, porous and massive glass beads. The adsorption materials for Hg195 are hydrated manganese dioxide, silver, and zinc, cadmium, silver or zirconium sulfides. The procedure for depositing these materials in the packing material is outlined and the most suitable eluting fluid for each adsorption material is presented. The procedure has applications in the execution of a radiodiagnostic examination using an Ausup(195m) labelled fluid. (C.F.)

  4. 15 CFR 19.5 - How will Commerce entities add interest, penalty charges, and administrative costs to a Commerce...

    Science.gov (United States)

    2010-01-01

    ... administrative costs on Commerce debts in accordance with the provisions of 31 U.S.C. 3717 and 31 CFR 901.9... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false How will Commerce entities add interest, penalty charges, and administrative costs to a Commerce debt? 19.5 Section 19.5 Commerce...

  5. Sustainable syntrophic growth of Dehalococcoides ethenogenes strain 195 with Desulfovibrio vulgaris Hildenborough and Methanobacterium congolense: global transcriptomic and proteomic analyses

    Energy Technology Data Exchange (ETDEWEB)

    Men, Yujie [University of California, Berkeley; Feil, Helene [University of California, Berkeley; Verberkmoes, Nathan C [ORNL; Shah, Manesh B [ORNL; Johnson, David R. [University of California, Berkeley; Lee, Patrick K. H. [University of California, Berkeley; West, Kimberlee A [University of California, Berkeley; Zinder, Stephen H. [Cornell University; Andersen, Gary L. [Lawrence Berkeley National Laboratory (LBNL); Alvarez-Cohen, Lisa [Lawrence Berkeley National Laboratory (LBNL)

    2012-01-01

    Dehalococcoides ethenogenes strain 195 (DE195) was grown in a sustainable syntrophic association with Desulfovibrio vulgaris Hildenborough (DVH) as a co-culture, as well as with DVH and the hydrogenotrophic methanogen Methanobacterium congolense (MC) as a tri-culture using lactate as the sole energy and carbon source. In the co- and tri-cultures, maximum dechlorination rates of DE195 were enhanced by approximately three times (11.0 0.01 lmol per day for the co-culture and 10.1 0.3 lmol per day for the tri-culture) compared with DE195 grown alone (3.8 0.1 lmol per day). Cell yield of DE195 was enhanced in the co-culture (9.0 0.5107 cells per lmol Cl released, compared with 6.8 0.9107 cells per lmol Cl released for the pure culture), whereas no further enhancement was observed in the tri-culture (7.3 1.8107 cells per lmol Cl released). The transcriptome of DE195 grown in the co-culture was analyzed using a wholegenome microarray targeting DE195, which detected 102 significantly up- or down-regulated genes compared with DE195 grown in isolation, whereas no significant transcriptomic difference was observed between co- and tri-cultures. Proteomic analysis showed that 120 proteins were differentially expressed in the co-culture compared with DE195 grown in isolation. Physiological, transcriptomic and proteomic results indicate that the robust growth of DE195 in co- and tri-cultures is because of the advantages associated with the capabilities of DVH to ferment lactate to provide H2 and acetate for growth, along with potential benefits from proton translocation, cobalamin-salvaging and amino acid biosynthesis, whereas MC in the tri-culture provided no significant additional benefits beyond those of DVH.

  6. Downregulated miR-195 detected in preeclamptic placenta affects trophoblast cell invasion via modulating ActRIIA expression.

    Directory of Open Access Journals (Sweden)

    Yang Bai

    Full Text Available BACKGROUND: Preeclampsia (PE is a pregnancy-specific syndrome manifested by on-set of hypertension and proteinuria after 20 weeks of gestation. Abnormal placenta development has been generally accepted as initial cause of the disorder. Recently, miR-195 was found to be down-regulated in preeclamptic placentas compared with normal pregnant ones, indicating possible association of this small molecule with placental pathology of preeclampsia. By far the function of miR-195 in the development of placenta remains unknown. METHODOLOGY/PRINCIPAL FINDINGS: Bioinformatic assay predicted ActRIIA as one of the targets for miR-195. By using Real-time PCR, Western blotting and Dual Luciferase Assay, we validated that ActRIIA was the direct target of miR-195 in human trophoblast cells. Transwell insert invasion assay showed that miR-195 could promote cell invasion in trophoblast cell line, HTR8/SVneo cells, and the effect could be abrogated by overexpressed ActRIIA. In preeclamptic placenta tissues, pri-miR-195 and mature miR-195 expressions were down-regulated, whereas ActRIIA level appeared to be increased when compared with that in gestational-week-matched normal placentas. CONCLUSIONS/SIGNIFICANCE: This is the first report on the function of miR-195 in human placental trophoblast cells which reveals an invasion-promoting effect of the small RNA via repressing ActRIIA. Aberrant expression of miR-195 may contribute to the occurrence of preeclampsia through interfering with Activin/Nodal signaling mediated by ActRIIA in human placenta.

  7. Characterisation of platinum-based fuel cell catalyst materials using 195Pt wideline solid state NMR.

    Science.gov (United States)

    Rees, Gregory J; Orr, Simon T; Barrett, Laurence O; Fisher, Janet M; Houghton, Jennifer; Spikes, Geoffrey H; Theobald, Brian R C; Thompsett, David; Smith, Mark E; Hanna, John V

    2013-10-28

    This study demonstrates the utility of the novel Field Sweep Fourier Transform (FSFT) method for acquiring wideline (195)Pt NMR data from various sized Pt nanoparticles, Pt-Sn intermetallics/bimetallics used to catalyse oxidative processes in fuel cell applications, and various other related Pt3X alloys (X = Al, Sc, Nb, Ti, Hf and Zr) which can facilitate oxygen reduction catalysis. The (195)Pt and (119)Sn NMR lineshapes measured from the PtSn intermetallic and Pt3Sn bimetallic systems suggest that these are more ordered than other closely related bimetallic alloys; this observation is supported by other characterisation techniques such as XRD. From these reconstructed spectra the mean number of atoms in a Pt nanoparticle can be accurately determined, along with detailed information regarding the number of atoms present effectively in each layer from the surface. This can be compared with theoretical predictions of the number of Pt atoms in these various layers for cubo-octahedral nanoparticles, thereby providing an estimate of the particle size. A comparison of the common NMR techniques used to acquire wideline data from the I = 1/2 (195)Pt nucleus illustrates the advantages of the automated FSFT technique over the Spin Echo Height Spectroscopy (SEHS) (or Spin Echo Integration Spectroscopy (SEIS)) approach that dominates the literature in this area of study. This work also presents the first (195)Pt NMR characterisation of novel small Pt13 nanoclusters which are diamagnetic and thus devoid of metallic character. This unique system provides a direct measure of an isotropic chemical shift for these Pt nanoparticles and affords a better basis for determining the actual Knight shift when compared to referencing against the primary IUPAC shift standard (1.2 M Na2PtCl6(aq)) which has a very different local chemical environment. PMID:24013445

  8. Protein stabilizer, NDSB-195, enhances the dynamics of the β4 -α2 loop of ubiquitin.

    Science.gov (United States)

    Wang, Haimei; Hosoda, Kazuo; Ishii, Takeshi; Arai, Ryo; Kohno, Toshiyuki; Terawaki, Shin-Ichi; Wakamatsu, Kaori

    2016-03-01

    Non-detergent sulfobetaines (NDSBs) are a new group of small, synthetic protein stabilizers, which have advantages over classical compatible osmolytes, such as polyol, amines, and amino acids: they do not increase solution viscosity, unlike polyols, and they are zwitterionic at all pH ranges, unlike amines and amino acids. NDSBs also facilitate the crystallization and refolding of proteins. The mechanism whereby NDSBs exhibit such activities, however, remains elusive. To gain insight into this mechanism, we studied, using nuclear magnetic resonance (NMR), the effects of dimethylethylammonium propane sulfonate (NDSB-195) on the dynamics of ubiquitin, on which a wealth of information has been accumulated. By analyzing the line width of amide proton resonances and the transverse relaxation rates of nitrogen atoms, we found that NDSB-195 enhances the microsecond-millisecond dynamics of a β4 -α2 loop of ubiquitin. Although those compounds that enhance protein dynamics are generally considered to destabilize protein molecules, NDSB-195 enhanced the stability of ubiquitin against guanidium chloride denaturation. Thus, the simultaneous enhancement of stability and flexibility by a single compound can be attained. Copyright © 2016 European Peptide Society and John Wiley & Sons, Ltd. PMID:26856691

  9. Expression of microRNA-195 is transactivated by Sp1 but inhibited by histone deacetylase 3 in hepatocellular carcinoma cells.

    Science.gov (United States)

    Zhao, Na; Li, Siwen; Wang, Ruizhi; Xiao, Manhuan; Meng, Yu; Zeng, Chunxian; Fang, Jian-Hong; Yang, Jine; Zhuang, Shi-Mei

    2016-07-01

    MiR-195 expression is frequently reduced in various cancers, but its underlying mechanisms remain unknown. To explore whether abnormal transcription contributed to miR-195 downregulation in hepatocellular carcinoma (HCC), we characterized the -2165-bp site upstream of mature miR-195 as transcription start site and the -2.4 to -2.0-kb fragment as the promoter of miR-195 gene. Subsequent investigation showed that deletion of the predicted Sp1 binding site decreased the miR-195 promoter activity; Sp1 silencing significantly reduced the miR-195 promoter activity and the endogenous miR-195 level; Sp1 directly interacted with the miR-195 promoter in vitro and in vivo. These data suggest Sp1 as a transactivator for miR-195 transcription. Interestingly, miR-195 expression was also subjected to epigenetic regulation. Histone deacetylase 3 (HDAC3) could anchor to the miR-195 promoter via interacting with Sp1 and consequently repress the Sp1-mediated miR-195 transactivation by deacetylating histone in HCC cells. Consistently, substantial increase of HDAC3 protein was detected in human HCC tissues and HDAC3 upregulation was significantly correlated with miR-195 downregulation, suggesting that HDAC3 elevation may represent an important cause for miR-195 reduction in HCC. Our findings uncover the mechanisms underlying the transcriptional regulation and expression deregulation of miR-195 in HCC cells and provide new insight into microRNA biogenesis in cancer cells. PMID:27179445

  10. Downregulated miR-195 Detected in Preeclamptic Placenta Affects Trophoblast Cell Invasion via Modulating ActRIIA Expression

    OpenAIRE

    Bai, Yang; Yang, Weiwei; Yang, Hui-xia; Liao, Qinping; Ye, Gang; Fu, Guodong; Ji, Lei; Xu, Peng(Academy of Mathematics and Systems Science, Chinese Academy of Sciences, 100190, Beijing, China); Wang, Hao; Li, Yu-Xia; Peng, Chun; Wang, Yan-Ling

    2012-01-01

    Background Preeclampsia (PE) is a pregnancy-specific syndrome manifested by on-set of hypertension and proteinuria after 20 weeks of gestation. Abnormal placenta development has been generally accepted as initial cause of the disorder. Recently, miR-195 was found to be down-regulated in preeclamptic placentas compared with normal pregnant ones, indicating possible association of this small molecule with placental pathology of preeclampsia. By far the function of miR-195 in the development of ...

  11. Sustainable syntrophic growth of Dehalococcoides ethenogenes strain 195 with Desulfovibrio vulgaris Hildenborough and Methanobacterium congolense: Global transcriptomic and proteomic analyses

    Energy Technology Data Exchange (ETDEWEB)

    Men, Y.; Feil, H.; VerBerkmoes, N.C.; Shah, M.B.; Johnson, D.R.; Lee, P.K.H; West, K.A.; Zinder, S.H.; Andersen, G.L.; Alvarez-Cohen, L.

    2011-03-01

    Dehalococcoides ethenogenes strain 195 (DE195) was grown in a sustainable syntrophic association with Desulfovibrio vulgaris Hildenborough (DVH) as a co-culture, as well as with DVH and the hydrogenotrophic methanogen Methanobacterium congolense (MC) as a tri-culture using lactate as the sole energy and carbon source. In the co- and tri-cultures, maximum dechlorination rates of DE195 were enhanced by approximately three times (11.0±0.01 lmol per day for the co-culture and 10.1±0.3 lmol per day for the tri-culture) compared with DE195 grown alone (3.8±0.1 lmol per day). Cell yield of DE195 was enhanced in the co-culture (9.0±0.5 x 107 cells per lmol Cl{sup -} released, compared with 6.8±0.9x 107 cells per lmol Cl{sup -} released for the pure culture), whereas no further enhancement was observed in the tri-culture (7.3±1.8x 107 cells per lmol Cl{sup -} released). The transcriptome of DE195 grown in the co-culture was analyzed using a whole-genome microarray targeting DE195, which detected 102 significantly up- or down-regulated genes compared with DE195 grown in isolation, whereas no significant transcriptomic difference was observed between co- and tri-cultures. Proteomic analysis showed that 120 proteins were differentially expressed in the co-culture compared with DE195 grown in isolation. Physiological, transcriptomic and proteomic results indicate that the robust growth of DE195 in co- and tri-cultures is because of the advantages associated with the capabilities of DVH to ferment lactate to provide H2 and acetate for growth, along with potential benefits from proton translocation, cobalamin-salvaging and amino acid biosynthesis, whereas MC in the tri-culture provided no significant additional benefits beyond those of DVH.

  12. Treatment of cultured glioma cells with the EGFR-TKI gefitinib (''Iressa'', ZD1839) increases the uptake of astatinated EGF despite the absence of gefitinib-mediated growth inhibition

    International Nuclear Information System (INIS)

    The EGFR-TKI (epidermal growth factor receptor tyrosine kinase inhibitor) gefitinib (''Iressa'', ZD1839), a reversible growth inhibitor of EGFR-expressing tumour cells, has been shown to enhance the antitumour effect of ionising radiation, and also to increase the uptake of radioiodinated EGF. Thus, combination of gefitinib treatment and radionuclide targeting is an interesting option for therapy of brain tumours that are difficult to treat with conventional methods. The aim of this study was to evaluate how pre-treatment with gefitinib affects binding of astatinated EGF (211At-EGF) to cultured glioma U343 cells, which express high levels of EGFR. The growth of U343 cells in the presence of gefitinib was investigated, and it was found that gefitinib does not significantly inhibit the growth of these cells. Nevertheless, the uptake of 211At-EGF in U343 cells was markedly increased (up to 3.5 times) in cells pre-treated with gefitinib (1 μM). This indicates that a combination of gefitinib treatment and radionuclide targeting to EGFR might be a useful therapeutic modality, even for patients who do not respond to treatment with gefitinib alone. (orig.)

  13. Cerebral perfusion studies using Au-195: Investigations into their clinical usefulness and comparisons with the xenon-133 inhalation method

    International Nuclear Information System (INIS)

    Au-195m cerebral perfusion studies in the diagnosis of blood supply disorders of the brain have only recently leaped into currency. Au-195m is not capable of diffusing. This particular property permits first-pass times of vascular transfer to be determined for cerebral tissues that correlate with the degree of cerebral circulation. In the study described here, attempts were made to shed more light on the clinical usefulness of the method. For this purpose, the record sheets of two cohorts of patients were analysed on a retrospective basis. 1. In 23 patients, where the cerebrovascular disorders were strictly confined to the cerebral hemispheres, the blood supply of the brain was examined on the basis of both Au-195m cerebral perfusion studies and the xenon-133 inhalation method. In the evaluation of the findings based on the Au-195m study the investigator was blinded to the neurological manifestations of the disease and the results from other studies. In 82% of the patients the perfusion mapping using Au-195m was consistent with the clinical symptoms. 2. In a second group of patients, the probable results of the Au-195m perfusion study were forecasted on the basis of the medical history, clinical symptoms and preliminary diagnosis and subsequently compared to those actually obtained. Expected and actual results were found to be in agreement for 88% of cases. The results provided evidence of the suitability of Au-195m cerebral perfusion studies to examine the blood suply of the brain. In view of the fact that the examinations and measurements are relatively uncomplicated, this newly developed method is most likely to be used on a broader basis in the future. (orig./MG)

  14. X-ray emission from the region of gamma 195 + 5

    International Nuclear Information System (INIS)

    X-ray emission from the vicinity of the MeV gamma ray source, gamma 195+5, was observed with the HEAO-A2 detectors. A source with an intensity of (1.5 +- 0.5) x 10-11 erg/cm2 s (2-6 keV) was seen in each of two separate observations at a combined confidence level of 3.1 sigma. The location of the source is l2 = 194.56 degrees, b2 = 4.92 degrees with a 90% confidence error box of 1.4 square degrees, significantly smaller than the positional uncertainty of the gamma ray source, and consistent with its location. The chance overlap of such an X-ray source with the gamma ray region is estimated to be 9% and, therefore, they may be 9% and therefore they may be associated. The spectrum appears too steep to extrapolate simply to the 100 MeV flux value for gamma 195+5

  15. Effects of adsorption interferents on removal of Reactive Red 195 dye in wastewater by chitosan

    Institute of Scientific and Technical Information of China (English)

    WEN Yue-zhong; LIU Wen-qi; FANG Zhao-hua; LIU Wei-ping

    2005-01-01

    Reactive Red 195, which is an azoic anionic dye characterized by the presence of five sulfonic groups and one azoic group, is efficiently removed using chitosan. The increasing chitosan dose had a dramatic positive impact on the achieved color removal, there was approximately a linear relationship between chitosan dose and color removal of dye before color removal reach maximum. Also, the increase of dye concentration led to the increase of chitosan dosage in order to get the same color removal. 92 mg/L of chitosan dosage was sufficient to achieve complete remove of dye at initial concentration of dye at 200 mg/L. For the higher concentrations of dye, high dosages were necessary to reach complete color removal. On the other hand, the use of adsorption interferents(Fe2+ , Na+ , HCO3- and others) can be interesting, addition of ions had effect on the color removal of Reactive Red 195. Comparing with blank, addition of chemical species approximately decreased the color removal except Na+ and combination of Fe2+ + HCO3-. However, comparing with Fe2+ alone and HCO3- alone, combination of Fe2+ + HCO-3 increased the color removal.

  16. Daily snow depth measurements from 195 stations in the United States

    Energy Technology Data Exchange (ETDEWEB)

    Allison, L.J. [ed.] [Oak Ridge National Lab., TN (United States). Carbon Dioxide Information Analysis Center; Easterling, D.R.; Jamason, P.; Bowman, D.P.; Hughes, P.Y.; Mason, E.H. [National Oceanic and Atmospheric Administration, Asheville, NC (United States). National Climatic Data Center

    1997-02-01

    This document describes a database containing daily measurements of snow depth at 195 National Weather Service (NWS) first-order climatological stations in the United States. The data have been assembled and made available by the National Climatic Data Center (NCDC) in Asheville, North Carolina. The 195 stations encompass 388 unique sampling locations in 48 of the 50 states; no observations from Delaware or Hawaii are included in the database. Station selection criteria emphasized the quality and length of station records while seeking to provide a network with good geographic coverage. Snow depth at the 388 locations was measured once per day on ground open to the sky. The daily snow depth is the total depth of the snow on the ground at measurement time. The time period covered by the database is 1893--1992; however, not all station records encompass the complete period. While a station record ideally should contain daily data for at least the seven winter months (January through April and October through December), not all stations have complete records. Each logical record in the snow depth database contains one station`s daily data values for a period of one month, including data source, measurement, and quality flags.

  17. High-pressure phase transitions in rare earth metal thulium to 195 GPa

    International Nuclear Information System (INIS)

    We have performed image plate x-ray diffraction studies on a heavy rare earth metal, thulium (Tm), in a diamond anvil cell to a pressure of 195 GPa and volume compression V/Vo = 0.38 at room temperature. The rare earth crystal structure sequence, hcp → Sm-type → dhcp → fcc → distorted fcc, is observed in Tm below 70 GPa with the exception of a pure fcc phase. The focus of our study is on the ultrahigh-pressure phase transition and Rietveld refinement of crystal structures in the pressure range between 70 and 195 GPa. The hexagonal hR- 24 phase is seen to describe the distorted fcc phase between 70 and 124 GPa. Above 124 ± 4 GPa, a structural transformation from hR 24 phase to a monoclinic C 2/m phase is observed with a volume change of - 1.5%. The equation of state data shows rapid stiffening above the phase transition at 124 GPa and is indicative of participation of f-electrons in bonding. We compare the behavior of Tm to other heavy rare-earths and heavy actinide metals under extreme conditions of pressure.

  18. Gold-195m, a new generator-produced short-lived radionuclide for sequential assessment of ventricular performance by first pass radionuclide angiocardiography

    International Nuclear Information System (INIS)

    The feasibility of performing rapid sequential first pass radionuclide angiocardiography using a new short-lived radiotracer, gold-195m (195/sup m/Au) half-life 30.5 seconds) was evaluated. This radionuclide emits a 262 keV gamma ray and is the daughter of mercury-195 (195/sup m/Hg) (half-life 41.6 hours). The prototype table top 195/sup m/Hg/195/sup m/Au generator produced 20 to 25 mCi of 195/sup m/Au in 2 ml of eluate (yield of 40 percent). Four dogs each had 15 to 20 sequential first pass studies performed with 195/sup m/Hg at 3 to 10 minute intervals using a computerized multicrystal gamma camera. During the left ventricular phase, 160,000 to 190,000 counts/s were acquired. The end-diastolic left ventricular region of interest contained 3000 to 6000 counts (background- and decay-corrected). Multiple reproducible values for left ventricular ejection fraction were obtained during stable conditions. During infusion of isoproterenol, rapid increase of left ventricular ejection fraction was demonstrated. Excellent agreement was observed between studies performed with technetium-99m diethylenetriaminepentaacetic acid (99/sup m/Tc-DTPA) and 195/sup m/Au. This new short-lived radiotracer makes possible rapid sequential assessments of ventricular function at greatly reduced patient exposure to radiation

  19. Observation of low-lying resonances in the quasicontinuum of 195,196Pt and enhanced astrophysical reaction rates

    International Nuclear Information System (INIS)

    An excess of strength on the low-energy tail of the giant dipole resonance recently has been observed in the γ-decay from the quasicontinuum of 195,196Pt. The nature of this phenomenon is not yet fully investigated. If this feature is present also in the γ-ray strength of the neutron-rich isotopes, it can affect the neutron-capture reactions involved in the formation of heavy-elements in stellar nucleosynthesis. The experimental level density and γ-ray strength function of 195,196Pt are presented together with preliminary calculations of the corresponding neutron-capture cross sections

  20. New possibilities for quantitative measurements of regional cerebral blood flow with gold-195m

    International Nuclear Information System (INIS)

    A previously reported theory for quantitative cerebral blood flow measurement for nondiffusible radiotracers has been applied to patients after stroke and to volunteers undergoing a mental stimulation exercise. The energy spectrum of gold-195m shows two strong photon peaks, one at an energy level of 68 keV and a second at an energy-level of 262 keV. The low energy peak is suitable for perfusion studies in lateral views of the hemispheres; no look-through effect is seen. The high energy level is good for studies in posterior-anterior positions. Parametric images for quantitative regional cerebral blood flow can be generated. The area of occluded vessels in the case of stroke can be detected. Quantitative activation patterns of cerebral blood flow during mental stimulation can be generated. The results prove that, not only with freely diffusible indicators like xenon but also with nondiffusible indicators, it is possible to measure quantitatively cerebral blood flow patterns

  1. Characterization of Ce0.9Gd0.1O1.95 powders synthesized by spray drying

    DEFF Research Database (Denmark)

    Blennow Tullmar, Peter; Chen, Weiwu; Lundberg, Mats;

    2009-01-01

    Ce0.9Gd0.1O1.95 powders were synthesized by spray drying and successive calcinations. The phase purity, BET surface area, and particle morphology of as-sprayed and calcined powders were characterized. After calcination above 300 °C, the powders were single phase and showed a BET surface area of 68...

  2. STS-33 MS Carter on KSC LC Pad 39B 195 ft level with OV-103 in background

    Science.gov (United States)

    1990-01-01

    STS-33 Mission Specialist (MS) Manley L. Carter, Jr, wearing launch and entry suit (LES), poses in front of Discovery, Orbiter Vehicle (OV) 103, at the 195 ft level elevator entrance at Kennedy Space Center (KSC) Launch Complex (LC) Pad 39B. Visible in the background is the catwalk to OV-103's side hatch and the Atlantic Ocean.

  3. k195hw.m77t and k195hw.h77t: MGD77T data and header files for single-beam bathymetry data for field activity K-1-95-HW in in Hawaii from 06/14/1995 to 06/18/1995

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of the U.S. Geological Survey cruise K-1-95-HW. The cruise was conducted in Oahu,...

  4. Oxidation of spent fuel in air at 175 degree to 195 degree C

    International Nuclear Information System (INIS)

    Oxidation tests in dry air were conducted on four LWR spent fuels at 175 degrees and 195 degrees C to determine the effect of the fuel characteristics on the oxidation state likely to exist at the time leaching occurs in a potential repository. Weight changes were measured and samples were examined by XRD, ceramography, TEM, and TGA. Despite local variations in the grain boundary susceptibility to oxidation, all four fuels progressed toward an apparent endpoint at an oxygen-to-metal (O/M) ratio of 2.4. The sole oxidation product was U4O9+x, a cubic phase structurally related to UO2 but with a slightly smaller lattice constant. The growth of the U4O9+x from the grain boundaries into the UO2 grains followed parabolic kinetics and had an activation energy of 26.6 kcal/mol. Based on the kinetics, the time required at 95 degrees C to completely oxidize LWR spent fuel to U4O9+x would be at least 2000 yr. The next oxidation product to form after the U4O9+x phase may be U3O8, but no U3O8 or other dilatational oxidation product has been detected in these accelerated tests conducted up to 25,000 h

  5. The First Outbreak Caused by Acinetobacter baumannii ST208 and ST195 in China

    Directory of Open Access Journals (Sweden)

    Junyan Qu

    2016-01-01

    Full Text Available This study aimed to analyze the clinical characteristics of patients and molecular mechanisms of the first outbreak mainly caused by sequence types (STs 208 multidrug resistant (MDR Acinetobacter baumannii in China. A total of 10 clinical samples were collected from 5 patients who were involved in the outbreak. Bacterial identification and antibiotic sensitivity tests were performed by the VITEK-2 COMPACT automated system. MICs of tigecycline for clinical isolates were determined using broth microdilution. The clonal relatedness of A. baumannii clinical isolates in our local settings was determinated by pulsed-field gel electrophoresis (PFGE and multilocus sequence typing (MLST. A total of 7 A. baumannii strains were isolated and all were MDR strains; two of them were carbapenem-nonsusceptible strains. blaOXA-23 was the only acquired carbapenemase gene in the isolates. The isolates belonged to a single clonal pulsotype determined by PFGE and two sequences types (STs determined by MLST. The isolates belonged to the globally disseminated clonal complex 92, among which ST195 and ST208 were the most common sequence types (71.43% and 28.57%. The outbreak was successfully controlled by stringent infection control measures, especially improving the hand hygiene compliance and enhancing antimicrobial stewardship. In conclusion, this is the first description of an outbreak caused mainly by A. baumannii of ST208 in China. Infection control measures should be strengthened when infection outbreaks in hospital.

  6. The First Outbreak Caused by Acinetobacter baumannii ST208 and ST195 in China

    Science.gov (United States)

    Qu, Junyan; Du, Yu

    2016-01-01

    This study aimed to analyze the clinical characteristics of patients and molecular mechanisms of the first outbreak mainly caused by sequence types (STs) 208 multidrug resistant (MDR) Acinetobacter baumannii in China. A total of 10 clinical samples were collected from 5 patients who were involved in the outbreak. Bacterial identification and antibiotic sensitivity tests were performed by the VITEK-2 COMPACT automated system. MICs of tigecycline for clinical isolates were determined using broth microdilution. The clonal relatedness of A. baumannii clinical isolates in our local settings was determinated by pulsed-field gel electrophoresis (PFGE) and multilocus sequence typing (MLST). A total of 7 A. baumannii strains were isolated and all were MDR strains; two of them were carbapenem-nonsusceptible strains. blaOXA-23 was the only acquired carbapenemase gene in the isolates. The isolates belonged to a single clonal pulsotype determined by PFGE and two sequences types (STs) determined by MLST. The isolates belonged to the globally disseminated clonal complex 92, among which ST195 and ST208 were the most common sequence types (71.43% and 28.57%). The outbreak was successfully controlled by stringent infection control measures, especially improving the hand hygiene compliance and enhancing antimicrobial stewardship. In conclusion, this is the first description of an outbreak caused mainly by A. baumannii of ST208 in China. Infection control measures should be strengthened when infection outbreaks in hospital. PMID:27144176

  7. Photographer : JPL Range : 312, 000 kilometers (195,000 miles) This photo of Ganymede (Ice Giant)

    Science.gov (United States)

    1979-01-01

    Photographer : JPL Range : 312, 000 kilometers (195,000 miles) This photo of Ganymede (Ice Giant) was taken from Voyager 2 and shows features down to about 5 to 6 kilometers across. Different types of terrain common on Ganymede's surface are visible. The boundary of the largest region of dark ancient terrain on Ganymede can be seen to the east (right), revealing some of the light linear features which may be all that remains of a large ancient impact structure similar to the large ring structure on Callisto. The broad light regions running through the image are the typical grooved structures seen within another example of what might be evidence of large scale lateral motion in Ganymede's crust. The band of grooved terrain (about 100 kilometers wide) in this region appears to be offset by 50 kilometers or more on the left hand edge by a linear feature perpendicular to it. A feature similar to this one was previously discovered by Voyager 1. These are the first clear examples of strike-slip style faulting on any planet other than Earth. Many examples of craters of all ages can be seen in this image, ranging from fresh, bright ray craters to large, subdued circular markings thought to be the 'scars' of large ancient impacts that have been flatteded by glacier-like flows.

  8. Dynamic changes in left ventricular function during cold pressor stimulation assessed with gold-195m

    International Nuclear Information System (INIS)

    The temporal changes in left ventricular function induced by cold pressor stimulation were assessed in 12 normal controls and 12 patients with coronary artery disease (CAD) by rapid, sequential first-pass nuclear angiography with gold-195m. Imaging was performed at rest, after 1, 2.5, and 4 min of cold pressor and after 2 min of recovery. After 1 min, LVEF (left ventricular ejection fraction) fell significantly in normals and in patients but only in the coronary patients was a significant fall maintained at 2.5 and 4 min. The number of new abnormalities on the regional ejection fraction images for normals and those with CAD, respectively, was 12 and 19 at 1 min, 1 and 21 at 2.5 min, 2 and 13 at 4 min, and 0 and 8 during recovery. The authors conclude that (1) cold pressor-induced depression of left ventricular function is transient in normals but often prolonged in patients with CAD and (2) the temporal dissociation between rise in blood pressure and fall in LVEF suggests factors other than afterload changes may be involved in depression of cardiac function

  9. VizieR Online Data Catalog: Radio fluxes of 195 ICRF2-Gaia transfer sources (Le Bail+, 2016)

    Science.gov (United States)

    Le Bail, K.; Gipson, J. M.; Gordon, D.; MacMillan, D. S.; Behrend, D.; Thomas, C. C.; Bolotin, S.; Himwich, W. E.; Baver, K. D.; Corey, B. E.; Titus, M.; Bourda, G.; Charlot, P.; Collioud, A.

    2016-07-01

    The second realization of the International Celestial Reference Frame (ICRF2) is based on Very Long Baseline Interferometry (VLBI) data at radio frequencies in X band and S band. The European Space Agency's Gaia mission, launched on 2013 December 19, started routine scientific operations in 2014 July. By scanning the whole sky, it is expected to observe ~500000 Quasi Stellar Objects in the optical domain. This means that, in the future, two extragalactic celestial reference frames, at two different frequency domains, will coexist. It will thus be important to align them very accurately. In 2012, the Laboratoire d'Astrophysique de Bordeaux (LAB) selected 195 sources from ICRF2 that will be observed by Gaia and should be suitable for aligning the radio and optical frames: they are called ICRF2-Gaia transfer sources. The LAB submitted a proposal to the International VLBI Service (IVS) to regularly observe these ICRF2-Gaia transfer sources at the same rate as Gaia observes them in the optical realm, e.g., roughly once a month. Of the 195 sources, all but one have been successfully observed in the 12 months prior to 2015 September 01. Table1 lists the 195 ICRF2-Gaia transfer sources. Beginning in 2003 June, the Goddard VLBI group developed a program to purposefully monitor when sources were observed and to increase the observations of "under-observed" sources. In 2013 March, we added all 195 ICRF2-Gaia transfer sources to the IVS source monitoring program with an observation target of 12 successful sessions per year. (1 data file).

  10. Equilibrium, kinetic and thermodynamic studies of the biosorption of textile dye (Reactive Red 195) onto Pinus sylvestris L

    International Nuclear Information System (INIS)

    This study investigated the biosorption of Reactive Red 195 (RR 195), an azo dye, from aqueous solution by using cone biomass of Pinus sylvestris Linneo. To this end, pH, initial dye concentration, biomass dosage and contact time were studied in a batch biosorption system. Maximum pH for efficient RR 195 biosorption was found to be 1.0 and the initial RR 195 concentration increased with decreasing percentage removal. Biosorption capacity increased from 6.69 mg/g at 20 deg. C to 7.38 mg/g at 50 deg. C for 200 mg/L dye concentration. Kinetics of the interactions was tested by pseudo-first-order and pseudo-second-order kinetics, the Elovich equation and intraparticle diffusion mechanism. Pseudo-second-order kinetic model provided a better correlation for the experimental data studied in comparison to the pseudo-first-order kinetic model and intraparticle diffusion mechanism. Moreover, the Elovich equation also showed a good fit to the experimental data. Freundlich and Langmuir adsorption isotherms were used for the mathematical description of the biosorption equilibrium data. The activation energy of biosorption (Ea) was found to be 8.904 kJ/mol by using the Arrhenius equation. Using the thermodynamic equilibrium coefficients obtained at different temperatures, the study also evaluated the thermodynamic constants of biosorption (ΔGo, ΔHo and ΔS). The results indicate that cone biomass can be used as an effective and low-cost biosorbent to remove reactive dyes from aqueous solution.

  11. Early hominin diet included diverse terrestrial and aquatic animals 1.95 Ma in East Turkana, Kenya

    OpenAIRE

    Braun, David R.; Harris, John W. K.; Naomi E. Levin; McCoy, Jack T.; Herries, Andy I. R.; Bamford, Marion K.; Bishop, Laura C.; Richmond, Brian G.; Kibunjia, Mzalendo

    2010-01-01

    The manufacture of stone tools and their use to access animal tissues by Pliocene hominins marks the origin of a key adaptation in human evolutionary history. Here we report an in situ archaeological assemblage from the Koobi Fora Formation in northern Kenya that provides a unique combination of faunal remains, some with direct evidence of butchery, and Oldowan artifacts, which are well dated to 1.95 Ma. This site provides the oldest in situ evidence that hominins, predating Homo erectus, enj...

  12. Expression of Reductive Dehalogenase Genes in Dehalococcoides ethenogenes Strain 195 Growing on Tetrachloroethene, Trichloroethene, or 2,3-Dichlorophenol▿ †

    OpenAIRE

    Fung, Jennifer M.; Morris, Robert M.; Adrian, Lorenz; Zinder, Stephen H.

    2007-01-01

    Reductive dehalogenase (RD) gene transcript levels in Dehalococcoides ethenogenes strain 195 were investigated using reverse transcriptase quantitative PCR during growth and reductive dechlorination of tetrachloroethene (PCE), trichloroethene (TCE), or 2,3-dichlorophenol (2,3-DCP). Cells grown with PCE or TCE had high transcript levels (greater than that for rpoB) for tceA, which encodes the TCE RD, pceA, which encodes the PCE RD, and DET0162, which contains a predicted stop codon and is cons...

  13. Comparative Genomics of “Dehalococcoides ethenogenes” 195 and an Enrichment Culture Containing Unsequenced “Dehalococcoides” Strains ▿ †

    OpenAIRE

    West, Kimberlee A.; Johnson, David R.; Hu, Ping; DeSantis, Todd Z.; Brodie, Eoin L; Patrick K. H. Lee; Feil, Helene; Gary L. Andersen; Zinder, Stephen H.; Alvarez-Cohen, Lisa

    2008-01-01

    Tetrachloroethene (PCE) and trichloroethene (TCE) are prevalent groundwater contaminants that can be completely reductively dehalogenated by some “Dehalococcoides” organisms. A Dehalococcoides-organism-containing microbial consortium (referred to as ANAS) with the ability to degrade TCE to ethene, an innocuous end product, was previously enriched from contaminated soil. A whole-genome photolithographic microarray was developed based on the genome of “Dehalococcoides ethenogenes” 195. This mic...

  14. ["The Italian decree 195/2006 on the protection of workers against risks arising from noise"].

    Science.gov (United States)

    Merluzzi, F; Pira, E; Riboldi, L

    2006-01-01

    The Italian decree 195/2006 incorporates the European Directive 2003/10/CE on the minimum health and safety requirements regarding the exposure of workers to the risks arising from physical agents (noise). It is rather different to previous decree 277/1991, particularly as regard of the new exposure limit value and the elimination of annex VI and VII. We discus here only two aspects that we consider relevant and quite critical: 1) The calculation of the exposure limit values as noise equivalent level: it is a method that underestimates the potential damage of impulsive noise, so the risk evaluation remains quite inaccurate. 2) To take account of the attenuation provided by the individual hearing protectors worn by the worker in determining the worker's effective exposure when applying the exposure limit values: this must not apply to the obligations of employer to control the risk at source avoiding or reducing exposure to the minimum. Furthermore the attenuation power of individual hearing protectors is difficult to measure because his variability during the time and among different subjects. Then we evaluate and discus the new duties of Occupational Physician in this matter. The daily exposure limit values and action values are in fact in part modified as well as the methodology for organize the programs of prevention, health surveillance, information and formation of workers. As support for his activity we proposed the guidelines that The Italian Society of Occupational Health and Industrial Hygiene (SIMLII) has published in 2003, which provides recommendations for the health surveillance for the prevention of noise induced hearing loss at the workplace. PMID:17144410

  15. Patient-reported outcomes of parenteral somatostatin analogue injections in 195 patients with acromegaly

    Science.gov (United States)

    Strasburger, Christian J; Karavitaki, Niki; Störmann, Sylvère; Trainer, Peter J; Kreitschmann-Andermahr, Ilonka; Droste, Michael; Korbonits, Márta; Feldmann, Berit; Zopf, Kathrin; Sanderson, Violet Fazal; Schwicker, David; Gelbaum, Dana; Haviv, Asi; Bidlingmaier, Martin; Biermasz, Nienke R

    2016-01-01

    Background Long-acting somatostatin analogues delivered parenterally are the most widely used medical treatment in acromegaly. This patient-reported outcomes survey was designed to assess the impact of chronic injections on subjects with acromegaly. Methods The survey was conducted in nine pituitary centres in Germany, UK and The Netherlands. The questionnaire was developed by endocrinologists and covered aspects of acromegaly symptoms, injection-related manifestations, emotional and daily life impact, treatment satisfaction and unmet medical needs. Results In total, 195 patients participated, of which 112 (57%) were on octreotide (Sandostatin LAR) and 83 (43%) on lanreotide (Somatuline Depot). The majority (>70%) of patients reported acromegaly symptoms despite treatment. A total of 52% of patients reported that their symptoms worsen towards the end of the dosing interval. Administration site pain lasting up to a week following injection was the most frequently reported injection-related symptom (70% of patients). Other injection site reactions included nodules (38%), swelling (28%), bruising (16%), scar tissue (8%) and inflammation (7%). Injection burden was similar between octreotide and lanreotide. Only a minority of patients received injections at home (17%) and 5% were self-injecting. Over a third of patients indicated a feeling of loss of independence due to the injections, and 16% reported repeated work loss days. Despite the physical, emotional and daily life impact of injections, patients were satisfied with their treatment, yet reported that modifications that would offer major improvement over current care would be ‘avoiding injections’ and ‘better symptom control’. Conclusion Lifelong injections of long-acting somatostatin analogues have significant burden on the functioning, well-being and daily lives of patients with acromegaly. PMID:26744896

  16. /sup 195m/Au, a new generator-produced short-lived radionuclide for sequential assessment of ventricular performance by first pass radionuclide angiocardiography

    International Nuclear Information System (INIS)

    The feasibility of performing rapid sequential first pass radionuclide angiocardiography using a new short-lived radiotracer, (195mAu) half-life 30.5 seconds) was evaluated. This radionuclide emits a 262 keV gamma ray and is the daughter of (195mHg) (half-life 41.6 hours). The prototype tabletop 195mHg/195mAu generator produced 20 to 25 mCi of 195mAu in 2 ml of eluate (yield of 40 percent). The breakthrough of 195mHg in the eluate was 0.02 percent of the amount of 195mHg in the generator. The eluate contained 20 microCi of 195mHg per study, resulting in an estimated human radiation dose of 0.007 rad/study to the whole body and 0.34 rad/study to the kidney. Four dogs each had 15 to 20 sequential first pass studies performed with 1195mHg at 3 to 10 minute intervals using a computerized multicrystal gamma camera. During the left ventricular phase, 160,000 to 190,000 counts/s were acquired. The end-diastolic left ventricular region of interest contained 3,000 to 6,000 counts (background- and decay-corrected). Multiple reproducible values for left ventricular ejection fraction were obtained during stable conditions. The mean (+/- standard deviation) interstudy variability was 4 +/- 2 percent. During infusion of isoproterenol, rapid increase of left ventricular ejection fraction was demonstrated. Excellent agreement was observed between studies performed with /sup 99m/Tc-DTPA) and 195mAu. The mean interstudy difference was 4 +/- 3 percent. Thus, sufficiently high yield and dose are obtained from the 195mHg/195mAu generator for reliable high count rate first pass determination of left ventricular ejection fraction. This new short-lived radiotracer makes possible rapid sequential assessments of ventricular function at greatly reduced patient exposure to radiation

  17. MicroRNA-195 inhibits the proliferation of human glioma cells by directly targeting cyclin D1 and cyclin E1.

    Directory of Open Access Journals (Sweden)

    Wang Hui

    Full Text Available Glioma proliferation is a multistep process during which a sequence of genetic and epigenetic alterations randomly occur to affect the genes controlling cell proliferation, cell death and genetic stability. microRNAs are emerging as important epigenetic modulators of multiple target genes, leading to abnormal cellular signaling involving cellular proliferation in cancers.In the present study, we found that expression of miR-195 was markedly downregulated in glioma cell lines and human primary glioma tissues, compared to normal human astrocytes and matched non-tumor associated tissues. Upregulation of miR-195 dramatically reduced the proliferation of glioma cells. Flow cytometry analysis showed that ectopic expression of miR-195 significantly decreased the percentage of S phase cells and increased the percentage of G1/G0 phase cells. Overexpression of miR-195 dramatically reduced the anchorage-independent growth ability of glioma cells. Furthermore, overexpression of miR-195 downregulated the levels of phosphorylated retinoblastoma (pRb and proliferating cell nuclear antigen (PCNA in glioma cells. Conversely, inhibition of miR-195 promoted cell proliferation, increased the percentage of S phase cells, reduced the percentage of G1/G0 phase cells, enhanced anchorage-independent growth ability, upregulated the phosphorylation of pRb and PCNA in glioma cells. Moreover, we show that miR-195 inhibited glioma cell proliferation by downregulating expression of cyclin D1 and cyclin E1, via directly targeting the 3'-untranslated regions (3'-UTR of cyclin D1 and cyclin E1 mRNA. Taken together, our results suggest that miR-195 plays an important role to inhibit the proliferation of glioma cells, and present a novel mechanism for direct miRNA-mediated suppression of cyclin D1 and cyclin E1 in glioma.

  18. Eta photoproduction on the proton for photon energies from 0.75 to 1.95 GeV.

    Science.gov (United States)

    Dugger, M; Ritchie, B G; Ball, J; Pasyuk, E; Adams, G; Anciant, E; Anghinolfi, M; Asavapibhop, B; Audit, G; Auger, T; Avakian, H; Bagdasaryan, H; Barrow, S; Battaglieri, M; Beard, K; Bektasoglu, M; Bellis, M; Berman, B L; Bianchi, N; Biselli, A S; Boiarinov, S; Bouchigny, S; Bradford, R; Branford, D; Briscoe, W J; Brooks, W K; Burkert, V D; Calarco, J R; Capitani, G P; Carman, D S; Carnahan, B; Cetina, C; Clark, R; Cole, P L; Coleman, A; Connelly, J; Cords, D; Corvisiero, P; Crabb, D; Crannell, H; Cummings, J P; DeSanctis, E; DeVita, R; Degtyarenko, P V; Denizli, H; Dennis, L; Dharmawardane, K V; Dhuga, K S; Djalali, C; Dodge, G E; Doughty, D; Dragovitsch, P; Dytman, S; Eckhause, M; Egiyan, H; Egiyan, K S; Elouadrhiri, L; Farhi, L; Fatemi, R; Feldman, G; Feuerbach, R J; Ficenec, J; Forest, T A; Frolov, V; Funsten, H; Gaff, S J; Gai, M; Gavalian, G; Gilad, S; Gilfoyle, G P; Giovanetti, K L; Girard, P; Gordon, C I O; Griffioen, K; Guidal, M; Guillo, M; Guo, L; Gyurjyan, V; Hadjidakis, C; Hancock, D; Hardie, J; Heddle, D; Heimberg, P; Hersman, F W; Hicks, K; Hicks, R S; Holtrop, M; Hyde-Wright, C E; Ito, M M; Jenkins, D; Joo, K; Kelley, J H; Kellie, J D; Khandaker, M; Kim, W; Klein, A; Klein, F J; Klusman, M; Kossov, M; Koubarovski, V; Kramer, L H; Kuang, Y; Kuhn, S E; Kuhn, J; Lachniet, J; Laget, J M; Lawrence, D; Li, Ji; Livingston, K; Longhi, A; Lucas, M; Lukashin, K; Major, W; Manak, J J; Marchand, C; McAleer, S; McCarthy, J; McNabb, J W C; Mecking, B A; Mehrabyan, S; Mestayer, M D; Meyer, C A; Mikhailov, K; Minehart, R; Mirazita, M; Miskimen, R; Morand, L; Morrow, S A; Mozer, M U; Muccifora, V; Mueller, J; Murphy, L Y; Mutchler, G S; Napolitano, J; Nasseripour, R; Nelson, S O; Niccolai, S; Niculescu, G; Niculescu, I; Niczyporuk, B B; Niyazov, R A; Nozar, M; O'Brien, J T; O'Rielly, G V; Opper, A K; Park, K; Peterson, G; Philips, S A; Pivnyuk, N; Pocanić, D; Pogorelko, O; Polli, E; Pozdniakov, S; Preedom, B M; Price, J W; Prok, Y; Protopopescu, D; Qin, L M; Raue, B A; Riccardi, G; Ricco, G; Ripani, M; Ronchetti, F; Rossi, P; Rowntree, D; Rubin, P D; Sabatié, F; Sabourov, K; Salgado, C; Santoro, J P; Sanzone-Arenhovel, M; Sapunenko, V; Schumacher, R A; Serov, V S; Shafi, A; Sharabian, Y G; Shaw, J; Skabelin, A V; Smith, E S; Smith, T; Smith, L C; Sober, D I; Spraker, M; Stavinsky, A; Stepanyan, S; Stoler, P; Strakovsky, I I; Strauch, S; Taiuti, M; Taylor, S; Tedeschi, D J; Thoma, U; Thompson, R; Todor, L; Ungaro, M; Vineyard, M F; Vlassov, A V; Wang, K; Weinstein, L B; Weller, H; Weygand, D P; Whisnant, C S; Witkowski, M; Wolin, E; Wood, M H; Yegneswaran, A; Yun, J; Zhang, B; Zhao, J; Zhou, Z

    2002-11-25

    Differential cross sections for gammap-->etap have been measured with tagged real photons for incident photon energies from 0.75 to 1.95 GeV. Mesons were identified by missing mass reconstruction using kinematical information for protons scattered in the production process. The data provide the first extensive angular distribution measurements for the process above W=1.75 GeV. Comparison with preliminary results from a constituent quark model support the suggestion that a third S11 resonance with mass approximately 1.8 GeV couples to the etaN channel. PMID:12485062

  19. Assessment of left ventricular function at different levels of exercise using gold-195m in asymptomatic diabetics

    International Nuclear Information System (INIS)

    Left ventricular ejection fraction (LVEF) was evaluated by gold-195m first pass ventriculography in 10 diabetic patients with microangiopathy, in 10 diabetics without any complications, and in 10 healthy controls during maximum exercise. No differences among groups were present at rest, but at maximal exercise LVEF was significantly lower in microangiopathic patients than in the other two groups. Also muscle blood flow measured by xenon-133 washout was significantly lower during exercise in microangiopathic subjects. Small-vessel involvement of myocardium and muscle could play a role in the development of cardiovascular abnormalities during exercise in diabetics

  20. Recent progress in measuring β half-lives of nuclei approaching the r-process waiting point A = 195

    International Nuclear Information System (INIS)

    Heavy neutron-rich nuclei close to N=126 were produced by fragmentation of a 1A GeV208Pb beam at the FRS at GSI. The β-decay half-lives of 8 nuclides have been determined using a novel numerical analysis method. The comparison of the data with model calculations provides indications on the importance of first-forbidden transitions around A=195. The measured data indicate that the matter flow in the r-process to heavier fissioning nuclei may be faster than previously expected.

  1. Identification of a novel HLA-A allele, HLA-A*01:195, in a UAE national.

    Science.gov (United States)

    Abdrabou, Wael; Witzel, Ini-Isabée; Paduch, Agnieszka; Tay, Guan; Alsafar, Habiba

    2016-07-01

    A novel human leucocyte antigen (HLA)-A allele, HLA-A*01:195, was identified by sequence-based typing (SBT) in a UAE national subject. The novel allele is identical to its closest known allele, HLA-A*01:01:01:01, in exon 2, 3 and 4, except for a single nucleotide mutation of A to G at position 442 in exon 3 (codon 124 in the α2 domain of the α chain of the mature protein). This A to G mutation results in an amino acid change of isoleucine #124 to valine. PMID:27184862

  2. Analyses of Finite Element and Experimental Mode for Cylinder Block of Type 195 Diesel%S195柴油机机体的有限元分析和试验模态分析

    Institute of Scientific and Technical Information of China (English)

    赵伟敏; 杨超珍

    2001-01-01

    The dynamic characteristic analysis for cylinder block of S195 diesel engine is performed by use of dynamic finite element and e xperimental modal analysis. The results about natural frequency and modal shape in the finite element analysis and modal analysis are almost equal. Through defo rmation data analysis of forced response simulation on the block struction the t rouble mechanism is found. The results show that predicting the dynamic characte ristic and deformation by finite element analysis is reliable and efficient.%应用动态有限元和试验模态分析技术研究S195柴油机 机体的动 态特性,从固有频率和振型两个方面比较两种方法的分析结果,两者基本一致。通过结构的 受迫响应模拟,从各部分变形数据分析实际使用中的故障机理,结果表明:利用有限元分析 技术预测机体结构的动态特性和变形,可靠有效。

  3. Absorption cross section measurements of oxygen in the wavelength region 195-241 nm of the Herzberg continuum

    Science.gov (United States)

    Cheung, A. S.-C.; Yoshino, K.; Parkinson, W. H.; Freeman, D. E.; Guberman, S. L.

    1986-01-01

    The continuous absorption cross section of oxygen in the region 205-241 nm is studied as a function of path length and oxygen pressure. The technique used to study the continuous absorption cross section is described. Cross section measurements of oxygen in the wavelength region 193-205 nm obtained by Cheung et al. (1984) are applied in this experiment. The measured cross section is analyzed in terms of a Herzberg continuum and a pressure-dependent continuum. The total measured continuum cross section, the cross section involving two molecules of O2, and the Herzberg continuum absorption cross section values are calculated. It is observed that the Herzberg continuum cross section of oxygen values measured at 1 nm intervals in the region 195-241 nm, increase from 6.3 x 10 to the -24th sq cm at 195 nm to a maximum of 6.6 x 10 to the -24th sq cm at 201 nm and then decrease to 0.85 x 10 to the -24th sq cm at 241 nm. The Herzberg values are compared with data from previous investigations and the values correlate well.

  4. Novel approaches to animal and human pharmacology: Pharmacokinetic imaging with 195mPt-cisplatin and 195mPt-carboplatin and correlative functional imaging of the pathophysiological status of tumors

    International Nuclear Information System (INIS)

    Pharmacokinetic imaging (the measurement of the time course of a drug at a target site), when combined with functional imaging (the measurement of the functional properties of the host's target site), provide the key elements needed to understand whether a drug can reach its desired target site (tumor) and whether it will do so at rates and in amounts that will make that drug effective in that individual. We have now developed a method that allows for the concurrent measurement of all the three spaces of tumors: the cellular space can be studied by using the 195mPt-labeled drugs, the vascular space by using 99mTc-RBC's and the sum of all extracellular spaces by using 111In-DTPA. Performing such imaging studies in such an order allows for concurrent measurements, in as much as the energy window of the gamma camera can be moved from 195mPt (mostly 66-77 keV) to 99mTc (centred on 141 keV) to 111In (energies above 180 keV). Studies in an animal tumor model have shown that the parameters of cisplatin or of carboplatin can be estimated from the imaging data following administration of the 195mPt-labeled drugs. As a next step, the functional status of tumors is of particular importance, given that changes in the tumour's pathophysiology will modify greatly the ability of drugs to be delivered to that target site - and hence, to be effective as antitumour agents. This is especially critical for drugs whose tumor targeting is governed by first passage phenomena, such as cisplatin and 5-FU, but very different for drugs whose targeting is governed by slow diffusion processes. These functional studies allow the direct measurement of the relative contributions that the well vascularized regions, the poorly vascularized regions, and the non-vascularized regions will make in allowing drugs to be targeted to tumor cells, as well as of the relative proportion of the vascular and the IF spaces in such regions. A new approach to chemotherapeutic planning is proposed: the use of

  5. Research on rapeseed oil as an alternative fuel in the S195 type diesel engine%S195柴油机燃用菜籽油的试验

    Institute of Scientific and Technical Information of China (English)

    陈军; 师帅兵; 韩冰; 张娟利; 卢红春

    2001-01-01

    Using rapeseed oil as the fuel,the fuel performance of S195 type diesel engine was studied.It indicated that it is feasible to burn rapeseed oil or mixture of rapeseed oil and diesel oil without changing the structure of the engine;When burning the rapeseed oil or the mixture fuel in the engine,the exhaust pollution is on decline,but the specific fuel consumption rate and deposit charcoal of combustion chambers and injection nozzles are more than ever.The performance of the engine is rather good when burning the mixture of half rapeseed oil and half light diesel oil in volume and the angle of pre-oil-supplied be 20° CA.%以菜籽油为燃料,对S195柴油机燃油性能进行了研究。结果表明:在发动机结构不经改动的情况下,燃用菜籽油或菜籽油与柴油的混合油是可行的;发动机燃用菜籽油或混合油时,其排放污染下降,但耗油率均有所上升,且燃烧室和喷油嘴积炭较多;发动机燃用50%菜籽油与50%轻柴油的混合油,且供油提前角为20° CA时燃烧性能较好。

  6. Astatination of closo-dodecaborate(2-) anion

    Czech Academy of Sciences Publication Activity Database

    Orlova, A.; Lebeda, Ondřej; Tolmachev, V.; Lundquist, H.; Carlsson, J.; Sjöberg, S.

    Cambridge : The Royal Society of Chemistry , 2000 - (Davidson, M.; Hughes, A.; Marder, T.; Wade , K.), s. 144-147 [Conference "Contemporary Boron Chemistry ". Durham (GB), 11.07.1999-15.07.1999] Institutional research plan: CEZ:AV0Z1048901 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  7. M1 transitions between superdeformed states in 194,195Tl: The fingerprint of the i13/2 proton intruder orbital

    International Nuclear Information System (INIS)

    Recent data from the EUROGAM array have revealed dipole transitions linking signature partner superdeformed bands in 194Tl and 195Tl nuclei. Measurements of the decay branching ratios, taken together with the average quadrupole moment of the neighboring superdeformed nuclei, enable the absolute M1 strengths to be determined. From these data and using the strong coupling model, we find that two SD bands in 195Tl are due to the 81st proton being in the [642]5/2+ orbital and four from the six SD bands in 194Tl correspond to a configuration where the intrinsic spins of the single proton and single neutron are aligned. (orig.)

  8. Double-neutron capture reaction and natural abundance of 183W, 195Pt, and 199Hg isotopes

    International Nuclear Information System (INIS)

    The database for neutron cross sections is well developed over the nuclide chart for stable isotopes and not as much for the radioactive species. Double-neutron capture experiments could be productive to supply more data. Time-integrated mean flux of slow neutrons reaches a value of 2.3·1012 cm-2·s-1 at the irradiation port near the active zone of the IBR-2 pulsed reactor of JINR. This is enough to detect the double-neutron capture products by the activation method. A high capture cross section is deduced in the present experiment for intermediate radioactive 182Ta and 194Ir target nuclides. Together with the known one for 198Au, these values may prove an essential role of double-neutron capture process for nucleosynthesis of 183W, 195Pt, and 199Hg isotopes at stellar conditions.

  9. Moessbauer effect of 197Au, 99Ru, 193Ir, 195Pt, and 151Eu diluted in hydrogenated palladium

    International Nuclear Information System (INIS)

    The study of hidrogenation in transition metals by Moessbauer spectroscopy of 197Au, 99Ru, 195Pt, 193Ir and 151Eu diluted in palladium is presented. The measured parameters in the Moessbauer effect are sensitive to hydrogenation and allow to obtain information about phases of hydrogened systems, modifications of electronic structure and effects related to hydrogen mobility. The (Pd1-x Agx)0.99 Au0.01 was also investigated by 197Au Moessbauer effect. The relantioship between α and β phase Debye - Waller factors by Moessbauer effect was estimated. Source and absorber Moessbauer experiments to verifying isomer shift variation in function of hydrogen concentration were done. A proposal for description of the isomer shift of transition (or rare) impurities in transition matrices from state density of each system is presented. The contribution of H+ ions bound to IS is discussed qualitatively. (M.C.K.)

  10. Double-neutron capture reaction and natural abundance of 183W, 195Pt and 199Hg isotopes

    Science.gov (United States)

    Karamian, S. A.; Aksenov, N. V.; Bozhikov, G. A.

    2016-06-01

    There are much data on neutron cross sections over the chart of nuclides for stable isotopes and not as much for the radioactive ones. Double neutron capture experiments could be fruitful to provide more data. Time-integrated mean flux of slow neutrons reaches the value of 2.3-1012 n/cm2 s at the irradiation port near the active zone of the IBR-2 pulsed reactor of JINR. This is enough to detect the double neutron capture products by the activation method. A high capture cross section is obtained in the present experiment for intermediate radioactive 182Ta and 194Ir target nuclides. Together with the known data for 198Au, these values may prove an essential role of double neutron capture process for nucleosynthesis of 183W, 195Pt and 199Hg isotopes at stellar conditions.

  11. Impact of the first-forbidden β decay on the production of A ∼ 195 r-process peak

    Science.gov (United States)

    Nishimura, Nobuya; Podolyák, Zsolt; Fang, Dong-Liang; Suzuki, Toshio

    2016-05-01

    We investigated the effects of first-forbidden transitions in β decays on the production of the r-process A ∼ 195 peak. The theoretical calculated β-decay rates with β-delayed neutron emission were examined using several astrophysical conditions. As the FF decay is dominant in N ∼ 126 neutron-rich nuclei, their inclusion shortens β-decay lifetimes and shifts the abundance peak towards higher masses. Additionally, the inclusion of the β-delayed neutron emission results in a wider abundance peak, and smoothens the mass distribution by removing the odd-even mass staggering. The effects are commonly seen in the results of all adopted astrophysical models. Nevertheless there are quantitative differences, indicating that remaining uncertainty in the determination of half-lives for N = 126 nuclei is still significant in order to determine the production of the r-process peak.

  12. Identification of a Novel β-Globin Mutation (HBB: C.189_195delTCATGGC) in a Chinese Family.

    Science.gov (United States)

    He, Sheng; Lin, Li; Wei, Yuan; Chen, Biyan; Yi, Shang; Chen, Qiuli; Qiu, XiaoXia; Wei, Hongwei; Li, Guojian; Zheng, Chenguang

    2016-08-01

    β-Thalassemia (β-thal) is one of the most common genetic disorders worldwide. Molecular characterization of β-thal is essential for prevention and understanding the biology of the disease. More and more rare and novel mutations are being reported. Here, we report a novel 7 bp deletion at codons 63-65 (HBB: c.189_195delTCATGGC) in exon 2 of the β-globin gene in a family from Guangxi Province, China. This novel mutation causes a shift in the normal reading frame of the β-globin coding sequence and created a stop codon at codon 87 in exon 2, which leads to a β(0)-thal phenotype. PMID:27492766

  13. Low toxicity binder systems for tape cast Ce0.9Gd0.1O1.95 laminates

    DEFF Research Database (Denmark)

    Klemensø, Trine; Menon, Mohan; Ramousse, Severine

    2010-01-01

    Conventional binder systems for tape casting contain toxic phthalate plasticizers and butanone (MEK) as part of the solvent. The effects of exchanging the phthalate with a non-toxic alternative, and butanone with ethanol, were studied on laminates of high-green density CGO (Ce0.9Gd0.1O1.95) tapes....... Samples were prepared with a binder system containing DBP (dibutyl phthalate) plasticizer and MEK solvent, and with a binder system based on a non-toxic non-phthalate plasticizer and ethanol. In both systems, the weight ratio of plasticizer to the PVB (polyvinyl butyral) binder was varied between 0.......4 and 0.7. Substitution to the less toxic binder system had no adverse impacts on the microstructure. In fact, denser packing and improved homogeneity were observed with the non-phthalate-based system at ratio 0.5 indicating improved dispersion in this system. The denser packing also coincided...

  14. 50 nm continuously tunable MEMS VCSEL devices with surface micromachining operating at 1.95 µm emission wavelength

    International Nuclear Information System (INIS)

    An investigation of micro-electro-mechanical-system vertical-cavity surface-emitting lasers at 1.95 µm emission wavelength grown on InP is presented. The top sided distributed Bragg reflector has been substituted by a dielectric SiOx/SiNy membrane. Its deflection causes a continuous change of emission wavelength due to cavity tuning. The membrane actuation can be achieved in two different ways: by electrostatic attraction and electrothermal expansion. The recently developed surface-micro-machining technique allows both tuning mechanisms on one and the same device. The maximum achieved continuous tuning range is 50 nm with side-mode-suppression-ratios beyond 50 dB over the entire tuning range. Peak optical output powers of 1.0 to 1.8 mW with threshold current densities of 2.2 kA cm−2 will be presented. (fast track communication)

  15. Effects on rat testis of 1.95-GHz W-CDMA for IMT-2000 cellular phones.

    Science.gov (United States)

    Imai, Norio; Kawabe, Mayumi; Hikage, Takashi; Nojima, Toshio; Takahashi, Satoru; Shirai, Tomoyuki

    2011-08-01

    In recent years concern has arisen whether carrying a cellular phone near the reproductive organs such as the testes may cause dysfunction and particularly decrease in sperm development and production, and thus fertility in men. The present study was performed to investigate the effects of a 1.95 GHz electromagnetic field on testicular function in male Sprague-Dawley rats. Five week old animals were divided into 3 groups of 24 each and a 1.95-GHz wide-band code division multiple access (W-CDMA) signal, which is used for the freedom of mobile multimedia access (FOMA), was employed for whole body exposure for 5 hours per day, 7 days a week for 5 weeks (the period from the age of 5 to 10 weeks, corresponding to reproductive maturation in the rat). Whole-body average specific absorption rates (SAR) for individuals were designed to be 0.4 and 0.08 W/kg respectively. The control group received sham exposure. There were no differences in body weight gain or weights of the testis, epididymis, seminal vesicles, and prostate among the groups. The number of sperm in the testis and epididymis were not decreased in the electromagnetic field (EMF) exposed groups, and, in fact, the testicular sperm count was significantly increased with the 0.4 SAR. Abnormalities of sperm motility or morphology and the histological appearance of seminiferous tubules, including the stage of the spermatogenic cycle, were not observed. Thus, under the present exposure conditions, no testicular toxicity was evident. PMID:21204746

  16. The importance of residues 195-206 of human blood clotting factor VII in the interaction of factor VII with tissue factor

    International Nuclear Information System (INIS)

    Previous studies indicated that human and bovine factor VII exhibit 71% amino acid sequence identity. In the present study, competition binding experiments revealed that the interaction of human factor VII with cell-surface human tissue factor was not inhibited by 100-fold molar excess of bovine factor VII. This finding indicated that bovine and human factor VII are not structurally homologous in the region(s) where human factor VII interacts with human tissue factor. On this premise, the authors synthesized three peptides corresponding to regions of human factor VII that exhibited marked structural dissimilarity to bovine factor VII; these regions of dissimilarity included residues 195-206, 263-274, and 314-326. Peptide 195-206 inhibited the interaction of factor VII with cell-surface tissue factor and the activation of factor X by a complex of factor VIIa and tissue factor half-maximally at concentrations of 1-2 mM. A structurally rearranged form of peptide 195-206 containing an aspartimide residue inhibited these reactions half-maximally at concentrations of 250-300 μM. In contrast, neither peptide 263-274 nor peptide 314-326, at 2 mM concentration, significantly affected either factor VIIa interaction with tissue factor or factor VIIa-mediated activation of factor X. The data provide presumptive evidence that residues 195-206 of human factor VII are involved in the interaction of human factor VII with the extracellular domain of human tissue factor apoprotein

  17. Inhibition of fibrin polymerization by synthetic peptides corresponding to Aalpha195-205 and gamma69-77 sites of fibrin molecule

    NARCIS (Netherlands)

    Pozniak, T.A.; Urvant, L.P.; Gritsenko, P.; Chernishov, V.I.; Pydiura, N.A.; Lugovskoi, E.V.; Komisarenko, S.V.

    2014-01-01

    Using the idea of "proline brackets" we have found four sites in fibrin amino acid sequence, and appropriate peptides were synthesized: gamma69NPDESSKPN77, Bbeta228QPDSSVKPY236, Bbeta455RPFFPQ460 and Aalpha195LPSRDRQHLPL205. Turbidity and electron-microscopy analyses have demonstrated that synthetic

  18. Densification and Grain Growth during Early-stage Sintering of Ce0.9Gd0.1O1.95-δ in Reducing Atmosphere

    DEFF Research Database (Denmark)

    He, Zeming; Yuan, Hao; Glasscock, Julie;

    2010-01-01

    The present work investigates the processes of densification and grain growth of Ce0.9Gd0.1O1.95-δ (CGO10) during sintering in reducing atmosphere. Sintering variables were experimentally characterized and analyzed using defect chemistry and sintering constitutive laws. Based on the achieved...

  19. Powder electrochemical properties with different particle sizes of spinel LiAl0.05Mn1.95O4 synthesized by sol-gel method

    Institute of Scientific and Technical Information of China (English)

    YI Tingfeng; WANG Dianlong; GAO Kun; HU Xinguo

    2007-01-01

    An Al-doped spinel lithium manganese oxide was prepared by the adipic acid-assisted sol-gel method at 800℃, and the cathode materials (LiAl0.05Mn1.95O4) with different particle sizes were obtained through ball milling. The effects of particle size on the electrochemical performance of LiAl0.05Mn1.95O4 samples were investigated by differential thermal analysis and thermogravimetry, X-ray diffraction, galvanostatic charge-discharge test, cyclic voltammetry, and electrochemical impedance spectroscopy. The results indicate that all samples with different particle sizes show the same pure spinel phase and good crystal structure; LiAl0.05Mn1.95O4 with D50 = 17.3 μm shows better capacity retention; LiAl0.05Mn1.95O4 cathode materials with small particle size have a bigger resistance of charge transfer than the large one, and the particle size has significant effects on the electrochemical performance of Al-doped spinel LiMn2O4 cathode materials.

  20. Chemonuclear studies for identification for new production routes for the therapeutically useful radionuclides 140Nd, 192Ir, 191Pt, 193mPt, und 195mPt

    International Nuclear Information System (INIS)

    New production routes for the therapeutically useful radionuclides 140Nd, 192Ir, 191Pt, 193mPt and 195mPt were investigated. Cross section data were measured using the stacked-foil technique and compared with theoretical calculations. A production method for the platinum nuclides was developed. The 141Pr(p, 2n)140Nd and natCe(3He, xn)140Nd reactions were investigated for production of 140Nd. Cross section data of nuclear reactions leading to the side products 141Nd, 139Nd and 139Ce could also be achieved. The experimental data were compared with theoretical calculations using the code ALICE-IPPE. A comparison of the calculated thick target yields showed that the 141Pr(p, 2n)140Nd reaction gives a higher yield. The 192Os(p, n)192Ir reaction was examined in the context of the production of 192Ir. Cross section data were determined and compared with theoretical calculations using the codes ALICE-IPPE and EMPIRE II. The yield of this reaction was compared with the yield of the reactor production of this nuclide. The reactor production seems to be more suitable because of a higher purity and yield. Cross section data were measured for the 192Os(α, n)195mPt, 192Os(α, 3n)193mPt and 192Os(3He, 4n)191Pt reactions. The activity of 193mPt and 195mPt was determined by X-ray spectroscopy after a chemical separation procedure. The ALICE-IPPE code was found to be inappropriate to reproduce the experimental values. The calculated yields were compared with the yields of other reactions, especially the reactor production of 195mPt. The yield of the 192Os(α, n)195mPt reaction is lower compared to the yield of the reactor production, but offers lower target costs and higher specific activity. A production method for 193mPt and 195mPt was developed. Batch yields of 0.9 MBq 195mPt (specific activity of about 150 GBq/g Pt) and 8.7 MBq 193mPt (ca. 3 TBq/g Pt) could be achieved. The experimental yields were compared with the calculated yields. The agreement between these two data sets

  1. 儿童非霍奇金淋巴瘤195例临床病理分析%Clinical pathologic study of 195 cases of childhood non-Hodgkin s lymphoma

    Institute of Scientific and Technical Information of China (English)

    王佳; 奚政君; 李稻

    2011-01-01

    Objective To evaluate the clinical and pathological features of childhood non-Hodgkin's lymphoma (NHL). Methods A total of 195 NHL cases, with age younger than twelve years old, diagnosed from January 1982 to January 2010 in Xinhua Hospital were reviewed. Results The peak onset age is 6 - 8 years old. The male to female ratio is 2.3 : 1 and male patients predominate in each subtype. The cases in stage III and IV account for 49.2%. The most common subtypes were lymphoblastic lymphoma (LBL) , Burkitt lymphoma (BL) and anaplastic large cell lymphoma (ALCL). About 88.8% cases of LBL is T-cell lymphoma while all the BL is B-cell lymphoma and all the ALCL is T-cell lymphoma. More than 1/3 (37.9%) of all the cases have primary extranodal lymphoma. More than one organ involvement was found in 56.1% of LBL cases when they were diagnosed. Conclusions Childhood NHL differs greatly from adult NHL in clinical and pathological aspects. Immunohistochemistry plays an important role in diagnosis.%目的 探讨儿童非霍奇金淋巴瘤(NHL)的临床病理特点.方法 收集1982年1月-2010年1月诊断的非霍奇金淋巴瘤病例195例,进行临床和病理分析.结果 儿童NHL发病年龄高峰在6~8岁,男女之比为2.3:1,III期和IV期占49.2%.病理组织类型主要有淋巴母细胞性淋巴瘤(LBL)、Burkitt淋巴瘤(BL)、间变性大细胞性淋巴瘤(ALCL);88.8%LBL为T细胞性淋巴瘤,BL皆为B细胞性淋巴瘤,ALCL皆为T细胞性淋巴瘤.37.9%病例首发于淋巴结外组织,56.1%LBL患儿确诊时已累及1个以上部位.结论 儿童NHL的临床及病理表现与成人NHL存在很大差异.免疫组化等技术对NHL的病理诊断有重要作用.

  2. CXC195 suppresses proliferation and inflammatory response in LPS-induced human hepatocellular carcinoma cells via regulating TLR4-MyD88-TAK1-mediated NF-κB and MAPK pathway

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Yiting [Department of Oncology, The Second Affiliated Hospital of Nanchang University, Nanchang (China); Tu, Qunfei [Department of Thyroid Surgery, The Second Affiliated Hospital of Nanchang University, Nanchang (China); Yan, Wei; Xiao, Dan; Zeng, Zhimin; Ouyang, Yuming; Huang, Long; Cai, Jing; Zeng, Xiaoli; Chen, Ya-Jie [Department of Oncology, The Second Affiliated Hospital of Nanchang University, Nanchang (China); Liu, Anwen, E-mail: liuanweinanchang@163.com [Department of Oncology, The Second Affiliated Hospital of Nanchang University, Nanchang (China)

    2015-01-02

    Highlights: • CXC195 exhibited significant anti-proliferative effect and induced cell cycle arrest in LPS-induced HepG2 cells. • CXC195 suppressed the release of pro-inflammatory mediators in LPS-induced HepG2 cells. • CXC195 regulated TLR4-MyD88-TAK1-mediated NF-κB and MAPK pathway in LPS-induced HepG2 cells. - Abstract: CXC195 showed strong protective effects in neuronal apoptosis by exerting its antioxidant activity. However, the anti-cancer effects of CXC195 is still with limited acquaintance. Here, we investigated the role of CXC195 in lipopolysaccharide (LPS)-induced human hepatocellular carcinoma (HCC) cells lines (HepG2) and the possible signaling pathways. CXC195 exhibited significant anti-proliferative effect and induced cell cycle arrest in LPS-induced HepG2 cells. In addition, CXC195 suppressed the release of pro-inflammatory mediators in LPS-induced HepG2 cells, including TNF-α, iNOS, IL-1β, IL-6, CC chemokine ligand (CCL)-2, CCL-22 and epidermal growth factor receptor (EGFR). Moreover, CXC195 inhibited the expressions and interactions of TLR4, MyD88 and TAK1, NF-κB translocation to nucleus and its DNA binding activity, phosphorylation of ERK1/2, p38 and JNK. Our results suggested that treatment with CXC195 could attenuate the TLR4-mediated proliferation and inflammatory response in LPS-induced HepG2 cells, thus might be beneficial for the treatment of HCC.

  3. Orientation Selection and Microstructural Evolution in Directionally Solidified Tb0.3Dy0.7Fe1.95

    Science.gov (United States)

    Palit, Mithun; Banumathy, S.; Singh, A. K.; Pandian, S.; Chattopadhyay, Kamanio

    2016-04-01

    Tb0.3Dy0.7Fe1.95 alloy was directionally solidified by using a modified Bridgman technique at a wide range of growth rates of 5 to 100 cm/h. The directionally grown samples exhibited plane front solidification morphology up to a growth rate of 90 cm/h. Typical island banding feature was observed closer to the chilled end, which eventually gave rise to irregular peritectic coupled growth (PCG). The PCG gained prominence with an increase in the growth rate. The texture study revealed formation of strong texture in a lower growth rate regime, and "rotated " in an intermediate growth regime, and in a higher growth rate regime. In-depth analysis of the atomic configuration of a solid-liquid interface revealed that the growth texture is influenced by the kinetics of atomic attachment to the solid-liquid interface, which is intimately related to a planar packing fraction and an atomic stacking sequence of the interfacial plane. The mechanism proposed in this article is novel and will be useful in addressing the orientation selection mechanism of topologically closed packed intermetallic systems. The samples grown at a higher growth rate exhibit larger magnetostriction ( λ) and dλ/dH owing to the absence of pro-peritectic (Tb,Dy)Fe3 and formation of texture, which lies closer to the easy magnetization direction (EMD).

  4. Early hominin diet included diverse terrestrial and aquatic animals 1.95 Ma in East Turkana, Kenya.

    Science.gov (United States)

    Braun, David R; Harris, John W K; Levin, Naomi E; McCoy, Jack T; Herries, Andy I R; Bamford, Marion K; Bishop, Laura C; Richmond, Brian G; Kibunjia, Mzalendo

    2010-06-01

    The manufacture of stone tools and their use to access animal tissues by Pliocene hominins marks the origin of a key adaptation in human evolutionary history. Here we report an in situ archaeological assemblage from the Koobi Fora Formation in northern Kenya that provides a unique combination of faunal remains, some with direct evidence of butchery, and Oldowan artifacts, which are well dated to 1.95 Ma. This site provides the oldest in situ evidence that hominins, predating Homo erectus, enjoyed access to carcasses of terrestrial and aquatic animals that they butchered in a well-watered habitat. It also provides the earliest definitive evidence of the incorporation into the hominin diet of various aquatic animals including turtles, crocodiles, and fish, which are rich sources of specific nutrients needed in human brain growth. The evidence here shows that these critical brain-growth compounds were part of the diets of hominins before the appearance of Homo ergaster/erectus and could have played an important role in the evolution of larger brains in the early history of our lineage. PMID:20534571

  5. Development of a diagnostic schedule for a defective LC-195V5 CNC milling machine using PERT

    Directory of Open Access Journals (Sweden)

    Oluwole Olayinka AGBOOLA

    2016-07-01

    Full Text Available Computer Numerical Control CNC machine tools usage are more and more extensive, its fault diagnosis research is becoming more essential. Failure forms accorded these machines are diversified, and fault reasons are very complicated. It should not be left unattended to, because this could lead to further deterioration. One of the parameters used in determining the efficiency of a technician (who repairs machine tools is the time saved in locating faults, hence the development of a diagnostic schedule which shows the sequential means of troubleshooting within a possible shortest time. In this research two approaches were used to diagnose a defective LC-195V5 CNC milling machine. Forward Pass (FP, which involves the diagnosis from electrical parts through Computer (CNC to mechanical component and Backward Pass (BP which involves the diagnosis from computer component through electrical parts to mechanical parts. Three different trials were conducted for each of the mode of diagnosis and the time to diagnose each component part was recorded. Based on the interrelationship of the component parts, two separate PERT (Project Evaluation & Review Techniques network diagrams were drawn and their Critical Paths were determined. The study reveals that Foward Pass method was able to save more time.

  6. Early hominin diet included diverse terrestrial and aquatic animals 1.95 Ma in East Turkana, Kenya

    Science.gov (United States)

    Braun, David R.; Harris, John W. K.; Levin, Naomi E.; McCoy, Jack T.; Herries, Andy I. R.; Bamford, Marion K.; Bishop, Laura C.; Richmond, Brian G.; Kibunjia, Mzalendo

    2010-01-01

    The manufacture of stone tools and their use to access animal tissues by Pliocene hominins marks the origin of a key adaptation in human evolutionary history. Here we report an in situ archaeological assemblage from the Koobi Fora Formation in northern Kenya that provides a unique combination of faunal remains, some with direct evidence of butchery, and Oldowan artifacts, which are well dated to 1.95 Ma. This site provides the oldest in situ evidence that hominins, predating Homo erectus, enjoyed access to carcasses of terrestrial and aquatic animals that they butchered in a well-watered habitat. It also provides the earliest definitive evidence of the incorporation into the hominin diet of various aquatic animals including turtles, crocodiles, and fish, which are rich sources of specific nutrients needed in human brain growth. The evidence here shows that these critical brain-growth compounds were part of the diets of hominins before the appearance of Homo ergaster/erectus and could have played an important role in the evolution of larger brains in the early history of our lineage. PMID:20534571

  7. Characterization of the four new transiting planets KOI-188b, KOI-195b, KOI-192b, and KOI-830b

    CERN Document Server

    Hebrard, G; Montagnier, G; Bruno, G; Deleuil, M; Havel, M; Almenara, J -M; Damiani, C; Barros, S C C; Bonomo, A S; Bouchy, F; Diaz, R F; Moutou, C

    2014-01-01

    The characterization of four new transiting extrasolar planets is presented here. KOI-188b and KOI-195b are bloated hot Saturns, with orbital periods of 3.8 and 3.2 days, and masses of 0.25 and 0.34 M_Jup, respectively. They are located in the low-mass range of known transiting, giant planets. KOI-192b has a similar mass (0.29 M_Jup) but a longer orbital period of 10.3 days. This places it in a domain where only few planets are known. KOI-830b, finally, with a mass of 1.27 M_Jup and a period of 3.5 days, is a typical hot Jupiter. The four planets have radii of 0.98, 1.09, 1.2, and 1.08 R_Jup, respectively. We detected no significant eccentricity in any of the systems, while the accuracy of our data does not rule out possible moderate eccentricities. The four objects were first identified by the Kepler Team as promising candidates from photometry of the Kepler satellite. We establish here their planetary nature thanks to the radial velocity follow-up we secured with the HARPS-N spectrograph at the Telescopio N...

  8. Structure of the central RNA recognition motif of human TIA-1 at 1.95 A resolution

    International Nuclear Information System (INIS)

    T-cell-restricted intracellular antigen-1 (TIA-1) regulates alternative pre-mRNA splicing in the nucleus, and mRNA translation in the cytoplasm, by recognizing uridine-rich sequences of RNAs. As a step towards understanding RNA recognition by this regulatory factor, the X-ray structure of the central RNA recognition motif (RRM2) of human TIA-1 is presented at 1.95 A resolution. Comparison with structurally homologous RRM-RNA complexes identifies residues at the RNA interfaces that are conserved in TIA-1-RRM2. The versatile capability of RNP motifs to interact with either proteins or RNA is reinforced by symmetry-related protein-protein interactions mediated by the RNP motifs of TIA-1-RRM2. Importantly, the TIA-1-RRM2 structure reveals the locations of mutations responsible for inhibiting nuclear import. In contrast with previous assumptions, the mutated residues are buried within the hydrophobic interior of the domain, where they would be likely to destabilize the RRM fold rather than directly inhibit RNA binding

  9. Dyeing properties of Reactive Red 195 on ramie yarn in liquid ammonia%活性红195对苎麻纱线的液氨染色性能研究

    Institute of Scientific and Technical Information of China (English)

    黄迎亚; 刘帆; 何林蔚; 彭雄义; 蔡映杰; 曾庆福

    2015-01-01

    采用环氧丙基三甲基氯化铵对苎麻纱线进行阳离子改性.对未改性和阳离子改性的苎麻纱线,使用活性红195在液氨中于-35℃,浴比1:35,染色时间10~600 s,染料用量1%~100%(omf)进行染色;染后在100℃下焙烘10 min.结果表明阳离子改性可提高染料竭染率、固色效率和耐水洗色牢度,但稍微降低耐摩擦色牢度.未改性和改性苎麻纱线在液氨染色中,染料的竭染率随染色时间的延长而增加,分别在60 s和180 s时达到染色平衡,其对应的竭染率分别为21%和34%;未改性苎麻纱线的固色效率在40%~76%,而改性苎麻纱线则高达100%.未改性和改性苎麻纱线在液氨染色中的染料竭染率随染料用量的增加而下降;未改性苎麻纱线的固色效率在25%~34%,而改性苎麻纱线则从染料用量50%(omf)时的100%下降到染料用量100%(omf)时的85%.但是,2种纱线的单位质量染料吸附量都随着染料用量的增加呈直线上升的趋势.%Cationic modified ramie yarn was prepared with 2,3- epoxypropytrimethylammonium chloride agent. Subsequently, the control and cationic modified ramie yarns were dyed in liquid ammonia with Reactive Red 195 at a liquor ratio of 1:35 with 1%~100%(omf) of dye concentration at- 35 ℃ for 10 s to 600 s. After dyeing, the samples were cured at 100 ℃ for 10 min. The results showed that the cationic modification in-creased the dye exhaustion and fixation, and improved the washing fastness, but decreased the rubbing fast-ness. The exhaustion percentages of both control and cationic modified ramie yarn were increased with the in-creasing of dyeing time, and the equilibrium was reached at 60 s and 180 s with 21% and 34% of exhaustion percentage, respectively. The fixation values of control ramie were between 40%~76%, while the cationic ones were approaching to 100%. The exhaustion percentage of both samples decreased with the increase of dye concentration. The fixation efficiency of control ramie

  10. Synthesis of 195mPt radiolabeled (-)-(R)-2-aminomethylpyrrolidine (1,1-cyclobutanedicarboxylato)-2-platinum(II) monohydrate using high performance liquid chromatography

    International Nuclear Information System (INIS)

    An experimental method is described for the synthesis of 195mPt-radiolabeled (-)-(R)-2-aminomethylpyrrolidine (1,1-cyclobutanedicarboxylato)-2-platinum (II) (DWA2114R). An amount of 10 mg of 95% enriched 194Pt was irradiated for 75 h in the hydraulic conveyer of the KUR at a thermal neutron flux of approximately 8.1x1013 n.cm-2.sec-1 and the 195mPt-radiolabeled DWA2114R was purified using HPLC. The chemical yield is higher than 65%, its chemical purity is greater than 99.2%, the radiochemical purity is nearly 100%, and the specific activity is 6.7 MBq. mg-1 DWA2114R. (author) 12 refs.; 4 figs.; 1 tab

  11. M1 transitions between superdeformed states in {sup 194,195}Tl: The fingerprint of the i{sub 13/2} proton intruder orbital

    Energy Technology Data Exchange (ETDEWEB)

    Azaiez, F.; Duprat, J.; Sharpey-Schafer, J.F.; Aiche, M.; Bastin, G.; Beausang, C.W.; Bourgeois, C.; Clark, R.M.; Deloncle, I.; Duffait, R.; Gale, S.J.; Gall, B.; Hannachi, F.; Hibbert, I.; Joyce, M.J.; Kaci, A.; Kelly, W.H.; Korichi, A.; Le Coz, Y.; Meyer, M.; Perrin, N.; Poffe, N.; Porquet, M.G.; Redon, N.; Sergolle, H.; Schuck, C.; Simpson, J.; Wadsworth, R. [Inst. de Physique Nucleaire, 91 Orsay (France)]|[Oliver Lodge Lab., Univ. of Liverpool (United Kingdom)]|[C.S.N.S.M., IN2P3-CNRS, 91 Orsay (France)]|[Nuclear Structure Facility, Daresbury Lab., Daresbury, Warrington (United Kingdom)]|[Inst. de Physique Nucleaire de Lyon, IN2P3-CNRS, Univ. Claude Bernard, 69 Villeurbanne (France)]|[Dept. of Physics, Univ. of York (United Kingdom)]|[Iowa State Univ., Ames, IA (United States)]|[Univ. of Oxford, Dept. of Physics (United Kingdom)

    1995-12-31

    Recent data from the EUROGAM array have revealed dipole transitions linking signature partner superdeformed bands in {sup 194}Tl and {sup 195}Tl nuclei. Measurements of the decay branching ratios, taken together with the average quadrupole moment of the neighboring superdeformed nuclei, enable the absolute M1 strengths to be determined. From these data and using the strong coupling model, we find that two SD bands in {sup 195}Tl are due to the 81st proton being in the [642]5/2{sup +} orbital and four from the six SD bands in {sup 194}Tl correspond to a configuration where the intrinsic spins of the single proton and single neutron are aligned. (orig.).

  12. Synthesis of 195mPt radiolabelled cis-diamminedichloroplatinum(II) of high chemical and radiochemical purity using high performance liquid chromatography

    International Nuclear Information System (INIS)

    An improved method is described for the synthesis of 195mPt-radiolabelled cis-diamminedichloroplatinum(II). An amount of 10 mg of 95% enriched 194Pt was irradiated for 75 h in the hydraulic conveyer of the Kyoto University Reactor at a thermal neutron flux of approximately 8.15x1013 n.cm-2.sec-1 and the 195mPt-radiolabelled CDDP was purified using HPLC. The chemical yield is 61%, chemical purity is greater than 99.74%, the radiochemical purity is nearly 100%, and the specific activity is 7.4x106 Bq mg-1 CDDP (200 μCi mg-1 CDDP). (author) 9 refs.; 5 figs.; 1 tab

  13. Three-dimensional photonic crystal with a stop band from 1.35 to 1.95thinspthinspμ m

    International Nuclear Information System (INIS)

    A combination of advanced silicon-processing techniques was used to create three-dimensional (3D) photonic crystals with a 180-nm minimum feature size. The resulting 3D crystal displayed a strong stop band at optical wavelengths from λ=1.35 μm to λ=1.95 μm . This is believed to be the smallest 3D crystal with a complete 3D photonic bandgap ever created. copyright 1999 Optical Society of America

  14. Site-directed mutagenesis from Arg195 to His of a microalgal chloroplastidial glycerol-3-phosphate acyltransferase causes an increase in phospholipid levels in yeast

    Directory of Open Access Journals (Sweden)

    Long-Ling eOuyang

    2016-03-01

    Full Text Available To analyze the contribution of glycerol-3-phosphate acyltransferase (GPAT to the first acylation of glycerol-3-phosphate (G-3-P, the present study focused on a functional analysis of the GPAT gene from Lobosphaera incisa (designated as LiGPAT and the subcellular localization of the encoded protein LiGPAT. A full-length cDNA of LiGPAT consisting of a 1,305-bp ORF, a 1,652-bp 5′-UTR, and a 354-bp 3′-UTR, was cloned. The ORF encoded a 434-amino acid peptide, of which 63 residues at the N-terminus defined a chloroplast transit peptide. LiGPAT was exclusively localized to chloroplasts, which was shown by co-expression of LiGPAT with eGFP in Chlamydomonas reinhardtii and by immunogold labeling in L. incisa. Considering the conservation of His among the G-3-P binding sites from chloroplastidial GPATs and the substitution of His by Arg at position 195 in the LiGPAT mature protein (designated mLiGPAT, we established the heterologous expression of either mLiGPAT or its mutant (Arg195His (sdmLiGPAT in the GPAT-deficient yeast mutant gat1Δ. Lipid profile analyses of these transgenic yeasts not only validated the acylation function of LiGPAT but also indicated that the site-directed mutagenesis from Arg195 to His led to an increase in the phospholipid level in yeast. Semi-quantitative analysis of mLiGPAT and sdmLiGPAT, together with the structural superimposition of their G-3-P binding sites, indicated that the increased enzymatic activity was caused by the enlarged accessible surface of the phosphate group binding pocket when Arg195 was mutated to His. Thus, the potential of genetic manipulation of GPAT to increase the glycerolipid level in L. incisa and other microalgae would be of great interest.

  15. Effect of Addition of Al on Crystal Structure Microtexture and Magnetostriction Coefficient in Tb0.3 Dy0.7 Fe1.95 Alloy

    Institute of Scientific and Technical Information of China (English)

    Jiang Liping; Zhao Zengqi; Wu Shuangxia; Huang Jimin; Zuo Liang

    2004-01-01

    The effect of addition of A1 on crystal structure microtexture and magnetostrictioncoefficient in Tb0.3Dy0.7Fe1.95 alloy were studied.The results show that addition of A1 does not change crystal structure of alloy and the precipitates increase in the microtexture as addition of A1 increases.At a certain magnetic field, magnetostriction coefficient decreased as addition of Al increased.

  16. The use of tumour markers CEA, CA-195 and CA-242 in evaluating the response to chemotherapy in patients with advanced colorectal cancer.

    OpenAIRE

    Ward, U.; Primrose, J N; Finan, P. J.; Perren, T. J.; Selby, P.; Purves, D. A.; Cooper, E H

    1993-01-01

    Tumour markers CEA, CA-195 and CA-242 were measured in 33 patients undergoing chemotherapy for advanced colorectal cancer. The aim was to determine whether they could be used to accurately monitor the course of the disease, and reduce the need for imaging. Treatment with a 5-fluorouracil based regimen resulted in a partial response in nine patients (27%), whereas the remainder either had disease stabilisation or suffered from progression. Before treatment the CEA was elevated in 85% of patien...

  17. A Retrospective Analysis of 5,195 Patient Treatment Sessions in an Integrative Veterinary Medicine Service: Patient Characteristics, Presenting Complaints, and Therapeutic Interventions

    OpenAIRE

    Justin Shmalberg; Memon, Mushtaq A.

    2015-01-01

    Integrative veterinary medicine, the combination of complementary and alternative therapies with conventional care, is increasingly prevalent in veterinary practice and a focus of clinical instruction in many academic teaching institutions. However, the presenting complaints, therapeutic modalities, and patient population in an integrative medicine service have not been described. A retrospective analysis of 5,195 integrative patient treatment sessions in a veterinary academic teaching hospit...

  18. The quadrupole moments of 195-197Ausup(m)(11/2) and the low temperature thermal relaxation of gold in cadmium

    International Nuclear Information System (INIS)

    sup(195, 197m)Hg has been oriented at low temperature in a cadmium single crystal. From the orientation pattern of the 388 keV gamma ray Vsub(zz)(HgCd) = +1.82(25)x1018 V/cm2 has been deduced. Using the dipole-relaxation mechanism on the gold isomeric state, the relaxation constant Csub(K) = 0.044(5)Ks, the quadrupole interaction frequencies γsub(Q)(195m-AuCd) = +395(18) MHz, γsub(Q)(197m-AuCd) = +380(58) MHz and delta(E2/M1 ; 261 keV) < 0 are obtained from the orientation pattern of the 261 and 279 keV gamma rays. Using literature electric field gradient of gold in cadmium, Q(195m-Au,11/2) = (+)1.41(10) b and Q(197m-Au,11/2) = (+)1.35(22) b can be deduced. (Auth.)

  19. Oxygen permeation in thin, dense Ce0.9Gd0.1O 1.95- membranes II. experimental determination

    DEFF Research Database (Denmark)

    Chatzichristodoulou, Christodoulos; Søgaard, Martin; Glasscock, Julie; Kaiser, Andreas; Foghmoes, Søren Preben Vagn; Hendriksen, Peter Vang

    2011-01-01

    Thin (∼30 m), dense Ce0.9Gd0.1O1.95- (CGO10) membranes (5 5 cm2+) supported on a porous NiO/YSZ substrate were fabricated by tape casting, wet powder spraying and lamination. A La 0.58Sr0.4Co0.2Fe0.8O 3-δ/Ce0.9Gd0.1O1.95- (LSCF/CGO10) composite cathode was applied by screen printing. Oxygen......L min-1 cm-2 at 1175 K. The measured oxygen flux was in good agreement with theoretical predictions from a model that takes into account the bulk transport properties of Ce0.9Gd 0.1O1.95-, the anode and cathode polarisation resistances, and the gas conversion and gas diffusion losses in the permeate...... did not reveal any significant microstructural degradation of the CGO10 membrane or the anode-support. © 2011 The Electrochemical Society....

  20. Influence of conductive electroactive polymer polyaniline on electrochemical performance of LiMn1.95Al0.05O4 cathode for lithium ion batteries

    Indian Academy of Sciences (India)

    Chang-Ling Fan; Hari Om; Ke-He Zhang; Shao-Chang Han

    2013-11-01

    Conductive electroactive polymer polyaniline is utilized to substitute conductive additive acetylene black in the LiMn1.95Al0.05O4 cathode for lithium ion batteries. Results show that LiMn1.95Al0.05O4 possesses stable structure and good performance. Percolation theory is used to optimize the content of conductive additive in cathode. It shows that the conductivity of cathode reaches its maximum value when the content of conductive additives is 15 wt%. This is in agreement with the results of charge and discharge experiments. The application of polyaniline can evidently enhance the electrochemical performance of cathode. The discharge capacity of cathode using 15 wt% polyaniline is 95.9 mAh g-1 at the current density of 170 mA g-1. The charge transfer resistance under different depths of discharge of cathode is much lower compared with the use of acetylene black. It can be concluded that the application of polyaniline in cathode can greatly improve the electrochemical performances of LiMn1.95Al0.05O4 cathode.

  1. Chemonuclear studies for identification for new production routes for the therapeutically useful radionuclides {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt, und {sup 195m}Pt; Kernchemische Studien zur Entwicklung neuerer Produktionsverfahren fuer die therapierelevanten Radionuklide {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt, und {sup 195m}Pt

    Energy Technology Data Exchange (ETDEWEB)

    Hilgers, K.

    2005-12-15

    New production routes for the therapeutically useful radionuclides {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt and {sup 195m}Pt were investigated. Cross section data were measured using the stacked-foil technique and compared with theoretical calculations. A production method for the platinum nuclides was developed. The {sup 141}Pr(p, 2n){sup 140}Nd and {sup nat}Ce({sup 3}He, xn){sup 140}Nd reactions were investigated for production of {sup 140}Nd. Cross section data of nuclear reactions leading to the side products {sup 141}Nd, {sup 139}Nd and {sup 139}Ce could also be achieved. The experimental data were compared with theoretical calculations using the code ALICE-IPPE. A comparison of the calculated thick target yields showed that the {sup 141}Pr(p, 2n){sup 140}Nd reaction gives a higher yield. The {sup 192}Os(p, n){sup 192}Ir reaction was examined in the context of the production of {sup 192}Ir. Cross section data were determined and compared with theoretical calculations using the codes ALICE-IPPE and EMPIRE II. The yield of this reaction was compared with the yield of the reactor production of this nuclide. The reactor production seems to be more suitable because of a higher purity and yield. Cross section data were measured for the {sup 192}Os({alpha}, n){sup 195m}Pt, {sup 192}Os({alpha}, 3n){sup 193m}Pt and {sup 192}Os({sup 3}He, 4n){sup 191}Pt reactions. The activity of {sup 193m}Pt and {sup 195m}Pt was determined by X-ray spectroscopy after a chemical separation procedure. The ALICE-IPPE code was found to be inappropriate to reproduce the experimental values. The calculated yields were compared with the yields of other reactions, especially the reactor production of {sup 195m}Pt. The yield of the {sup 192}Os({alpha}, n){sup 195m}Pt reaction is lower compared to the yield of the reactor production, but offers lower target costs and higher specific activity. A production method for {sup 193m}Pt and {sup 195m}Pt was developed. Batch yields of 0.9 MBq

  2. Physical and underway data collected aboard the KNORR during cruise KN195-07 in the North Pacific Ocean from 2009-04-27 to 2009-05-01 (NODC Accession 0104273)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104273 includes physical and underway data collected aboard the KNORR during cruise KN195-07 in the North Pacific Ocean from 2009-04-27 to...

  3. Physical and underway data collected aboard the KNORR during cruise KN195-05 in the South Pacific Ocean from 2009-03-24 to 2009-04-05 (NODC Accession 0104271)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104271 includes physical and underway data collected aboard the KNORR during cruise KN195-05 in the South Pacific Ocean from 2009-03-24 to...

  4. Physical and underway data collected aboard the KNORR during cruise KN195-09 in the Bering Sea and North Pacific Ocean from 2009-06-02 to 2009-06-11 (NODC Accession 0104275)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104275 includes physical and underway data collected aboard the KNORR during cruise KN195-09 in the Bering Sea and North Pacific Ocean from...

  5. Physical and underway data collected aboard the KNORR during cruise KN195-12 in the North Pacific Ocean from 2009-07-27 to 2009-08-09 (NODC Accession 0104278)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104278 includes physical and underway data collected aboard the KNORR during cruise KN195-12 in the North Pacific Ocean from 2009-07-27 to...

  6. Mutation of Gly195 of the ChlH Subunit of Mg-chelatase Reduces Chlorophyll and Further Disrupts PS II Assembly in a Ycf48-Deficient Strain of Synechocystis sp. PCC 6803

    Science.gov (United States)

    Crawford, Tim S.; Eaton-Rye, Julian J.; Summerfield, Tina C.

    2016-01-01

    Biogenesis of the photosystems in oxygenic phototrophs requires co-translational insertion of chlorophyll a. The first committed step of chlorophyll a biosynthesis is the insertion of a Mg2+ ion into the tetrapyrrole intermediate protoporphyrin IX, catalyzed by Mg-chelatase. We have identified a Synechocystis sp. PCC 6803 strain with a spontaneous mutation in chlH that results in a Gly195 to Glu substitution in a conserved region of the catalytic subunit of Mg-chelatase. Mutant strains containing the ChlH Gly195 to Glu mutation were generated using a two-step protocol that introduced the chlH gene into a putative neutral site in the chromosome prior to deletion of the native gene. The Gly195 to Glu mutation resulted in strains with decreased chlorophyll a. Deletion of the PS II assembly factor Ycf48 in a strain carrying the ChlH Gly195 to Glu mutation did not grow photoautotrophically. In addition, the ChlH-G195E:ΔYcf48 strain showed impaired PS II activity and decreased assembly of PS II centers in comparison to a ΔYcf48 strain. We suggest decreased chlorophyll in the ChlH-G195E mutant provides a background to screen for the role of assembly factors that are not essential under optimal growth conditions. PMID:27489555

  7. Antiproliferative effects and mechanism of action of ICI 195,739, a novel bis-triazole derivative, on epimastigotes and amastigotes of Trypanosoma (Schizotrypanum) cruzi.

    OpenAIRE

    Urbina, Julia A.; Lazardi, Keyla; Aguirre, Tania; Piras, Marta M.; Piras, Romano

    1991-01-01

    The in vitro antiproliferative effects of ICI 195,739, a recently developed bis-triazole derivative (T. Boyle, D. J. Gilman, M. B. Gravestock, and J. M. Wardleworth, Ann. N.Y. Acad. Sci. 544:86-100, 1988; J. F. Ryley, S. McGregor, and R. G. Wilson, Ann. N.Y. Acad. Sci. 544:310-328, 1988), on epimastigotes and amastigotes of Trypanosoma (Schizotrypanum) cruzi and some aspects of its mechanism of action are described. Despite previous claims that triazole compounds act on susceptible organisms ...

  8. From first-order magneto-elastic to magneto-structural transition in (Mn,Fe)1.95P0.50Si0.50 compounds

    OpenAIRE

    Dung, N.H.; Zhang, L; Ou, Z.Q.; Brück, E

    2012-01-01

    We report on structural, magnetic, and magnetocaloric properties of MnxFe1.95−xP0.50Si0.50 (x ≥ 1.10) compounds. With increasing the Mn:Fe ratio, a first-order magneto-elastic transition gradually changes into a first-order magneto-structural transition via a second-order magnetic transition. The study also shows that thermal hysteresis can be tuned by varying the Mn:Fe ratio. Small thermal hysteresis (less than 1 K) can be obtained while maintaining a giant magnetocaloric effect. This achiev...

  9. Young's Modulus Anisotropy and Magnetomechanical Damping of [110] Oriented Tb0.3Dy0.7Fe1.95 Alloy

    Institute of Scientific and Technical Information of China (English)

    PEI Yong-Mao; FANG Dai-Ning

    2007-01-01

    The AE effect and the magnetoelastic or magnetomechanical damping of vibrations in [110] oriented Tb0.3Dy0.7Fe1.95 alloy are experimentally studied by quasi-static stress-strain measurements under various constant magnetic fields between 0 and 3000 Oe, where stress ranges are taken from about 0 to -25, -50, -75MPa. The linear stress-strain behaviour is obtained when the magnetic field is high enough (9000 Oe). However, the modulus E varies with the angle θ between the compressive stress and magnetic field (9000 Oe), which shows that the anisotropy of the modulus E is related to the magnetic domain distribution.

  10. Structure of Trypanosoma cruzi glycosomal glyceraldehyde-3-phosphate dehydrogenase complexed with chalepin, a natural product inhibitor, at 1.95 A resolution.

    Science.gov (United States)

    Pavão, F; Castilho, M S; Pupo, M T; Dias, R L A; Correa, A G; Fernandes, J B; da Silva, M F G F; Mafezoli, J; Vieira, P C; Oliva, G

    2002-06-01

    The structure of the glycosomal glyceraldehyde-3-phosphate dehydrogenase (gGAPDH) from Trypanosoma cruzi complexed with chalepin, a natural product from Pilocarpus spicatus, has been determined by X-ray crystallography to 1.95 A resolution. The structure is in the apo form without cofactors in the subunits of the tetrameric gGAPDH in the asymmetric unit. Unequivocal density corresponding to the inhibitor was clearly identified in one monomer. The final refined model of the complex shows extensive conformational changes when compared with the native structure. The mode of binding of chalepin to gGAPDH and its implications for inhibitor design are discussed. PMID:12044862

  11. Structural and Functional Organization of the Vestibular Apparatus in Rats Subjected to Weightlessness for 19.5 Days Aboard the Kosmos-782 Satellite

    Science.gov (United States)

    Vinnikov, Y. A.; Gazenko, O. G.; Titova, L. K.; Bronshteyn, A. A.; Govardovskiy, V. I.; Pevzner, R. A.; Gribakin, G. G.; Aronova, M. Z.; Kharkeyevich, T. A.; Tsirulis, T. P.

    1978-01-01

    The vestibular apparatus was investigated in rats subjected to weightlessness for 19.5 days. The vestibular apparatus was removed and its sections were fixed in a glutaraldehyde solution for investigation by light and electron microscopes. Structural and functional charges were noted in the otolith portions of the ear, with the otolith particles clinging to the utricular receptor surface and with the peripheral arrangement of the nucleolus in the nuclei of the receptor cells. It is possible that increased edema of the vestibular tissue resulted in the destruction of some receptor cells and in changes in the form and structure of the otolith. In the horizontal crista, the capula was separated.

  12. Tumor Necrosis Factor-α Induces RelA Degradation via Ubiquitination at Lysine 195 to Prevent Excessive Nuclear Factor-κB Activation*

    OpenAIRE

    Fan, Yihui; Mao, Renfang; Zhao, Yanling; Yu, Yang; Sun, WenJing; Song, Ping; Shi, Zhongcheng; Zhang, Dekai; Yvon, Eric; Zhang, Hong; Fu, Songbin; Yang, Jianhua

    2009-01-01

    Ubiquitination-mediated degradation of the RelA subunit of nuclear factor-κB (NF-κB) is critical for the termination of NF-κB activation. However, the precise mechanism for the ubiquitination of RelA is still not fully understood. Here we report that tumor necrosis factor-α (TNFα) induces RelA polyubiquitination at the lysine 195 residue, and this ubiquitination event is critical for the degradation of RelA and termination of TNFα-mediated NF-κB activation. Overexpression of a RelA mutant wit...

  13. Microstructural investigations and coercivity variation in Tb0.3Dy0.7Fe1.95 under different processing conditions

    International Nuclear Information System (INIS)

    The anisotropy compensated Tb0.3Dy0.7Fe1.95 alloy was investigated in as-cast, directionally solidified, melt-spun and ball milled to nano size scale with an emphasis on coercivity development in all forms. For structural elucidation, scanning electron microscopy and transmission electron microscopy were employed. Large increase in coercivity has been observed for the alloy in ball milled condition, accompanied with low magnetization value. The microstructural investigations indicate that the finer grain size and the strain associated with large defect density concentration seems to be the reason for coercivity enhancement in the nano-sized powder. (author)

  14. 195例牙科患者焦虑症现状及影响因素调查研究%Studies on the status and influence factors in the 195 cases of patients with dental anxiety

    Institute of Scientific and Technical Information of China (English)

    朱丹丹; 邵永新

    2015-01-01

    目的:本论文旨在调查牙科患者焦虑症(DA )现状及影响因素,找出减轻牙科焦虑症的方法。方法采用便利抽样方法选取辽宁省朝阳市中心医院口腔科患者195例,通过基本资料、改良的牙科焦虑量表(MDAS)、状态焦虑量表(S‐AI)和两个自制的量表进行调查。结果牙科焦虑组中女性的比例高于非焦虑组(60% vs .40%,P=0.008)。多因素Logistic回归分析发现:担心医技(OR=2.247),口内喷水(OR=2.151),影响正常功能(OR=2.589),听负面经历(OR=2.825),缺乏口腔知识(OR=2.539),害怕疼痛(OR=2.074)是DA的独立危险因素;掌握口腔知识(OR=0.374),听音乐(OR=0.279),打麻药(OR=0.305),多用鼓励语言(OR=0.460)是缓解DA的独立保护因素。结论担心医技、口内喷水、影响正常功能、听负面经历、缺乏了解口腔知识、害怕疼痛都是引起DA的常见原因,学习口腔知识、听音乐、打麻药、医护人员多用鼓励的语言是有效缓解牙科焦虑症的方法。%Objective The aim of the study was to find out the status and influencing factors of dental anxiety and reduce it . Methods One hundred and ninety‐five patients in Chaoyang Central Hospital were selected via stomatology convenience sampling . Basic information ,modified dental anxiety scale(MDAS) ,State Anxiety Inventory(S‐AI) ,and two homemade scales were used to in‐vestigated .Results No difference in general baseline data was found in two groups of anxiety and non‐anxious ,except the propor‐tion of women in the group of dental anxiety was higher than non‐anxious group(60% vs .40% ,P=0 .008) .Logistic regression a‐nalysis showed that fear of bad medical technology(OR=2 .247);spray to mouth(OR=2 .151);affect normal chewing function(OR=2 .589);listen to the negative experiences(OR=2 .825);lack of knowledge of oral

  15. Magnetic-field-dependent microstructure evolution and magnetic properties of Tb0.27Dy0.73Fe1.95 alloy during solidification

    International Nuclear Information System (INIS)

    We report on the influence of magnetic field strength on the alloy Tb0.27Dy0.73Fe1.95 during slow-cooling solidification. We examined the effect of magnetic field strength on microstructure, magnetization, and magnetostrictive properties of this giant magnetostrictive alloy. We found that after field-treated solidification, the microstructure of specimens had a distinct grain arrangement and displayed magnetic anisotropy. The crystal orientation changed from random in the field-free treatment to aligned along the 〈110〉 direction in flux densities of 1 and 2.2 T, and along the easy magnetization axis 〈111〉 at a flux density of 4.4 T. In consequence, the magnetostrictive coefficient of the samples under various stresses improved with increasing magnetic flux density. Both the d33 and k33 values and the energy transformation efficiency of the field-treated specimens showed strong enhancements. - Highlights: • We investigate effect of magnetic field on microstructure and properties of Tb0.27Dy0.73Fe1.95. • The alloy shows grain arrangement and magnetic anisotropy in high magnetic fields. • The crystal orientation shows a transformation of random-- with increasing B. • The magnetostrictive coefficient at 10MP improves with increasing B. • The d33 and k33 values suggest the “jump” effect with magnetic fields

  16. Measured dependence of some effective cross sections on thermal neutron temperatures in the range -195 degrees C to 20 degrees C

    International Nuclear Information System (INIS)

    The variation of effective cross section in Maxwellian neutron distributions with temperatures in the range -195 degrees C to 20 degrees C have been measured for Usup(233), Usup(235), and Pusup(239) fission, and for Usup(238), Thsup(232), Cusup(63), Insup(115), Lusup(176), and Ausup(197) capture. Foil activation methods were used. Mnsup(55), which has known 1/v dependence, was used as the reference. The results, with some from previous measurements covering temperatures from 20 degrees C to 300 degrees C, are compared with suitable integrations of ENDF/B-V data. Except for Lusup(176) and Ausup(197) the results agree within the estimated uncertainties with the ENDF/B-V data

  17. Experimental determination of the atmospheric dispersion at the Karlsruhe Nuclear Research Center for 160 m and 195 m emission heights. Pt. 1

    International Nuclear Information System (INIS)

    Diffusion experiments have been carried out at the Karlsruhe Nuclear Research Center in order to investigate the atmospheric diffusion of pollutants and to determine specifically the influence on atmospheric diffusion of topographic conditions specific to the site. For this purpose, halogenated hydrocarbons are emitted at 160 m and 195 m height, their local concentration distribution is measured at ground level downwind of the source. Part 1 of the report describes the diffusion experiments performed and presents the detailed data of measurements. These include the coordinates of the sampling positions, the measured concentrations and the relevant meteorological data recorded during the experiments. The stability classes prevailing during the experiments are derived from these data and are indicated. (orig.)

  18. Production of slow protons in the inclusive reactions p(π+) + n → psub(slow) + x at 195 GeV/c

    International Nuclear Information System (INIS)

    The inclusive reactions pn → psub(s) + x and π+n → psub(s) + x at incident momentum of 195 GeV/c have been studied in an exposure of the Fermilab 30 inch deuterium filled bubble chamber to a mixed (π+, p) beam. Analysing the t and M2 dependence of the data within the framework of triple-Regge models it is concluded that pion exchange yields a dominating contribution. Comparing the data with the pp results it is concluded that isoscalar Regge exchange, ω, is much larger than isovector, rho, Regge exchange. Significant leading π- emission is observed from the recoiling mass x, comparable to that observed in on-mass-shell π-p→π- experiments. This verifies the conclusions about pion-exchange dominance in the above reactions. (Auth.)

  19. InGaAs/AlInGaAs THz Quantum Cascade Lasers operating up to 195 K in strong magnetic field

    CERN Document Server

    Valmorra, Federico; Ohtani, Keita; Beck, Mattias; Faist, Jerome

    2014-01-01

    Terahertz quantum cascade lasers based on InGaAs wells and quaternary AlInGaAs barriers were measured in magnetic field. This study was carried out on a four quantum well active region design with photon energy of 14.3 meV processed both with Au and Cu waveguides. The heterostructure operates up to 148 K at B=0 T and in a Cu waveguide. The complete magneto-spectroscopic study allowed the comparison of emission and transport data. Increasing the magnetic field, the low effective mass of the InGaAs wells allowed us to reach the very strong confinement regime and at B=12 T, where the cyclotron transition is almost resonant with the LO-phonon, we recorded a maximum operating temperature of 195 K for the devices with Cu waveguide. Additional lasing at 5.9 meV was detected for a delimited range of the parameters space.

  20. Effect of sintering temperature on structural and electrical properties of gadolinium doped ceria (Ce0.9Gd0.1O1.95)

    Indian Academy of Sciences (India)

    L D Jadhav; S H Pawar; M G Chourashiya

    2007-04-01

    Gadolinium doped ceria oxide is one of the promising materials as an electrolyte for IT–SOFCs. Ce0.9Gd0.1O1.95 (GDC10) powder was prepared by solid state reaction and sintered at 1473 K, 1573 K, 1673 K and 1773 K. All samples were studied using X-ray diffraction, scanning electron micrograph and d.c. conductivity measurement. The crystallinity and surface morphology of the samples improved with sintering temperature. Further, the electrical conductivity measurement indicated that the conduction mechanism is mainly ionic. The conductivity of samples sintered at 1673 K and 1773 K at 800°C are of the order of 0.1 S-cm-1. The activation energies decreased from 1.25–0.82 eV with increase in sintering temperature.

  1. Physical studies on the binding of cis-dichlorodiamine platinum(II) to DNA and homopolynucleotides. [UV radiation, /sup 195/Pt tracer techniques

    Energy Technology Data Exchange (ETDEWEB)

    Munchausen, L.L.; Rahn, R.O.

    1975-01-01

    The amount of cis-dichlorodiamine platinum(II) bound to DNAs of varying (dA + dT) content was assayed by both ultraviolet absorbance spectrophotometry and the use of the radioisotope /sup 195/Pt. Radioisotope labeling indicates twice as much bound platinum as do optical measurements. The molar ratio of bound platinum r at saturation is approximately half the sum of the nearest-neighbor frequencies of all base-pairs that do not contain thymine. We therefore conclude that platinum does not bind to thymine in DNA. Chomatographic studies with (/sup 14/C) purine-labeled DNA indicate preferential binding of platinum to guanine, followed by binding to adenine. The luminescence properties of DNA and of homopolynucleotides are strongly affected by bound platinum as a result of a heavy-atom effect. A plot of the fluorescence-to-phosphorescence ratio as a function of r gives a saturation bind curve similar to that obtained using /sup 195/Pt. Ultraviolet irradiation of DNA treated with the platinum compound results in a 30 percent increase in the rate of formation of thymine homocyclobutadipyrimidine. When acetophenone sensitization is employed, platinum binding enhances cytosine homocyclobutadipyrimidine formation 10-fold, presumably because the triplet level of cytosine complexed with platinum is lowered below that of acetophenone. The viscosity of DNA decreases sharply upon binding platinum, with half the change occurring when less than 6 percent of the bases are complexed. From the rate of reaction with formaldehyde, we conclude that binding of the platinum compound to DNA induced small denatured regions that unwind in the presence of formaldehyde with a rate about 40 times slower than that of a single-strand chain break.

  2. Spatially Resolved Electronic Alterations As Seen by in Situ 195Pt and 13CO NMR in Ru@Pt and Au@Pt Core-Shell Nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Atienza, Dianne O.; Allison, Thomas C.; Tong, Yu ye J.

    2012-12-20

    Pt-based core-shell (M@Pt where M stands for core element) nanoparticles (NPs) have recently been under increasing scrutiny in the fields of fuel cell and lithium air battery electrocatalysis due to their promising prospects in optimizing catalytic activity, reducing Pt loading and consequently lowering its cost. To achieve the latter, delineating spatially resolved local (surface) elemental distribution and associated variations in electronic properties under working condition (i.e., in situ) is arguably a prerequisite of fundamental importance in investigating electrocatalysis but unfortunately is still sorely missing. In this regard, in situ 195Pt electrochemical NMR (EC-NMR) of Pt-based NPs is unique in terms of accessing such information, particularly the spatially resolved partition between the sand d-like Fermi level local density of states (Ef-LDOS) modified by the core elements. In this paper, we report a comparative in situ 195Pt EC-NMR investigation of Ru@Pt vs Au@Pt NPs which was complemented by in situ 13C EC-NMR of the 13CO adsorbed on the respective NPs generated via dissociation of methanol and by ab initio DFT calculations. The obtained results showed opposing electronic effect between Ru vs Au cores: the former reduced substantially the s-like but not the d-like Ef-LDOS of the Pt shell while the latter did the opposite. According to recent quantum calculations, a reduction in d-like partition would weaken the Pt-O bond while a reduction in s-like partition would weaken the Pt-H bond, which is largely in agreement with experimental observations.

  3. Characterization of Ni19.5Ti50.5Pd25Pt5 High-Temperature Shape Memory Alloy Springs and their Potential Application in Aeronautics

    Science.gov (United States)

    Stebner, Aaron; Padula, Santo A.; Noebe, Ronald D.

    2008-01-01

    Shape memory alloys (SMAs) have been used as actuators in many different industries since the discovery of the shape memory effect, but the use of SMAs as actuation devices in aeronautics has been limited due to the temperature constraints of commercially available materials. Consequently, work is being done at NASA's Glenn Research Center to develop new SMAs capable of being used in high temperature environments. One of the more promising high-temperature shape memory alloys (HTSMAs) is Ni19.5Ti50.5Pd25Pt5. Recent work has shown that this material is capable of being used in operating environments of up to 250 C. This material has been shown to have very useful actuation capabilities, demonstrating repeatable strain recoveries up to 2.5% in the presence of an externally applied load. Based on these findings, further work has been initiated to explore potential applications and alternative forms of this alloy, such as springs. Thus, characterization of Ni19.5Ti50.5Pd25Pt5 springs, including their mechanical response and how variations in this response correlate to changes in geometric parameters, are discussed. The effects of loading history, or training, on spring behavior were also investigated. A comparison of the springs with wire actuators is made and the benefits of using one actuator form as opposed to the other discussed. These findings are used to discuss design considerations for a surge-control mechanism that could be used in the centrifugal compressor of a T-700 helicopter engine.

  4. Epidemiological analysis of orthognathic surgery in a hospital in Curitiba, Brazil: Review of 195 cases Análisis epidemiológico de la cirugía ortognática en un hospital de Curitiba, Brasil: Revisión de 195 casos

    OpenAIRE

    Rafaela Scariot; Delson João da Costa; Nelson Luis Barbosa Rebellato; Paulo Roberto Müller; Roberto da Conceição Ferreira

    2010-01-01

    Objective: The present retrospective study explored the spectrum and characteristics of patients treated with orthognathic surgery at the Universidade Federal do Paraná, Brazil. Materials and method: Over a six-year period from July 2002 to July 2008, the records of 195 patients with dentofacial deformities who underwent orthognathic surgical procedures were followed up. Results: Mean patient age was 25.87 years (range 14 to 65 years) and the female to male ratio was 1.5:1. The predominant ra...

  5. Densification and grain growth kinetics of Ce0.9Gd0.1O1.95 in tape cast layers: The influence of porosity

    DEFF Research Database (Denmark)

    Ni, De Wei; Esposito, Vincenzo; Foghmoes, Søren Preben Vagn;

    2014-01-01

    The sintering behavior of Ce0.9Gd0.1O1.95(CGO) tape cast layers with different porosity was investigated by an extensive characterization of densification, microstructural evolution, and applying the constitutive laws of sintering. The densification of CGO tapes associates with grain coarsening p...

  6. Densification and grain growth during sintering of porous Ce0.9Gd0.1O1.95tape cast layers: A comprehensive study on heuristic methods

    DEFF Research Database (Denmark)

    Ni, De Wei; Schmidt, Cristine Grings; Teocoli, Francesca;

    2013-01-01

    The sintering behavior of porous Ce0.9Gd0.1O1.95(CGO10) tape cast layers was systematically investigated to establish fundamental kinetic parameters associated to densification and grain growth. Densification and grain growth were characterized by a set of different methods to determine the domin...

  7. Physical and underway data collected aboard the KNORR during cruise KN195-11 in the Bering Sea from 2009-06-14 to 2009-07-23 (NODC Accession 0104277)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104277 includes physical and underway data collected aboard the KNORR during cruise KN195-11 in the Bering Sea from 2009-06-14 to 2009-07-23. These...

  8. Effect of cooling rate on magnetostriction gradients of Tb0.27Dy0.73Fe1.95 alloys solidified in high magnetic field gradients

    Science.gov (United States)

    Liu, Tie; Gao, Peng-Fei; Dong, Meng; Xiao, Yu-Bao; Wang, Qiang

    2016-05-01

    In this work, Tb0.27Dy0.73Fe1.95 alloys were solidified in a high magnetic field gradient (8.8 T, -565 T2/m) at various cooling rates. Changes in the magnetostriction, crystal orientation, and magnetization of the alloys were investigated. The application of the magnetic field gradient has a strong influence on the magnetostrictive performance. At lower cooling rates, the maximum magnetostriction increases gradually with depth from the top surface of the alloys. However, the effect of the magnetic field gradient is strongly dependent on the cooling rate. With increasing cooling rate, the magnetostriction gradient decreases. The magnetization measurement shows that the saturation magnetization at lower cooling rates increases gradually with depth from the top surface of the alloys. However, with increasing cooling rate, the increase in the saturation magnetization is reduced. The XRD measurement results show that the orientation behavior of the (Tb, Dy)Fe2 phase exhibits a continuous change throughout the alloys at lower cooling rates, but is almost unchanged at higher cooling rates. The change in the magnetostriction of the alloys can be attributed to the changes in crystal orientation and the amount of the (Tb, Dy)Fe2 phase in the alloys caused by both the magnetic field gradient and cooling rate.

  9. Microhardness and fracture toughness of Ce0.9Gd0.1O1.95 for manufacturing solid oxide electrolytes

    International Nuclear Information System (INIS)

    Synthesis of nanocrystalline gadolinium doped ceria (Ce0.9Gd0.1O1.95) was attempted by nitrate-fuel combustion technique involving different organic fuels namely urea, citric acid, glycine and poly ethylene glycol. As-combusted ceria precursors were calcined at 700 deg. C for 2 h for obtaining fully dense, nanocrystalline ceria powders. Cylindrical ceria discs were fabricated by uni-axial pressing and sintered intentionally at low temperature of 1200 deg. C for 2 h for assessing the sintering characteristics of the nano powders as well as the mechanical performance of the sintered ceria body. The study confirms that the nano powders could be sintered to 98% theoretical sintered density at 1200 deg. C with a grain size of 400 nm to 1 μm. The sintered samples exhibited the Vickers microhardness of 8.82 ± 0.2 GPa and the fracture toughness of 1.75 ± 0.3 MPa m1/2 at a load 20 N for glycine and citric acid fuels derived ceria, respectively. A comparison between the fuels was made with respect to the sintering and mechanical properties of doped ceria. Citric acid and glycine fuels resulted in sintered ceria with high hardness where as the urea and polyethylene fuels derived nano ceria resulted in high fracture toughness.

  10. Probing the solvent shell with 195Pt chemical shifts: density functional theory molecular dynamics study of Pt(II) and Pt(IV) anionic complexes in aqueous solution.

    Science.gov (United States)

    Truflandier, Lionel A; Autschbach, Jochen

    2010-03-17

    Ab initio molecular dynamics (aiMD) simulations based on density functional theory (DFT) were performed on a set of five anionic platinum complexes in aqueous solution. (195)Pt nuclear magnetic shielding constants were computed with DFT as averages over the aiMD trajectories, using the two-component relativistic zeroth-order regular approximation (ZORA) in order to treat relativistic effects on the Pt shielding tensors. The chemical shifts obtained from the aiMD averages are in good agreement with experimental data. For Pt(II) and Pt(IV) halide complexes we found an intermediate solvent shell interacting with the complexes that causes pronounced solvent effects on the Pt chemical shifts. For these complexes, the magnitude of solvent effects on the Pt shielding constant can be correlated with the surface charge density. For square-planar Pt complexes the aiMD simulations also clearly demonstrate the influence of closely coordinated non-equatorial water molecules on the Pt chemical shift, relating the structure of the solution around the complex to the solvent effects on the metal NMR chemical shift. For the complex [Pt(CN)(4)](2-), the solvent effects on the Pt shielding constant are surprisingly small. PMID:20166712

  11. Effects of gestational exposure to 1.95-GHz W-CDMA signals for IMT-2000 cellular phones: Lack of embryotoxicity and teratogenicity in rats.

    Science.gov (United States)

    Ogawa, Kumiko; Nabae, Kyoko; Wang, Jianqing; Wake, Kanako; Watanabe, So-ichi; Kawabe, Mayumi; Fujiwara, Osamu; Takahashi, Satoru; Ichihara, Toshio; Tamano, Seiko; Shirai, Tomoyuki

    2009-04-01

    The present study was designed to evaluate whether gestational exposure to an EMF targeting the head region, similar to that from cellular phones, might affect embryogenesis in rats. A 1.95-GHz wide-band code division multiple access (W-CDMA) signal, which is one applied for the International Mobile Telecommunication 2000 (IMT-2000) system and used for the freedom of mobile multimedia access (FOMA), was employed for exposure to the heads of four groups of pregnant CD(SD) IGS rats (20 per group) for gestational days 7-17. The exposure was performed for 90 min/day in the morning. The spatial average specific absorption rate (SAR) for individual brains was designed to be 0.67 and 2.0 W/kg with peak brain SARs of 3.1 and 7.0 W/kg for low (group 3) and high (group 4) exposures, respectively, and a whole-body average SAR less than 0.4 W/kg so as not to cause thermal effects due to temperature elevation. Control and sham exposure groups were also included. At gestational day 20, all dams were killed and fetuses were taken out by cesarean section. There were no differences in maternal body weight gain. No adverse effects of EMF exposure were observed on any reproductive and embryotoxic parameters such as number of live (243-271 fetuses), dead or resorbed embryos, placental weights, sex ratios, weights or external, visceral or skeletal abnormalities of live fetuses. PMID:19194858

  12. RILEM technical committee 195-DTD recommendation for test methods for AD and TD of early age concrete Round Robin documentation report : program, test results and statistical evaluation

    CERN Document Server

    Bjøntegaard, Øyvind; Krauss, Matias; Budelmann, Harald

    2015-01-01

    This report presents the Round-Robin (RR) program and test results including a statistical evaluation of the RILEM TC195-DTD committee named “Recommendation for test methods for autogenous deformation (AD) and thermal dilation (TD) of early age concrete”. The task of the committee was to investigate the linear test set-up for AD and TD measurements (Dilation Rigs) in the period from setting to the end of the hardening phase some weeks after. These are the stress-inducing deformations in a hardening concrete structure subjected to restraint conditions. The main task was to carry out an RR program on testing of AD of one concrete at 20 °C isothermal conditions in Dilation Rigs. The concrete part materials were distributed to 10 laboratories (Canada, Denmark, France, Germany, Japan, The Netherlands, Norway, Sweden and USA), and in total 30 tests on AD were carried out. Some supporting tests were also performed, as well as a smaller RR on cement paste. The committee has worked out a test procedure recommenda...

  13. A Retrospective Analysis of 5,195 Patient Treatment Sessions in an Integrative Veterinary Medicine Service: Patient Characteristics, Presenting Complaints, and Therapeutic Interventions

    Science.gov (United States)

    Memon, Mushtaq A.

    2015-01-01

    Integrative veterinary medicine, the combination of complementary and alternative therapies with conventional care, is increasingly prevalent in veterinary practice and a focus of clinical instruction in many academic teaching institutions. However, the presenting complaints, therapeutic modalities, and patient population in an integrative medicine service have not been described. A retrospective analysis of 5,195 integrative patient treatment sessions in a veterinary academic teaching hospital demonstrated that patients most commonly received a combination of therapeutic modalities (39% of all treatment sessions). The 274 patients receiving multiple modalities were most frequently treated for neurologic and orthopedic disease (50.7% versus 49.6% of all presenting complaints, resp.). Older neutered or spayed dogs (mean age = 9.0 years) and Dachshunds were treated more often than expected based on general population statistics. Acupuncture, laser therapy, electroacupuncture, and hydrotherapy were frequently administered (>50% patients). Neurologic patients were more likely to receive acupuncture, electroacupuncture, and therapeutic exercises but less likely than orthopedic patients to receive laser, hydrotherapy, or therapeutic ultrasound treatments (P < 0.05). The results suggest that the application of these specific modalities to orthopedic and neurologic diseases should be subjected to increased evidence-based investigations. A review of current knowledge in core areas is presented. PMID:26798552

  14. 天津市195例3~7岁儿童神经发育评估结果分析%Analysis on the evaluation results of neurodevelopment of 195 children aged 3-7-years old in Tianjin

    Institute of Scientific and Technical Information of China (English)

    吕丛超; 席薇; 苏媛媛; 张欣

    2012-01-01

    目的:分析天津市195例3~7岁儿童的神经发育评估结果,验证格里菲斯神经发育评估量表在天津地区的适用性.方法:在天津市内3个区中选择两所公立的幼儿园和一所普通小学,采用随机抽样的方法,对195例体格检查为正常的3~7岁儿童,在征得家长知情同意后,由具有资格认证的人员采用格里菲斯神经发育评估量表进行测评.结果:量表6个领域项目的整体难度在0.66~0.78之间,随儿童生理年龄的增加,测试项目的难度逐渐降低.相关性分析显示儿童6个领域发育年龄与生理年龄之间均呈正相关(P =0.000),整体发育年龄与生理年龄之间的相关系数为0.922.3~7岁儿童总发育商平均为(110±11)分.结论:在天津地区应用格里菲斯神经发育评估量表,能够对儿童神经发育的成熟程度进行客观地评估,重新修订我国儿童的标准是必要的.%Objective: To analyze the evaluation results of neurodevelopment of 195 children aged 3-7 - years old in Tianjin, and verify the feasibility of Griffiths mental development scale in Tianjin. Methods: Two public kindergartens and a general primary school were selected from three districts of Tianjin city, random sampling method was sued to selected 195 children aged 3—7 years old with normal results of physical examination , then Griffiths mental development scale was used for assessment. Results: The total difficulties of six subscales were within 0. 66 — 0. 78 , which decreased gradually with age of children. Correlation analysis showed that there was a positive correlation between developmental ages of six suhscales and physiological age ( P = 0. 000) , the coefficient of correlation was 0. 922. The total developmental quotient of 3 — 7 — year — old children was (110±11) on average. Conclusion: Griffiths mental development scale used in Tianjin city can evaluate the mature degree of neurodevelopment of children objectively, and its

  15. Process for producing astatine-211 for radiopharmaceutical use

    International Nuclear Information System (INIS)

    A one-step chemical manipulation is described in combination with a distillation and collection process for producing At-211 comprising; a. providing a target of irradiated Bismuth coated to a predetermined thickness of a backing member, b. providing a vapor-producing still operably connected with a condenser that has a water cooled condensate collector formed of a dry silica gel mesh maintained at a temperature above the freezing point of water, and providing an effluent gas filter that is operably connected to receive effluent gas from the condenser, c. heating the target in the still at a temperature in the range of about 6300-6800C for a time period in the range of 50 to 80 minutes, to evole At-211 vapor from the target, c. providing a dry carrier gas having an oxygen concentration that is sufficient to form Bi/sub 2/O/sub 3/ thereby to essentially preclude vaporization of Bi metal, passing the carrier gas through the still to carry the At-211 vapor to the condenser, and to carry effluent from the condenser to the effluent gas filter, e. eluting At-211 from the condensate collector of the condenser with a controlled volume of eluent containing predetermined solvents that are compatible with a given desired radiopharmaceutical procedure, and f. collecting the At-211 in the controlled volume of eluent for use in the given radiopharmaceutical procedure

  16. Influence of a platinum functional layer on a Ni-Ce0.9Gd0.1O1.95 anode for thin-film solid oxide fuel cells

    International Nuclear Information System (INIS)

    A Pt functional layer was deposited between a Ni-Ce0.9Gd0.1O1.95 (50 wt. % Ni) anode and an 8 mol. % yttria-stabilized zirconia electrolyte in order to enhance the performance of a thin film solid oxide fuel cell. By inserting this ultrathin functional layer, the ohmic impedance of the single cell was significantly reduced, and the maximum power density was increased by a factor of ∼1.55. However, excessive deposition of the Pt functional layer caused ionic conduction pathway blocking between the yttria-stabilized zirconia and Ni-Gd0.1Ce0.9O1.95 (Ni-GDC), deactivating the Ni-GDC as a mixed ionic and electronic conducting anode. As a result, both the ohmic impedance and anodic faradaic impedance were increased after introduction of excessive Pt functional layer, and the maximum power density was also reduced

  17. CHEMICAL AND PHYSICAL CONDITIONS IN MOLECULAR CLOUD CORE DC 000.4–19.5 (SL42) IN CORONA AUSTRALIS

    International Nuclear Information System (INIS)

    Chemical reactions in starless molecular clouds are heavily dependent on interactions between gas phase material and solid phase dust and ices. We have observed the abundance and distribution of molecular gases in the cold, starless core DC 000.4–19.5 (SL42) in Corona Australis using data from the Swedish ESO Submillimeter Telescope. We present column density maps determined from measurements of C18O (J = 2-1, 1-0) and N2H+ (J = 1-0) emission features. Herschel data of the same region allow a direct comparison to the dust component of the cloud core and provide evidence for gas phase depletion of CO at the highest extinctions. The dust color temperature in the core calculated from Herschel maps ranges from roughly 10.7 to 14.0 K. This range agrees with the previous determinations from Infrared Space Observatory and Planck observations. The column density profile of the core can be fitted with a Plummer-like density distribution approaching n(r) ∼ r –2 at large distances. The core structure deviates clearly from a critical Bonnor-Ebert sphere. Instead, the core appears to be gravitationally bound and to lack thermal and turbulent support against the pressure of the surrounding low-density material: it may therefore be in the process of slow contraction. We test two chemical models and find that a steady-state depletion model agrees with the observed C18O column density profile and the observed N(C18O) versus AV relationship.

  18. Classification of neck/shoulder pain in epidemiological research: a comparison of personal and occupational characteristics, disability, and prognosis among 12,195 workers from 18 countries.

    Science.gov (United States)

    Sarquis, Leila M M; Coggon, David; Ntani, Georgia; Walker-Bone, Karen; Palmer, Keith T; Felli, Vanda E; Harari, Raul; Barrero, Lope H; Felknor, Sarah A; Gimeno, David; Cattrell, Anna; Vargas-Prada, Sergio; Bonzini, Matteo; Solidaki, Eleni; Merisalu, Eda; Habib, Rima R; Sadeghian, Farideh; Kadir, M Masood; Warnakulasuriya, Sudath S P; Matsudaira, Ko; Nyantumbu, Busisiwe; Sim, Malcolm R; Harcombe, Helen; Cox, Ken; Marziale, Maria H; Harari, Florencia; Freire, Rocio; Harari, Natalia; Monroy, Magda V; Quintana, Leonardo A; Rojas, Marianela; Harris, E Clare; Serra, Consol; Martinez, J Miguel; Delclos, George; Benavides, Fernando G; Carugno, Michele; Ferrario, Marco M; Pesatori, Angela C; Chatzi, Leda; Bitsios, Panos; Kogevinas, Manolis; Oha, Kristel; Freimann, Tiina; Sadeghian, Ali; Peiris-John, Roshini J; Sathiakumar, Nalini; Wickremasinghe, A Rajitha; Yoshimura, Noriko; Kelsall, Helen L; Hoe, Victor C W; Urquhart, Donna M; Derrett, Sarah; McBride, David; Herbison, Peter; Gray, Andrew; Salazar Vega, Eduardo J

    2016-05-01

    To inform case definition for neck/shoulder pain in epidemiological research, we compared levels of disability, patterns of association, and prognosis for pain that was limited to the neck or shoulders (LNSP) and more generalised musculoskeletal pain that involved the neck or shoulder(s) (GPNS). Baseline data on musculoskeletal pain, disability, and potential correlates were collected by questionnaire from 12,195 workers in 47 occupational groups (mostly office workers, nurses, and manual workers) in 18 countries (response rate = 70%). Continuing pain after a mean interval of 14 months was ascertained through a follow-up questionnaire in 9150 workers from 45 occupational groups. Associations with personal and occupational factors were assessed by Poisson regression and summarised by prevalence rate ratios (PRRs). The 1-month prevalence of GPNS at baseline was much greater than that of LNSP (35.1% vs 5.6%), and it tended to be more troublesome and disabling. Unlike LNSP, the prevalence of GPNS increased with age. Moreover, it showed significantly stronger associations with somatising tendency (PRR 1.6 vs 1.3) and poor mental health (PRR 1.3 vs 1.1); greater variation between the occupational groups studied (prevalence ranging from 0% to 67.6%) that correlated poorly with the variation in LNSP; and was more persistent at follow-up (72.1% vs 61.7%). Our findings highlight important epidemiological distinctions between subcategories of neck/shoulder pain. In future epidemiological research that bases case definitions on symptoms, it would be useful to distinguish pain that is localised to the neck or shoulder from more generalised pain that happens to involve the neck/shoulder region. PMID:26761390

  19. Hydrogen absorption in Mg1.95Ti0.05Ni0.95Cu0.05 alloy prepared with mechanical alloying and thermal treatment; Absorcion de hidrogeno en la aleacion Mg1.95Ti0.05Ni0.95Cu0.05 preparada por aleado mecanico y tratamiento termico

    Energy Technology Data Exchange (ETDEWEB)

    Martinez, Juan Bonifacio; Urena Nunez, Fernando [Instituto Nacional de Investigaciones Nucleares, Ocoyoacac, Estado de Mexico (Mexico)]. E-mail: juan.bonifacio@inin.gob.mx

    2009-09-15

    This work presents hydrogen absorption in quaternary alloy Mg1.95Ti0.05Ni0.95Cu0.05 obtained by the mechanical alloying method, followed by thermal treatment in ultra-high pure argon atmosphere. The composition of the phases, microstructure and morphology of ground powders and with thermal treatment were characterized by DRX, SEM/EDS and TEM. After 20 hours of mechanical grinding and recooked at 300 degrees Celsius/1h in argon atmosphere, the quaternary alloy has a Mg{sub 2}Ni crystalline hexagonal structure with a crystallite size under 10 nm. The absorption measurements were performed under a pressure of 0.2 to 1.2 MPa at a temperature of 200 degrees Celsius in a micro-reactor. The quantification of absorption-desorption of hydrogen in the intermetallic was conducted in a TGA-DSC simultaneous calorimeter. Metallic hydride-dehydride powder was characterized with SEM and XRD. [Spanish] En este trabajo se presenta la absorcion de hidrogeno en la aleacion cuaternaria Mg1.95Ti0.05Ni0.95Cu0.05 obtenida por el metodo de aleado mecanico, seguida de tratamiento termico en atmosfera de argon de ultra alta pureza. La composicion de las fases, microestructura y morfologia de los polvos molidos y con tratamiento termico fue caracterizada por DRX, SEM/EDS y TEM. Despues de 20 h de molienda mecanica con recocido a 300 grados Celsios/1h en atmosfera de argon, la aleacion cuaternaria tiene una estructura cristalina hexagonal Mg{sub 2}Ni con tamano de cristalito menor a 10 nm. Las mediciones de absorcion fueron realizadas bajo una presion de 0.2 a 1.2 MPa a una temperatura de 200 grados Celsios en un micro-reactor. La cuantificacion de absorcion-desorcion de hidrogeno en el intermetalico se realizo en un calorimetro simultaneo TGA-DSC. Se determino que la cantidad maxima absorbida de hidrogeno en la aleacion cuaternaria fue de 3.24% en peso cuando la presion fue de 0.8 MPa a dicha temperatura. Polvos metalicos hidrurados-deshidrurados se caracterizaron por SEM y XRD.

  20. Identification of aquifer limits inside an Andean Piedmont (between 19,5°S and 20°S - Northern Chile) with TDEM and gauging methods.

    Science.gov (United States)

    Viguier, Benoit; Jourde, Hervé; Leonardi, Véronique; Moya, Claudio; Líra, Elias; Yáñez, Gonzalo; Maringue, José; García-Pérez, Tiaren; Lictevout, Elisabeth

    2016-04-01

    In times of brutal climate changes and water scarcity in arid areas, the management of water resource has become a major issue. In this aim, several studies attempted to quantify the aquifer recharge and hydrodynamic processes. However, the quality of many studies depends on the characterization of aquifer boundaries. In arid areas, the amount of observation points (e.g. wells) and their spatial distribution constrain the understanding of aquifer boundaries spatial variations. In this study, we propose a methodology to characterize both water table level and boundaries of aquifer in such areas where the observation points do not exist. The Andean Piedmont (between 19,5°S and 20°S - Northern Chile) is located in the Pampa del Tamarugal Central Depression and is bounded respectively at the westside and the eastside by the Coastal Cordillera (1100 m a.s.l) and the Precordillera mountain range (4500 m a.s.l). The piedmont and the basin floor are composed of the late-Cenozoic alluvial deposits (hundred meters thick) which contain the Pampa del Tamarugal aquifer. Due to the hyperarid context, this regional aquifer is one of the main strategic groundwater resources in Northern Chile. This aquifer is mainly unconfined and the electrical conductivity of groundwater varies around 3000 μS/cm in the study area. The analysis of resistivity variation with depth, acquired by Time Domain Electromagnetic (TDEM) method in various points inside the piedmont, allow identifying a continuous resistivity contrast (from ≥ 100-40 Ω.m to ≤ 10 Ω.m) that varies over the study area. This continuous resistivity contrast is assumed to be related to the water table of the unconfined aquifer rather than to a lithology contrast. After validation of the observations, a piezometric map was constructed using both the available hydrogeological information and the TDEM results. In the piedmont, river sink were identified; these zones where surface water sinks are correlated with the resistivity

  1. Studies on the percolation limit of Ce0.9Gd0.1O1.95 in La0.6Sr0.4Co0.2Fe0.8O3-δ-Ce0.9Gd0.1O1.95 nanocomposites for solid oxide fuel cells application

    Science.gov (United States)

    Jamale, Atul P.; Jadhav, S. T.; Dubal, S. U.; Bhosale, C. H.; Jadhav, L. D.

    2015-10-01

    A large difference in thermal expansion coefficient of electrode and electrolyte leads to imperfect electrode/electrolyte interface and hence significant polarization losses in solid oxide fuel cells. To overcome the difficulties associated with electrode and electrode/electrolyte interface, there is need to fabricate the composite cathode. Thus the present paper deals with study of La0.6Sr0.4Co0.2Fe0.8O3-δ(LSCF)-Ce0.9Gd0.1O1.95(GDC) nanocomposite with different fractions of GDC obtained by physical mixing of combustion synthesized nanopowders. No secondary phases were observed upon sintering at 1100 °C for 2 h affirming the chemical compatibility between LSCF and GDC. The composites with relatively high GDC% have higher density as a consequence of rapid grain growth and less conductivity. The nanocomposite with 50% of GDC showed electric conductivity of 30 Scm-1 at 500 °C and low area specific resistance of 106 Ω cm2 with 10 μs relaxation time at 200 °C.

  2. (29)Si, (47)Ti, (49)Ti and (195)Pt solid state MAS NMR spectroscopic investigations of ternary silicides TPtSi, germanides TPtGe (T = Ti, Zr, Hf) and stannide TiPtSn.

    Science.gov (United States)

    Benndorf, Christopher; Eckert, Hellmut; Pöttgen, Rainer

    2016-05-10

    Eight ternary tetrelides TPtX (T = Ti, Zr, Hf; X = Si, Ge, Sn) were synthesized from the elements by arc-melting and subsequent annealing. TiPtSi, ZrPtSi, ZrPtGe, HfPtSi and HfPtGe crystallize with the orthorhombic TiNiSi type structure, in the space group Pnma. The structures of HfPtSi (a = 654.44(9), b = 387.97(6), c = 750.0(1) pm, wR2 = 0.0592, 411 F(2) values, 20 variables) and HfPtGe (a = 660.36(7), b = 395.18(4), c = 763.05(8) pm, wR2 = 0.0495, 430 F(2) values, 20 variables) were refined from single crystal X-ray diffractometer data. TiPtSn adopts the cubic MgAgAs type. TiPtGe is dimorphic with a TiNiSi type high-temperature modification which transforms to cubic LT-TiPtGe (MgAgAs type). All phases were investigated by high resolution (29)Si, (47)Ti, (49)Ti and (195)Pt solid state MAS NMR spectroscopy. In the cubic compounds, the (47/49)Ti NMR signals are easily detected owing to the absence of quadrupolar broadening effects. The (195)Pt resonances of the orthorhombic compounds are characterized by strongly negative isotropic Knight shifts and large Knight shift anisotropies, whereas positive isotropic Knight shifts and no anisotropies are observed for the cubic compounds. These results indicate that the phase transition in TiPtGe is associated with dramatic changes in the electronic properties. Within each group of isotypic compounds the isotropic (29)Si, (47/49)Ti and (195)Pt Knight shifts show systematic dependences on the transition metal or tetrel atomic number, suggesting that the numerical values are influenced by the electronegativities of the metallic (or metalloid) neighbours. PMID:27097719

  3. Lack of promoting effects of chronic exposure to 1.95-GHz W-CDMA signals for IMT-2000 cellular system on development of N-ethylnitrosourea-induced central nervous system tumors in F344 rats.

    Science.gov (United States)

    Shirai, Tomoyuki; Ichihara, Toshio; Wake, Kanako; Watanabe, So-ichi; Yamanaka, Yukio; Kawabe, Mayumi; Taki, Masao; Fujiwara, Osamu; Wang, Jianqing; Takahashi, Satoru; Tamano, Seiko

    2007-10-01

    The present study was performed to evaluate effects of a 2-year exposure to an electromagnetic near-field (EMF) equivalent to that generated by cellular phones on tumor development in the central nervous system (CNS) of rats. For this purpose, pregnant F344 rats were given a single administration of N-ethylnitrosourea (ENU) on gestational day 18. A total of 500 pups were divided into five groups, each composed of 50 males and 50 females: Group 1, untreated controls; Group 2, ENU alone; Groups 3 to 5, ENU + EMF (sham exposure and two exposure levels). A 1.95-GHz wide-band code division multiple access (W-CDMA) signal, which is a feature of the International Mobile Telecommunication 2000 (IMT-2000) cellular system was employed for exposure of the rat head starting from 5 weeks of age, 90 min a day, 5 days a week, for 104 weeks. Brain average specific absorption rates (SARs) were designed to be .67 and 2.0 W/kg for low and high exposures, respectively. The incidence and numbers of brain tumors in female rats exposed to 1.95-GHz W-CDMA signals showed tendencies to increase but without statistical significance. Overall, no significant increase in incidences or numbers, either in the males or females, was detected in the EMF-exposed groups. In addition, no clear changes in tumor types in the brain were evident. Thus, under the present experimental conditions, exposure of heads of rats to 1.95-GHz W-CDMA signals for IMT-2000 for a 2-year period was not demonstrated to accelerate or otherwise affect ENU-initiated brain tumorigenesis. PMID:17516507

  4. Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.

    Science.gov (United States)

    Kong, Leopold; Torrents de la Peña, Alba; Deller, Marc C; Garces, Fernando; Sliepen, Kwinten; Hua, Yuanzi; Stanfield, Robyn L; Sanders, Rogier W; Wilson, Ian A

    2015-10-01

    The HIV-1 envelope gp160 glycoprotein (Env) is a trimer of gp120 and gp41 heterodimers that mediates cell entry and is the primary target of the humoral immune response. Broadly neutralizing antibodies (bNAbs) to HIV-1 have revealed multiple epitopes or sites of vulnerability, but mapping of most of these sites is incomplete owing to a paucity of structural information on the full epitope in the context of the Env trimer. Here, a crystal structure of the soluble BG505 SOSIP gp140 trimer at 4.6 Å resolution with the bNAbs 8ANC195 and PGT128 reveals additional interactions in comparison to previous antibody-gp120 structures. For 8ANC195, in addition to previously documented interactions with gp120, a substantial interface with gp41 is now elucidated that includes extensive interactions with the N637 glycan. Surprisingly, removal of the N637 glycan did not impact 8ANC195 affinity, suggesting that the antibody has evolved to accommodate this glycan without loss of binding energy. PGT128 indirectly affects the N262 glycan by a domino effect, in which PGT128 binds to the N301 glycan, which in turn interacts with and repositions the N262 glycan, thereby illustrating the important role of neighboring glycans on epitope conformation and stability. Comparisons with other Env trimer and gp120 structures support an induced conformation for glycan N262, suggesting that the glycan shield is allosterically modified upon PGT128 binding. These complete epitopes of two broadly neutralizing antibodies on the Env trimer can now be exploited for HIV-1 vaccine design. PMID:26457433

  5. Influence of sintering methods on microstructure and ionic conductivity of La1.95Sr0.05Zr2O6.975 synthesized by co-precipitation

    OpenAIRE

    Huo, Da; Gosset, Dominique; Siméone, David; Baldinozzi, Gianguido; Khodja, Hicham; Villeroy, Benjamin; Surblé, Suzy

    2015-01-01

    We present here the synthesis of Sr-doped lanthanumzirconate pyrochlores La1.95Sr0.05Zr2O6.975with controlled grain sizes and we compare different methods of sintering. Pyrochlores are systems where it is hard to achieve high density without a significant coarsening of the sample microstructure. It is shown that the use of Spark Plasma Sintering (SPS) can produce high density ceramic samples while maintaining a nanometric grain size, a key factor for enhancing electrical and mechanical proper...

  6. Epidemiological analysis of orthognathic surgery in a hospital in Curitiba, Brazil: Review of 195 cases Análisis epidemiológico de la cirugía ortognática en un hospital de Curitiba, Brasil: Revisión de 195 casos

    Directory of Open Access Journals (Sweden)

    Rafaela Scariot

    2010-12-01

    Full Text Available Objective: The present retrospective study explored the spectrum and characteristics of patients treated with orthognathic surgery at the Universidade Federal do Paraná, Brazil. Materials and method: Over a six-year period from July 2002 to July 2008, the records of 195 patients with dentofacial deformities who underwent orthognathic surgical procedures were followed up. Results: Mean patient age was 25.87 years (range 14 to 65 years and the female to male ratio was 1.5:1. The predominant racial group was "white". Most patients belonged to the economically productive population. Sixty-two patients had complete dentition. Only 3.59% patients had local anesthesia (rapid palatal expansion. Transverse maxillary deficiency was the most common deformity, followed by maxillary anteroposterior deficiency associated with mandibular anteroposterior excess. Mandibular set-back was the intervention most frequently performed. The surgical procedures took an average of 3 hours 51 minutes and orthodontic treatments took an average of 44.48 months. Complications occurred in 22.57% of patients, the most common of which were permanent paresthesia of the lower lip (7.17% and inadequate fracture reduction (5.12%. Conclusions: The findings included concepts that were useful for characterizing the profile of patients who undergo orthognathic surgery in southern Brazil. The results also may help to correctly develop protocols for patient care designed to improve the overall results of the procedures.Objetivo: Este estudio retrospectivo explora el espectro y las características de los pacientes tratados con cirugía ortognática en la Universidade Federal do Paraná. Material y método: A lo largo de 6 años, a partir de julio de 2002 hasta julio de 2008, se efectuó el seguimiento de 195 pacientes con deformidades dentofaciales que se sometieron a procedimientos de cirugía ortognática. Resultados: La edad media de los pacientes fue de 25,87 años (de 14 a 65 y la

  7. Influence of a platinum functional layer on a Ni-Ce{sub 0.9}Gd{sub 0.1}O{sub 1.95} anode for thin-film solid oxide fuel cells

    Energy Technology Data Exchange (ETDEWEB)

    Kang, Sungmin; Cha, Suk Won, E-mail: ybkim@hanyang.ac.kr, E-mail: swcha@snu.ac.kr [Department of Mechanical and Aerospace Engineering, Seoul National University, Gwanak-ro 1, Gwanak-gu, Seoul 151-744 (Korea, Republic of); Chang, Ikwhang [Graduate School of Convergence Science and Technology, Seoul National University, 864-1, Iui-dong, Yeongtong-gu, Suwon, Gyeonggi-do 443-270 (Korea, Republic of); Kim, Young-Beom, E-mail: ybkim@hanyang.ac.kr, E-mail: swcha@snu.ac.kr [Department of Mechanical Engineering, Hanyang University, 222 Wangshimni-ro, Seongdong-gu, Seoul 133-791 (Korea, Republic of)

    2015-09-15

    A Pt functional layer was deposited between a Ni-Ce{sub 0.9}Gd{sub 0.1}O{sub 1.95} (50 wt. % Ni) anode and an 8 mol. % yttria-stabilized zirconia electrolyte in order to enhance the performance of a thin film solid oxide fuel cell. By inserting this ultrathin functional layer, the ohmic impedance of the single cell was significantly reduced, and the maximum power density was increased by a factor of ∼1.55. However, excessive deposition of the Pt functional layer caused ionic conduction pathway blocking between the yttria-stabilized zirconia and Ni-Gd{sub 0.1}Ce{sub 0.9}O{sub 1.95} (Ni-GDC), deactivating the Ni-GDC as a mixed ionic and electronic conducting anode. As a result, both the ohmic impedance and anodic faradaic impedance were increased after introduction of excessive Pt functional layer, and the maximum power density was also reduced.

  8. 铜-钢-铜三层复合板室温轧制成形工艺及结合机制的研究%The Study of the Compound Technology and Bond Mechanism Copper Alloy/Q195/Copper Alloy Three-ply Cladding Sheet

    Institute of Scientific and Technical Information of China (English)

    于宝义; 安振之; 齐克敏

    2001-01-01

    研究了铜合金-Q195-铜合金三层复合板室温轧制成形工艺,借助金相显微镜、扫描电镜、电子探针分析了复合板的结合机制。%The study was carried out on the compound technology of copper alloy/Q195/copper alloy cladding sheet,with room temperature rolling deformation.The bond mechanism of compound sheet was analysed by using optical,scanning electron microscope,electron probe.

  9. Influence of porosity on densification and grain growth kinetics of Ce0.9Gd0.1O1.95 tape

    DEFF Research Database (Denmark)

    Ni, De Wei; Esposito, Vincenzo; Foghmoes, Søren Preben Vagn;

    determined from master viscosity curves, which are comparable to the kinetic values obtained from densification and grain growth. It is indicated that porosity has negligible effect on densification kinetics, but high porosity decreases the chance of particle contact, and grain boundary mobility is therefore...... is accompanied by the change of shape, size and fraction of pores in a given volume. Therefore, porosity can be treated as an extra phase during sintering study. In this work, we presented the densification and grain growth behaviour of Ce0.9Gd0.1O1.95 tape cast layers with different percentage of...... porosity. The emphasis was put on the effect of porosity on densification and grain growth kinetics. Derived from the sintering constitutive laws, the densification and grain growth kinetics were experimentally characterized and analyzed. Furthermore, the activation energies for viscous flow were...

  10. Original Research: Generation of non-deletional hereditary persistence of fetal hemoglobin β-globin locus yeast artificial chromosome transgenic mouse models: -175 Black HPFH and -195 Brazilian HPFH.

    Science.gov (United States)

    Braghini, Carolina A; Costa, Flavia C; Fedosyuk, Halyna; Neades, Renee Y; Novikova, Lesya V; Parker, Matthew P; Winefield, Robert D; Peterson, Kenneth R

    2016-04-01

    Fetal hemoglobin is a major genetic modifier of the phenotypic heterogeneity in patients with sickle cell disease and certain β-thalassemias. Normal levels of fetal hemoglobin postnatally are approximately 1% of total hemoglobin. Patients who have hereditary persistence of fetal hemoglobin, characterized by elevated synthesis of γ-globin in adulthood, show reduced disease pathophysiology. Hereditary persistence of fetal hemoglobin is caused by β-globin locus deletions (deletional hereditary persistence of fetal hemoglobin) or γ-globin gene promoter point mutations (non-deletional hereditary persistence of fetal hemoglobin). Current research has focused on elucidating the pathways involved in the maintenance/reactivation of γ-globin in adult life. To better understand these pathways, we generated new β-globin locus yeast artificial chromosome transgenic mice bearing the (A)γ-globin -175 T > C or -195 C > G hereditary persistence of fetal hemoglobin mutations to model naturally occurring hereditary persistence of fetal hemoglobin. Adult -175 and -195 mutant β-YAC mice displayed a hereditary persistence of fetal hemoglobin phenotype, as measured at the mRNA and protein levels. The molecular basis for these phenotypes was examined by chromatin immunoprecipitation of transcription factor/co-factor binding, including YY1, PAX1, TAL1, LMO2, and LDB1. In -175 HPFH versus wild-type samples, the occupancy of LMO2, TAL1 and LDB1 proteins was enriched in HPFH mice (5.8-fold, 5.2-fold and 2.7-fold, respectively), a result that concurs with a recent study in cell lines showing that these proteins form a complex with GATA-1 to mediate long-range interactions between the locus control region and the (A)γ-globin gene. Both hereditary persistence of fetal hemoglobin mutations result in a gain of (A)γ-globin activation, in contrast to other hereditary persistence of fetal hemoglobin mutations that result in a loss of repression. The mice provide additional tools to

  11. Generation of non-deletional hereditary persistence of fetal hemoglobin β-globin locus yeast artificial chromosome transgenic mouse models: −175 Black HPFH and −195 Brazilian HPFH

    Science.gov (United States)

    Braghini, Carolina A; Costa, Flavia C; Fedosyuk, Halyna; Neades, Renee Y; Novikova, Lesya V; Parker, Matthew P; Winefield, Robert D; Peterson, Kenneth R

    2016-01-01

    Fetal hemoglobin is a major genetic modifier of the phenotypic heterogeneity in patients with sickle cell disease and certain β-thalassemias. Normal levels of fetal hemoglobin postnatally are approximately 1% of total hemoglobin. Patients who have hereditary persistence of fetal hemoglobin, characterized by elevated synthesis of γ-globin in adulthood, show reduced disease pathophysiology. Hereditary persistence of fetal hemoglobin is caused by β-globin locus deletions (deletional hereditary persistence of fetal hemoglobin) or γ-globin gene promoter point mutations (non-deletional hereditary persistence of fetal hemoglobin). Current research has focused on elucidating the pathways involved in the maintenance/reactivation of γ-globin in adult life. To better understand these pathways, we generated new β-globin locus yeast artificial chromosome transgenic mice bearing the Aγ-globin −175 T >C or −195 C >G hereditary persistence of fetal hemoglobin mutations to model naturally occurring hereditary persistence of fetal hemoglobin. Adult −175 and −195 mutant β-YAC mice displayed a hereditary persistence of fetal hemoglobin phenotype, as measured at the mRNA and protein levels. The molecular basis for these phenotypes was examined by chromatin immunoprecipitation of transcription factor/co-factor binding, including YY1, PAX1, TAL1, LMO2, and LDB1. In −175 HPFH versus wild-type samples, the occupancy of LMO2, TAL1 and LDB1 proteins was enriched in HPFH mice (5.8-fold, 5.2-fold and 2.7-fold, respectively), a result that concurs with a recent study in cell lines showing that these proteins form a complex with GATA-1 to mediate long-range interactions between the locus control region and the Aγ-globin gene. Both hereditary persistence of fetal hemoglobin mutations result in a gain of Aγ-globin activation, in contrast to other hereditary persistence of fetal hemoglobin mutations that result in a loss of repression. The mice provide additional tools to study

  12. Effect of Zirconium Precursor on Performance of Pd/Ce0.45Zr0.45La0.1O1.95 Three-Way Catalyst%不同锆源对Pd/Ce0.45Zr0.45La0.1O1.95整体式三效催化剂性能的影响

    Institute of Scientific and Technical Information of China (English)

    陈山虎; 姚艳玲; 兰丽; 曹毅; 闫朝阳; 龚茂初; 陈耀强

    2012-01-01

    10.1016/S1872-2067(11)60445-2%  分别以ZrOCO3, ZrO(NO3)2和Zr(NO3)4为锆源采用双氧水氧化-共沉淀法合成了Ce0.45Zr0.45La0.1O1.95储氧材料,并用湿法浸渍法制备了Pd/Ce0.45Zr0.45La0.1O1.95三效催化剂,用X射线衍射、拉曼光谱、N2吸附、X射线光电子能谱、氢气程序升温还原和氧脉冲等技术对该催化剂进行了表征.结果表明,以 ZrOCO3和 ZrO(NO3)2为锆源时所制催化剂上只能检测到单一的CeO2-ZrO2立方相,而以Zr(NO3)4为锆源制备的催化剂经老化后却能检测到四方相;另外,在模拟汽车尾气组分和工作条件下考察了整体型Pd/Ce0.45Zr0.45La0.1O1.9催化剂的三效活性.结果表明,以ZrOCO3为前驱体制备的整体式Pd/Ce0.45Zr0.45La0.1O1.9催化剂对C3H8, CO和NO具有最佳的催化活性.认为ZrOCO3更有利于Zr4+和La3+进入CeO2晶格形成均一固溶体,从而提高催化剂的高温稳定性和氧化还原性能.

  13. Photocatalytic degradation of an azo textile dye (C.I. Reactive Red 195 (3BF)) in aqueous solution over copper cobaltite nanocomposite coated on glass by Doctor Blade method

    Science.gov (United States)

    Habibi, Mohammad Hossein; Rezvani, Zoya

    2015-08-01

    The degradation of C.I. Reactive Red 195 (3BF) in aqueous solution using copper cobaltite nanocomposite coated on glass by Doctor Blade method was studied. Structural, optical and morphological properties of nanocomposite coatings were characterized by X-ray powder diffractometry (XRD), diffuse reflectance spectroscopy (DRS) and field emission scanning electron microscopy (FESEM). The nanoparticles exhibit a particle size of 31 nm, showing a good nanoscale crystalline morphology. The photocatalytic activity of copper cobaltite nanocomposite coated on glass was studied by performing the photocatalytic degradation of 3BF at different irradiation time. The effect of irradiation time on the degradation of 3BF was studied and the results showed that more than 85% of the 3BF was degraded in 45 min of irradiation. The pseudo-first-order kinetic models were used and the rate constants were evaluated with pseudo first order rate constants of 4.10 × 10-2 min-1. The main advantage of the photocatalyst coated on glass overcomes the difficulties in separation and recycle of photocatalyst suspensions.

  14. Synthesis and properties of Mn1.05−yCo1.95−x−z−wNixMgyAlzFewO4 NTC ceramic by co-precipitation method

    International Nuclear Information System (INIS)

    Mn1.05−yCo1.95−x−z−wNixMgyAlzFewO4 negative temperature coefficient (NTC) material was synthesized by double precipitation reacting method. The synthesis condition was optimized. Fourier infrared (FI) spectrometer indicated that the precursor was consisted of oxalate and hydroxide. The powder was studied by X–ray diffraction (XRD) to obtain the optimum calcination temperature of 800 °C. The ceramics were mainly in the cubic spinel structure except for the minority of cubic cobalt oxide. Scanning electron microscope (SEM) image showed that the grain size decreased with the increase of Al2O3 content in the ceramic. While the room temperature resistivity ρ25 increased from 3027 Ω cm to 16,911 Ω cm with increasing Al2O3 content. The material constants B25/85 and activity energies were in the range of 3592–3977 K and 0.3112–0.3330 eV, respectively. Complex impedance analysis indicated that the grain boundary resistivity increased with increasing Al2O3 content, whereas, the grain resistance remains virtually unchanged. - Highlights: • Powder with composition near to starting component was synthesized by precipitation. • The grain size of the ceramic decreased with increasing Al2O3 content. • Only the grain boundary resistivity increased with Al2O3 concentration

  15. Dielectric, elastic, anelastic and conductivity behaviour of ferroelectromagnetic composites, Ni0.5Zn0.5Fe1.95O4– + Ba0.8Pb0.2TiO3

    Indian Academy of Sciences (India)

    N Ramamanohar Reddy; M Venkata Ramana; K Krishnaveni; K V Siva Kumar; V R K Murthy

    2007-08-01

    Ferroelectromagnetic composites with compositions, Ni0.5Zn0.5Fe1.95O4– + (1 – ) Ba0.8Pb0.2TiO3, in which varies as 0, 0.005, 0.010, 0.015, 0.020, 0.040, 0.060, 0.080 and 1 in mole %, were prepared by conventional ceramic double sintering process. The presence of two phases was confirmed by X-ray diffraction. The temperature variation of dielectric constant, ', dielectric loss, tan , d.c. conductivity, a.c. conductivity, elastic and anelastic behaviour of ferrite–ferroelectric composites were studied in the temperature range 30–350°C. The a.c. conductivity measurements on these composites in the frequency range 100 Hz–1 MHz at room temperature reveal that the conduction mechanism is due to small polaron hopping. The dielectric and elastic data were discussed in the light of phase transitions.

  16. High Temperature Electrical Relaxation Study of La0.6Sr0.4Co0.2Fe0.8O3–δ-Ce0.9Gd0.1O1.95 Composite

    Directory of Open Access Journals (Sweden)

    WANG Yan-Dong 1,2, LV Zhe 2, WEI Bo 2

    2010-07-01

    Full Text Available High temperature electrical conductivity of perovskite-type mixed with ionic-electronic conductor La0.6Sr0.4Co0.2Fe0.8O3–δ (LSCF and La0.6Sr0.4Co0.2Fe0.8O3–δ- Ce0.9Gd0.1O1.95(LSCF-GDC composite material were studied by the DC four-terminal technique. The activation energies of pure LSCF and LSCF-GDC composite for small polaron conduction were Ea1=9.72kJ/mol and Ea2=10.64kJ/mol, respectively. Through electrical conductivity relaxation method, i.e. a continuously resistance measurement during the sudden change oxygen under partial pressure and the surface exchange property of the two samples were also investigated. In the temperature range from 600 to 800 degrees and the oxygen partial pressure range from 21kPa to 34kPa, the oxygen surface exchange coefficients (kchem were determined as 2.87×10-6-6.91×10-6cm/s. It is the catalysis effects of GDC on oxygen surface exchange process and the microstructure effect of introducing GDC that promoted the oxygen transport process of composite materials jointly. Based on the relationship of kchem and temperature, the activation energies for surface exchange process was also estimated.

  17. Characterization of Ni{sub 5}3.5-Fe{sub 1}9.5-Ga{sub 2}7 Ni{sub 5}3.5 ferromagnetic shape memory alloy produced by powder metallurgy; Caracterizacion de la aleacion Ni{sub 5}3.5-Fe{sub 1}9.5-Ga{sub 2}7 con memoria de forma ferromagnetica producida por metalurgia de polvos

    Energy Technology Data Exchange (ETDEWEB)

    Olmos, L.; Alvarado-Hernandez, F.; Omar Jimenez, H.; Vergara-Hernandez, J.; Arroyo Albiter, M.; Ochoa-Gamboa, R. A.

    2015-07-01

    The main drawback of ferromagnetic shape memory alloys fabricated through casting methods are its brittleness. In order to overcome this disadvantage, powder metallurgy is an ideal technique for the consolidation of many engineering parts. This paper is focused on the study of the milling and sintering effects of metallic powders over the evolution of the crystalline phases responsibly for the shape memory effect of these materials. To achieve this objective, ferromagnetic shape memory alloy powders (Ni{sub 5}3.5-Fe{sub 1}9.5-Ga{sub 2}7) were prepared from a cast ingot by mechanical milling at two different times of 30 and 60 minutes. The evolution of the phases was investigated through high temperature X-ray diffraction (HTXRD), whereas sintering was analyzed with dilatometry tests. X-ray studies showed that four different phases can be present depending on the particle size and temperature at which the heat treatment was performed. Coarser powders showed a B2 structure along with a γ phase while the finer showed a L21 structure when treated below 1173 K. Furthermore, finer powders had a modulated M14 martensitic structure after sintering at temperatures above 1273 K. The sintering of powders was slow and a mass diffusion mechanism was not clearly observed. (Author)

  18. Electrochemical performance and stability of nano-particulate and bi-continuous La1-XSrXCoO3 and Ce0.9Gd0.1O1.95 composite electrodes

    DEFF Research Database (Denmark)

    Hjalmarsson, Per; Hallinder, Jonathan; Mogensen, Mogens Bjerg

    2012-01-01

    A bi-continuous porous cathode consisting of nano-particles of strontium substituted lanthanum cobaltite (LSC) covering the surface of a Ce0.9Gd0.1O1.95 (CGO10) backbone has been produced. The polarization resistance (R (P)) of this cathode was measured to similar to 35 m Omega cm(2) at 650 A deg...... electrolyte. The results imply that a CGO10 barrier is required for this type of nano-structured cathode....

  19. Sintering and grain growth kinetics in La0.85Sr0.15MnO3–Ce0.9Gd0.1O1.95 (LSM–CGO) porous composite

    DEFF Research Database (Denmark)

    Ni, De Wei; Andersen, Kjeld Bøhm; Esposito, Vincenzo

    2014-01-01

    The sintering kinetics in La0.85Sr0.15MnO3–Ce0.9Gd0.1O1.95 (LSM–CGO) porous composite was studied by applying a two-stage master sintering curve (MSC) approach and comparing with LSM and CGO single-phase materials. In the two-stage MSC, sintering mechanisms occurring at different stages were...

  20. Caracterización de la aleación Ni53.5-Fe19.5-Ga27 con memoria de forma ferromagnética producida por metalurgia de polvos

    Directory of Open Access Journals (Sweden)

    Olmos, Luis

    2015-06-01

    Full Text Available The main drawback of ferromagnetic shape memory alloys fabricated through casting methods are its brittleness. In order to overcome this disadvantage, powder metallurgy is an ideal technique for the consolidation of many engineering parts. This paper is focused on the study of the milling and sintering effects of metallic powders over the evolution of the crystalline phases responsibly for the shape memory effect of these materials. To achieve this objective, ferromagnetic shape memory alloy powders (Ni53.5-Fe19.5-Ga27 were prepared from a cast ingot by mechanical milling at two different times of 30 and 60 minutes. The evolution of the phases was investigated through high temperature X-ray diffraction (HTXRD, whereas sintering was analyzed with dilatometry tests. X-ray studies showed that four different phases can be present depending on the particle size and temperature at which the heat treatment was performed. Coarser powders showed a B2 structure along with a γ phase while the finer showed a L21 structure when treated below 1173 K. Furthermore, finer powders had a modulated M14 martensitic structure after sintering at temperatures above 1273 K. The sintering of powders was slow and a mass diffusion mechanism was not clearly observed.La principal desventaja de las aleaciones con memoria de forma ferromagnéticas obtenidas por fundición es su fragilidad. Para superar esta desventaja la metalurgia de polvos es una técnica ideal para la consolidación de las piezas, por lo que este trabajo se orientó a estudiar el efecto generado por los procesos de molienda y sinterizado de polvos sobre la evolución de las fases cristalinas que le confieren la memoria de forma a estos materiales. Para ello se prepararon polvos de la aleación ferromagnética con memoria de forma Ni53.5-Fe19.5-Ga27 a partir de un lingote fundido mediante molienda mecánica, durante dos tiempos diferentes de molienda de 30 y 60 minutos. La evolución de las fases fue

  1. BDML Metadata: 195 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available 94-b85a-4272-87e4-e2204b65ef58 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data/...source/Ce_KK_P002/RNAi_T08A11.2_040907_02.zip http://ssbd.qbic.riken.jp/data/bdml.../Ce_KK_P002/RNAi_T08A11.2_040907_02.bdml0.18.xml http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK_P002.pdpml0.06.x...ml http://ssbd.qbic.riken.jp/search/e9861694-b85a-4272-87e4-e2204b65ef58/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-98 ...

  2. 49 CFR 195.2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... and controls the safety-related operations of a pipeline facility via a SCADA system from a control... yield strength. Supervisory Control and Data Acquisition (SCADA) system means a computer-based system or... pipeline system or (b) receive and store hazardous liquid transported by a pipeline for reinjection...

  3. 21 CFR 558.195 - Decoquinate.

    Science.gov (United States)

    2010-04-01

    ... (including veal calf), sheep, and goat feeds as in paragraphs (e)(2) and (e)(3) of this section. (3) Type C....9 to 90.8 Cattle (including ruminating and nonruminating calves and veal calves): For prevention of... this product in preruminating calves. Do not use in calves to be processed for veal. Do not feed...

  4. 7 CFR 800.195 - Delegations.

    Science.gov (United States)

    2010-01-01

    ... shall employ official personnel on the basis of job qualifications rather than political affiliations... any substantial change in a licensee's duties. (3) Rotation of personnel. Where feasible,...

  5. QTL Information Table: 195 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available antitative Trait Loci for Component Physiological Traits Determining Salt Tolerance in Rice. Plant Physiology 125, 406-422. http://www.plantphysiol.org/cgi/content/abstract/125/1/406 ...

  6. Development of lead free magnetoelectric laminates of Na{sub 0.5}Bi{sub 0.5}TiO{sub 3}–Tb{sub 0.3}Dy{sub 0.7}Fe{sub 1.95} for power generation

    Energy Technology Data Exchange (ETDEWEB)

    Prabahar, K. [Advanced Magnetics Group, Defence Metallurgical Research Laboratory, Hyderabad (India); Mirunalini, Josephine [Department of Physics, Thiagaraja College of Engineering, Madurai, Tamil Nadu (India); Sowmya, N. Shara; Chelvane, J. Arout [Advanced Magnetics Group, Defence Metallurgical Research Laboratory, Hyderabad (India); Mahendiran, M. [Department of Physics, Thiagaraja College of Engineering, Madurai, Tamil Nadu (India); Kamat, S.V. [Advanced Magnetics Group, Defence Metallurgical Research Laboratory, Hyderabad (India); Srinivas, A., E-mail: adirajs@dmrl.drdo.in [Advanced Magnetics Group, Defence Metallurgical Research Laboratory, Hyderabad (India)

    2014-09-01

    Lead free magnetoelectric laminates has been prepared by sandwiching Sodium Bismuth Titanate (Na{sub 0.5}Bi{sub 0.5}TiO{sub 3}) between two Tb{sub 0.3}Dy{sub 0.7}Fe{sub 1.95} (TDF) by epoxy bonding. The piezoelectric material Sodium Bismuth Titanate (Na{sub 0.5}Bi{sub 0.5}TiO{sub 3}) has been prepared by conventional solid state double sintering method and the magnetostrictive material, Tb{sub 0.3}Dy{sub 0.7}Fe{sub 1.95} (TDF) by vacuum induction melting process. NBT showed a saturated ferroelectric hysteresis behavior with the values of P{sub s}=22.24 μC/cm{sup 2}, E{sub c}=41 kV/cm and P{sub r}=27 μC/cm{sup 2}. The piezoelectric charge coefficient (d{sub 33}) measured for NBT was 102 pC/N. Magnetization versus magnetic field measurements were performed in longitudinal (L) and transverse (T) modes of TDF specimen that showed ferromagnetic hysteresis behavior. The magnetostriction of 950 ppm at 4 kOe and static strain coefficient of 0.37×10{sup −6} kOe{sup −1} at 1 kOe magnetic field were recorded for Tb{sub 0.3}Dy{sub 0.7}Fe{sub 1.95}. The magnetoelectric output was measured in L and T modes for the different NBT thickness of 1.0, 1.5 and 2 mm with TDF thickness of 1.5 mm. The high magnetoelectric coefficient (α) was found to be 0.08 mV/cm Oe (L mode) and 0.13 mV/cm Oe (T mode) for the NBT/TDF laminates with 1.0 mm thick NBT.

  7. Evaluation of a Wet Chemistry Method for Isolation of Cyclotron Produced [211At]Astatine

    Directory of Open Access Journals (Sweden)

    Shigeki Watanabe

    2013-09-01

    Full Text Available A “wet chemistry” approach for isolation of 211At from an irradiated bismuth target is described. The approach involves five steps: (1 dissolution of bismuth target in conc. HNO3; (2 removal of the HNO3 by distillation; (3 dissolution of residue in 8 M HCl; (4 extraction of 211At from 8 M HCl into DIPE; and (5 extraction of 211At from DIPE into NaOH. Results from 55 “optimized” 211At isolation runs gave recovery yields of approximately 78% after decay and attenuation corrections. An attenuation-corrected average of 26 ± 3 mCi in the target provided isolated (actual yields of 16 ± 3 mCi of 211At. A sixth step, used for purification of 211At from trace metals, was evaluated in seven runs. In those runs, isolated 211At was distilled under reductive conditions to provide an average 71 ± 8% recovery. RadioHPLC analyses of the isolated 211At solutions, both initial and after distillation, were obtained to examine the 211At species present. The primary species of 211At present was astatide, but astatate and unidentified species were also observed. Studies to determine the effect of bismuth attenuation on 211At were conducted to estimate an attenuation factor (~1.33 for adjustment of 211At readings in the bismuth target.

  8. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  9. Astatination of nanoparticles containing silver as possible carriers of 211At

    Czech Academy of Sciences Publication Activity Database

    Lebeda, Ondřej; Kučka, Jan; Hrubý, Martin; Koňák, Čestmír; Kozempel, Ján

    2006-01-01

    Roč. 64, - (2006), s. 201-206. ISSN 0969-8043 R&D Projects: GA AV ČR KJB4048302; GA AV ČR KJB4050408 Institutional research plan: CEZ:AV0Z1048901 Keywords : nanoparticles * 211AT * Atalpha particle therapy Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.924, year: 2006

  10. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  11. 11B and 195Pt NMR studies in the Normal State of substituted borocarbide superconductors Y0.98Er0.02Ni2B2C and LaPt1.5Au0.6B2C

    International Nuclear Information System (INIS)

    We report, 11B NMR studies on Y0.98Er0.02Ni2B2C and 11B and 195Pt NMR studies on LaPt1.5Au0.6B2C superconductors. The variation of (1/T1T) with temperature in the normal state of Y0.98Er0.02Ni2B2C shows a similar behaviour as in YNi2B2C. However, its magnitude is one order more than that observed in YNi2B2C. This suggests that T1 is dominated by the thermal fluctuations of Er local moments in this case. From 11B and 195Pt NMR in LaPt1.5Au0.6B2C, we demonstrate that the Pt 5d band is full and the compound exhibits Korringa behaviour as expected for a normal Fermi-liquid. This is in contrast to YNi2B2C where an enhancement of the 11B (1/T1T) is observed at low temperatures along with a deviation from Korringa behaviour, suggesting that the enhancement seen in YNi2B2C could be due to the antiferromagnetic fluctuations from nickel 3d-electrons. (orig.)

  12. Removal of NOx with Porous Cell Stacks with La0.85Sr0.15CoxMn1-xO3+δ-Ce0.9Gd0.1O1.95 Electrodes Infiltrated with BaO

    DEFF Research Database (Denmark)

    Werchmeister, Rebecka Maria Larsen; Bentzen, Janet Jonna; Andersen, Kjeld Bøhm; Kammer Hansen, Kent

    2014-01-01

    Porous cell stacks with composite electrodes of La0.85Sr0.15CoxMn1-xO3-Ce0.9Gd0.1O1.95 were tested for activity toward selective electrochemical reduction of NOx to N2 in the presence of 10% O2. The cell stacks were produced by tape casting, laminating and sintering the backbone structure followed...

  13. La0.99Co0.4Ni0.6O3−δ–Ce0.8Gd0.2O1.95 as composite cathode for solid oxide fuel cells

    DEFF Research Database (Denmark)

    Hjalmarsson, Per; Mogensen, Mogens Bjerg

    2011-01-01

    We have studied a new composite SOFC cathode consisting of LaCo0.4Ni0.6O3−δ (LCN60) and Ce0.9Gd0.1O1.95 (CGO). The polarisation resistance (RP) at 750°C and OCV was measured to 0.05±0.01Ωcm2 and the activation energy was determined to be about 1eV. The impedance spectra were modelled with an EQC...... model consisting of a high frequency ZRQ circuit and a medium frequency Gerischer impedance, ZG. The resistance of ZG was found to decrease with approximately a factor of two as a consequence of infiltration of (La0.6Sr0.4)0.99CoO3 into the porous LCN60–CGO structure. RP of both infiltrated and non...

  14. Magnetoelectric properties of lead-free Ni0.93Co0.02Mn0.05Fe1.95O4–Na0.5Bi0.5TiO3 multiferroic composites synthesized by spark plasma sintering

    International Nuclear Information System (INIS)

    Lead-free multiferroic ceramic composites of x Ni0.93Co0.02Mn0.05Fe1.95O4−(1–x) Na0.5Bi0.5TiO3 (x NCMF−(1–x) NBT, where x=0.1, 0.2, 0.3, 0.4 and 0.5 mol fraction) were synthesized by spark plasma sintering (SPS) in conjunction with high-energy ball milling. The phases, dielectric, piezoelectric, ferroelectric, magnetic and magnetoelectric properties of the composites were analyzed. The composites were composed of a mixture of spinel and perovskite phases. All the composite samples exhibited both apparent ferroelectric and ferromagnetic characteristics as well as considerable magnetoelectric (ME) effects. The maximum value of the ME voltage coefficient of the composites was quite high, being up to ~670 mV cm−1 Oe−1 for the 0.5 NCMF−0.5 NBT composite. Overall, the synthesized composites were promising in terms of electrical, magnetic and magnetoelectric properties, indicating that the SPS is a promising method of fabricating ME composite materials. - Highlights: • Ni0.93Co0.02Mn0.05Fe1.95O4–Na0.5Bi0.5TiO3 composites are synthesized by SPS. • The composites exhibit apparent ferromagnetic and ferroelectric characteristics. • There is quite a high magnetoelectric coefficient for the 0.5 NCMF−0.5 NBT composite. • SPS is a promising method of synthesizing multiferroic ceramic composites

  15. Preparation and electrical properties of Mn{sub 1.05−y}Co{sub 1.95−x−z−w}Ni{sub x}Mg{sub y}Al{sub z}Fe{sub w}O{sub 4} NTC ceramic derived from microemulsion method

    Energy Technology Data Exchange (ETDEWEB)

    Xia, Junbo [Key Laboratory of Functional Materials and Devices under Special Environments, CAS, Xinjiang Key Laboratory of Electronic Information Materials and Devices, Xinjiang Technical Institute of Physics and Chemistry, CAS, Urumqi 830011 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Zhao, Qing, E-mail: zhaoq@ms.xjb.ac.cn [Key Laboratory of Functional Materials and Devices under Special Environments, CAS, Xinjiang Key Laboratory of Electronic Information Materials and Devices, Xinjiang Technical Institute of Physics and Chemistry, CAS, Urumqi 830011 (China); Gao, Bo [Key Laboratory of Functional Materials and Devices under Special Environments, CAS, Xinjiang Key Laboratory of Electronic Information Materials and Devices, Xinjiang Technical Institute of Physics and Chemistry, CAS, Urumqi 830011 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Chang, Aimin, E-mail: changam@ms.xjb.ac.cn [Key Laboratory of Functional Materials and Devices under Special Environments, CAS, Xinjiang Key Laboratory of Electronic Information Materials and Devices, Xinjiang Technical Institute of Physics and Chemistry, CAS, Urumqi 830011 (China); Zhang, Bo; Ma, Renjun [Key Laboratory of Functional Materials and Devices under Special Environments, CAS, Xinjiang Key Laboratory of Electronic Information Materials and Devices, Xinjiang Technical Institute of Physics and Chemistry, CAS, Urumqi 830011 (China); University of Chinese Academy of Sciences, Beijing 100049 (China)

    2014-04-05

    Highlights: • The NTC thermister nano-powders Mn{sub 1.05−y}Co{sub 1.95−x−z−w}Ni{sub x}Mg{sub y}Al{sub z}Fe{sub w}O{sub 4} were prepared by microemulsion method. • The metal ions were subsided after twice sediment reaction. • The specimens show good electrical properties by doping some nontransition metals. -- Abstract: The NTC thermistor nano-powders of Mn{sub 1.05−y}Co{sub 1.95−x−z−w}Ni{sub x}Mg{sub y}Al{sub z}Fe{sub w}O{sub 4} were prepared by microemulsion method. Scanning electron microscope (SEM) image showed that the particles were well distributed. The mean particle-size was 72 nm. The structure of the precursor was investigated with Fourier infrared spectrometer (FI). The compositions of the powder and the as-sintered ceramic were evaluated by Energy Disperse Spectroscopy (EDS). X-ray diffraction (XRD) result indicated that the sintered samples were in the spinel structure. The room temperature resistivity ρ{sub 25}, material constant B{sub 25/85} and activation energies of the NTC thermistor are in the range of 1173–19,059 Ω cm, 3169–3771 k, 0.2672–0.3136 eV. The room temperature resistivity and B{sub 25/85} constant were found to increase with Al{sub 2}O{sub 3} content. The Mn{sub 0.9}Co{sub 1.2}Ni{sub 0.21}Mg{sub 0.15}Al{sub 0.09}Fe{sub 0.45}(A2) and Mn{sub 0.9}Co{sub 1.2}Ni{sub 0.27}Mg{sub 0.15}Al{sub 0.03}Fe{sub 0.45}(A3) specimens both showed a 200 °C resistance drift (ΔR/R) within 10% after aging at 910 °C for 600 h.

  16. Synthesis and properties of Mn{sub 1.05−y}Co{sub 1.95−x−z−w}Ni{sub x}Mg{sub y}Al{sub z}Fe{sub w}O{sub 4} NTC ceramic by co-precipitation method

    Energy Technology Data Exchange (ETDEWEB)

    Xia, Junbo [Key Laboratory of Functional Materials and Devices Under Special Environments, Chinese Academy of Sciences (CAS), Xinjiang Key Laboratory of Electronic Information Materials and Devices, Xinjiang Technical Institute of Physics and Chemistry, CAS, Urumqi 830011 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Zhao, Qing, E-mail: zhaoq@ms.xjb.ac.cn [Key Laboratory of Functional Materials and Devices Under Special Environments, Chinese Academy of Sciences (CAS), Xinjiang Key Laboratory of Electronic Information Materials and Devices, Xinjiang Technical Institute of Physics and Chemistry, CAS, Urumqi 830011 (China); Chang, Aimin, E-mail: changam@ms.xjb.ac.cn [Key Laboratory of Functional Materials and Devices Under Special Environments, Chinese Academy of Sciences (CAS), Xinjiang Key Laboratory of Electronic Information Materials and Devices, Xinjiang Technical Institute of Physics and Chemistry, CAS, Urumqi 830011 (China); Zhang, Bo [Key Laboratory of Functional Materials and Devices Under Special Environments, Chinese Academy of Sciences (CAS), Xinjiang Key Laboratory of Electronic Information Materials and Devices, Xinjiang Technical Institute of Physics and Chemistry, CAS, Urumqi 830011 (China)

    2015-10-15

    Mn{sub 1.05−y}Co{sub 1.95−x−z−w}Ni{sub x}Mg{sub y}Al{sub z}Fe{sub w}O{sub 4} negative temperature coefficient (NTC) material was synthesized by double precipitation reacting method. The synthesis condition was optimized. Fourier infrared (FI) spectrometer indicated that the precursor was consisted of oxalate and hydroxide. The powder was studied by X–ray diffraction (XRD) to obtain the optimum calcination temperature of 800 °C. The ceramics were mainly in the cubic spinel structure except for the minority of cubic cobalt oxide. Scanning electron microscope (SEM) image showed that the grain size decreased with the increase of Al{sub 2}O{sub 3} content in the ceramic. While the room temperature resistivity ρ{sub 25} increased from 3027 Ω cm to 16,911 Ω cm with increasing Al{sub 2}O{sub 3} content. The material constants B{sub 25/85} and activity energies were in the range of 3592–3977 K and 0.3112–0.3330 eV, respectively. Complex impedance analysis indicated that the grain boundary resistivity increased with increasing Al{sub 2}O{sub 3} content, whereas, the grain resistance remains virtually unchanged. - Highlights: • Powder with composition near to starting component was synthesized by precipitation. • The grain size of the ceramic decreased with increasing Al{sub 2}O{sub 3} content. • Only the grain boundary resistivity increased with Al{sub 2}O{sub 3} concentration.

  17. 49 CFR 195.106 - Internal design pressure.

    Science.gov (United States)

    2010-10-01

    ... strength determined by performing all of the tensile tests of API Specification 5L on randomly selected... outside diameter One test for each 200 lengths. 6 5/8 in through 123/4 in (168 mm through 324 mm) nominal outside diameter One test for each 100 lengths. Larger than 123/4 in (324 mm) nominal outside diameter...

  18. 1935 15' Quad #195 Aerial Photo Mosaic Index - AZ

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  19. 21 CFR 133.195 - Swiss and emmentaler cheese.

    Science.gov (United States)

    2010-04-01

    ... enzymes. Rennet and/or other clotting enzymes of animal, plant, or microbial origin. (3) Other optional... animal, plant, or microbial origin, used in curing or flavor development. (iv) Antimycotic agents, the... that: (1) Enzymes of animal, plant, or microbial origin may be declared as “enzymes”; and (2) The...

  20. 49 CFR 195.6 - Unusually Sensitive Areas (USAs).

    Science.gov (United States)

    2010-10-01

    ... orders Sirenia, Pinnipedia, and Cetacea), or primarily inhabits the marine environment (such as the polar bear)” (16 U.S.C. 1362). The order Sirenia includes manatees, the order Pinnipedia includes seals, sea lions, and walruses, and the order Cetacea includes dolphins, porpoises, and whales....

  1. 40 CFR 60.195 - Test methods and procedures.

    Science.gov (United States)

    2010-07-01

    ..., dscm/hr (dscf/hr). Pe=aluminum equivalent for anode production rate, Mg/hr (ton/hr). K=conversion... fluorides concentration (Cs) and volumetric flow rate (Qsd) of the effluent gas. The sampling time and... emission standards in §§ 60.192 and 60.193 as follows: (1) The emission rate (Ep) of total fluorides...

  2. Cottonwoods in British Columbia: Problem analysis. FRDA report No. 195

    Energy Technology Data Exchange (ETDEWEB)

    McLennan, D.S.; Mamias, A.M.

    1992-01-01

    Black cottonwood and balsam poplar are the fastest growing trees in British Columbia and interest in their management has recently been renewed. This report assembled resource data on the amount, quality, distribution, and potential economic importance of cottonwood in B.C.; described the range of management regimes currently used and provided a summary of management options available; described the potential impacts of cottonwood harvest and management on other resources values; and summarized current cottonwood knowledge gaps and management problems and recommended research.

  3. 49 CFR 572.195 - Thorax with arm.

    Science.gov (United States)

    2010-10-01

    ... accelerometers as specified in 49 CFR 572.200(d), and deflection potentiometers for the thorax and shoulder as... environment as specified in 49 CFR 572.200(j). (2) Seat the dummy, outfitted with the torso jacket (180-3450... spine box. (8) The impactor is specified in 49 CFR 572.200(a). (9) The impactor is guided, if needed,...

  4. 21 CFR 58.195 - Retention of records.

    Science.gov (United States)

    2010-04-01

    ... schedule sheet, copies of protocols, and records of quality assurance inspections, as required by § 58.35(c) shall be maintained by the quality assurance unit as an easily accessible system of records for the... and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL...

  5. 24 CFR 990.195 - Calculation of formula income.

    Science.gov (United States)

    2010-04-01

    ... communications with the respective PHAs. (e) Inapplicability of 24 CFR 85.25. Formula income is not subject to the provisions regarding program income in 24 CFR 85.25. ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Calculation of formula income....

  6. Dicty_cDB: SHC195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mes) Frame A: ttatttkakr*rvvitkeetiinaik*ketcrqrrf*nirdnhw*reeggci*s*tilfs cnsssnhggifnleyfllciscrldne*nrlyh...LYVLL--- ---sinyeyldctnrckrsnhfhsrrydscngvtkshsiyds*sqetl*sr*ewsitlgr sy*sles*tnflwfcwylyfimerrfrfnr*ts*s*kd*ss*vshveleerfrket...kpldwfi g*fckls*ikrlgtssig*kefplctl--- ---lh*l*vfglyqsl*kiqsfsfssv*fl*wcyqesfni*fleprdlmkpvrvvhhfg* kllifgel...hhqcn*vkrnmspkkilkh*rqslvkrrrrlylklnhtflm qffkqpwryf*fgifftlhivpvgq*iepiishsliqsfssl*slshfwvqhci*itlpi hvllfww*hwnkslpree...s: (bits) Value N AF163835 |AF163835.1 Dictyostelium discoideum cellulose synthase (dcsA) mRNA, complete cds

  7. 1935 15' Quad #195 Aerial Photo Mosaic Index - NM

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  8. Phase-inversion tape-casting preparation and significant performance enhancement of Ce0.9Gd0.1O1.95- La0.6Sr0.4Co0.2Fe0.8O3-δ dual-phase asymmetric membrane for oxygen separation

    DEFF Research Database (Denmark)

    Huang, Hua; Cheng, Shiyang; Gao, Jianfeng; Chen, Chusheng; Yi, Jianxin

    2014-01-01

    The dual-phase Ce0.9Gd0.1O1.95–La0.6Sr0.4Co0.2Fe0.8O3−δ asymmetric membrane was prepared via a phase-inversion tape-casting method. The membrane consisted of a thicker porous support layer and a thinner dense layer. When the dense side of the membrane was coated with a La0.6Sr0.4CoO3−δ catalytic...... activation layer, the oxygen permeation flux was markedly increased by a factor of 4.1–5.6, reaching 0.45 mL cm−2 min−1 at 900 °C. The flux increase can be attributed to enhanced surface oxygen exhange kinetics....

  9. Chemical compatibility, redox behavior, and electrochemical performance of Nd1−xSrxCoO3−δ cathodes based on Ce1.9Gd0.1O1.95 for intermediate-temperature solid oxide fuel cells

    International Nuclear Information System (INIS)

    Highlights: ► Nd1−xSrxCoO3−δ (x = 0.3, 0.4, 0.5, 0.6, and 0.7) are synthesized by glycine nitrate method and investigated the effect of Sr substitution for Nd. ► Electrical properties of the samples are identified by a four-terminal DC arrangement in air. ► Symmetrical half cells are measured by impedance spectroscopy at 500, 550, 600, 650, and 700 °C in air under an open-circuit condition. ► Electrochemical performances of Nd1−xSrxCoO3−δ cathodes are investigated using an anode supported cell based on GDC electrolyte for application to IT-SOFCs. - Abstract: The effect of Sr substitution for Nd on Nd1−xSrxCoO3−δ (NSC) (x = 0.3, 0.4, 0.5, 0.6, and 0.7) is investigated to evaluate NSC as a cathode material based on Gd0.1Ce0.9O1.95 (GDC) electrolyte for intermediate-temperature solid oxide fuel cells (IT-SOFCs). The NSC powders are prepared by the glycine nitrate method. At a given temperature, the electrical conductivity increases with increasing Sr content up to x = 0.5 and then decreases for x > 0.5. The redox behavior of NSC (x = 0.3, 0.5, and 0.7) cathodes is studied by the coulometric titration at 700 °C. In order to investigate the area specific resistances of NSC–GDC cathodes, symmetrical half cells (cathode/electrolyte/cathode) are measured using impedance spectroscopy at various temperatures in air under open circuit voltage (OCV) condition. The electrochemical performance of NSC–GDC cathodes is measured using an NSC–GDC/GDC/Ni-GDC anode supported cell. The maximum power density of NSC–GDC cathodes increases with increasing strontium content up to x = 0.5 and then decreases at 700 °C. In terms of electrical conductivity and electrochemical performance, Nd1−xSrxCoO3−δ (x = 0.5) is more suitable as a cathode material based on GDC electrolyte in IT-SOFC applications.

  10. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  11. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE,CERN

    OpenAIRE

    Rothe, Sebastian

    2012-01-01

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spec...

  12. Inactivation of human osteosarcoma cells in vitro by {sup 211}At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, R.H. [Univ. of Oslo (Norway)]|[Institute for Cancer Research, Oslo (Norway); Bruland, O.S. [Institute for Cancer Research, Oslo (Norway); Hoff, P.; Alstad, J. [Univ. of Oslo (Norway); Lindmo, T. [Institute for Cancer Research, Oslo (Norway); Rofstad, E.K. [Norwegian Institute of Technology, Trondheim (Norway)

    1994-08-01

    The potential usefulness of {alpha}-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) {sup 211}At-TP-3 of different specific activities, (b) {sup 211}At-labeled bovine serum albumin (BSA), (c) free {sup 211}At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, {sup 211}At-BSA or free {sup 211}At. The D{sub o}`s were lower for free {sup 211}At than for {sup 211}At-BSA. The survival curves for {sup 211}At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to {sup 211}At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to {sup 211}At-TP-3 treatment was the antigen expression. Cell inactivation after {sup 211}At-TP-3 treatment increased substantially with increasing specific activity of the {sup 211}At-TP-3. At high specific activities, the cytotoxic effect of {sup 211}At-TP-3 was significantly higher than that of {sup 211}At-BSA. In conclusion, {sup 211}At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs.

  13. KN195L03: WHOI cruise 195 leg 03 aboard the R/V Knorr from 2009-01-09 - 2009-02-23 (NODC Accession 0081511)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Post-cruise download of raw data from shipboard computer(s) as furnished by the Woods Hole Oceanographic Institution Shipboard Scientific Support Group and archived...

  14. KN195L06: WHOI cruise 195 leg 06 aboard the R/V Knorr from 2009-04-07 - 2009-04-22 (NODC Accession 0081593)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Post-cruise download of raw data from shipboard computer(s) as furnished by the Woods Hole Oceanographic Institution Shipboard Scientific Support Group and archived...

  15. KN195L04: WHOI cruise 195 leg 04 aboard the R/V Knorr from 2009-02-28 - 2009-03-22 (NODC Accession 0081552)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Post-cruise download of raw data from shipboard computer(s) as furnished by the Woods Hole Oceanographic Institution Shipboard Scientific Support Group and archived...

  16. НЕЙРОПРОТЕКТОРНОЕ ДЕЙСТВИЕ НОВОГО ПРОИЗВОДНОГО ГАМК-РГПУ-195 ПРИ ИШЕМИИ ГОЛОВНОГО МОЗГА

    OpenAIRE

    Мазина, Н.; Волотова, Е.; Куркин, Д.

    2013-01-01

    Целью проведённого исследования явилось изучение нейропротекторного действия нового производного ГАМК–соединения под лабораторным шифром РГПУ-195 в различных дозах на модели ишемии головного мозга, вызванной необратимой одномоментной окклюзией общих сонных артерий. Методы: исследование выполнено на крысах самцах. Нарушение мозгового кровообращения моделировалось путём необратимой билатеральной окклюзии общих сонных артерий, за 30 минут до которой вводилось исследуемое соединение – РГПУ-195 в ...

  17. Formulation studies and grout development for fixation of variable phosphate/sulfate waste, Milestone 195

    International Nuclear Information System (INIS)

    The objective of this work was to develop a range of cement-based blended dry solids which, when mixed with variable phosphate/sulfate waste (PSW), produce grouts that are processible in the Rockwell Hanford Operations (RHO) Transportable Grout Facility (TGF). The selected formula(s) will also utilize commerically available materials requiring no custom processing and meet all criteria as identified and quantified by RHO, not only for grouts made with the reference formula, but also for those grouts made with reasonable deviations from the reference formula expected during routine TGF operation. This report presents experimental data for processibility and solid performance as well as graphical representations of the data. Based upon the results of the preliminary study, several grout formulas were found that produced acceptable grouts. One such formula, composed of Type III Portland cement (50 wt%), class F fly ash (28 wt%), Attapulgite-150 clay (14 wt%), and Indian red pottery clay (IRPC) (8 wt%), produced acceptable grouts with several of the waste concentrations studied. When mixed with 100% sulfate waste, this blend produced acceptable grouts at mix ratios of 8, 8.5, and 9 lb/gal. This particular blend also produced acceptable grouts at waste concentrations of 25/75 and 75/25 PSW. 12 refs., 27 figs., 13 tabs

  18. Yeast Interacting Proteins Database: YLR208W, YDL195W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available complex (Sar1p, Sec13p, Sec16p, Sec23p, Sec24p, Sec31p, Sfb2p, and Sfb3p) which is important for the format...clear pore sub-complex and of the COPII complex (Sar1p, Sec13p, Sec16p, Sec23p, Sec24p, Sec31p, Sfb2p, and Sfb3p) which is important

  19. 41 CFR 102-85.195 - Does GSA provide special services?

    Science.gov (United States)

    2010-07-01

    ... Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 85-PRICING POLICY FOR... bill amount. The bill amount for separable special services is either based on a previously agreed upon... special services on a cost-reimbursable basis: (a) In GSA-controlled space, GSA may provide for...

  20. 36 CFR 223.195 - Procedures for identifying and marking unprocessed timber.

    Science.gov (United States)

    2010-07-01

    ... procedures required herein. (f) Waiver of branding requirements. Regional Foresters may waive the branding... individual timber sale basis, all or a portion of the branding requirements pursuant to paragraph (c)(2) of...) Regions 5 and 6. On an individual timber sale basis, the branding requirement pursuant to paragraph...

  1. SLC primer for Russian translation users. [For IBM 360/195

    Energy Technology Data Exchange (ETDEWEB)

    Jordan, S.R.; Brown, A.F.R.; Hutton, F.C.

    1977-08-01

    Since 1964, a generalized language translation system has been used by the Oak Ridge National Laboratory to translate Russian scientific text to English. The translation system, first implemented at Georgetown University around 1960, has been rewritten and improved through the years as computer models changed. Although the translations lack high literary quality, the system by means of its context-sensitive dictionary nevertheless provides inexpensive, fast, and highly useful translations of scientific literature. The translation system uses a linguistically oriented programing language called SLC (Simulated Linguistic Computer), which permits description of the translation process in linguistic terms. This SLC Primer is written as an aid to users of the Russian-to-English translation system; it describes how the SLC-based translation system works and how to improve the dictionary, both by modifying old dictionary entries and by adding new ones. In the translation process, the complete augmented dictionary entries for all the word units in the sentence are analyzed for interaction so that the correct translation in this context may be produced. Numerous examples of dictionary entries and their use are included in the discussion, and an increasingly sophisticated knowledge of the SLC programing language is developed.

  2. 49 CFR 195.428 - Overpressure safety devices and overfill protection systems.

    Science.gov (United States)

    2010-10-01

    ... months, but at least twice each calendar year, inspect and test each pressure limiting device, relief... breakout tanks containing highly volatile liquids, each operator shall test each valve at intervals not... API Standard 2510 after October 2, 2000, must have an overfill protection system installed...

  3. 49 CFR Appendix C to Part 195 - Guidance for Implementation of an Integrity Management Program

    Science.gov (United States)

    2010-10-01

    ... operator can use to determine an integrity assessment schedule; (3) Safety risk indicator tables for leak..., and using the risk indicator tables, an operator can determine the priority for assessing pipeline... year, and the third segment no later than the fifth year. III. Safety risk indicator tables for...

  4. 40 CFR 1065.195 - PM-stabilization environment for in-situ analyzers.

    Science.gov (United States)

    2010-07-01

    ... volume. (b) Maintain the environment free of ambient contaminants, such as dust, aerosols, or semi... affect the balance. (2) Follow the balance manufacturer's specifications. (f) If static electricity... intervals recommended by the neutralizer manufacturer. (2) You may use other neutralizers, such as a...

  5. Measurements of Discrete Symmetries in the Neutral Kaon System with the CPLEAR (PS195) Experiment

    CERN Document Server

    Ruf, Thomas

    2015-01-01

    The antiproton storage ring LEAR offered unique opportunities to study the symmetries which exist between matter and antimatter. At variance with other approaches at this facility, CPLEAR was an experiment devoted to the study of T, CPT and CP symmetries in the neutral kaon system. It measured with high precision the time evolution of initially strangeness-tagged $K^0$ and $\\bar{K}^0$ states to determine the size of violations with respect to these symmetries in the context of a systematic study. In parallel, limits concerning quantum-mechanical predictions (EPR paradox, coherence of the wave function) or the equivalence principle of general relativity have been obtained. This article will first discuss briefly the unique low energy antiproton storage ring LEAR followed by a description of the CPLEAR experiment, including the basic formalism necessary to understand the time evolution of a neutral kaon state and the main results related to measurements of discrete symmetries in the neutral kaon system. An exce...

  6. Healing arts radiation protection act: revised statutes of Ontario, 1980, chapter 195

    International Nuclear Information System (INIS)

    An act published by the Government of Ontario by the Minister of Health to ensure public safety while subjected to the use of x-rays for the irradiation of human beings for therapeutic or diagnostic purposes

  7. SU-E-T-195: Gantry Angle Dependency of MLC Leaf Position Error

    International Nuclear Information System (INIS)

    Purpose: The aim of this study was to investigate the gantry angle dependency of the multileaf collimator (MLC) leaf position error. Methods: An automatic MLC quality assurance system (AutoMLCQA) was developed to evaluate the gantry angle dependency of the MLC leaf position error using an electronic portal imaging device (EPID). To eliminate the EPID position error due to gantry rotation, we designed a reference maker (RM) that could be inserted into the wedge mount. After setting up the EPID, a reference image was taken of the RM using an open field. Next, an EPID-based picket-fence test (PFT) was performed without the RM. These procedures were repeated at every 45° intervals of the gantry angle. A total of eight reference images and PFT image sets were analyzed using in-house software. The average MLC leaf position error was calculated at five pickets (-10, -5, 0, 5, and 10 cm) in accordance with general PFT guidelines using in-house software. This test was carried out for four linear accelerators. Results: The average MLC leaf position errors were within the set criterion of <1 mm (actual errors ranged from -0.7 to 0.8 mm) for all gantry angles, but significant gantry angle dependency was observed in all machines. The error was smaller at a gantry angle of 0° but increased toward the positive direction with gantry angle increments in the clockwise direction. The error reached a maximum value at a gantry angle of 90° and then gradually decreased until 180°. In the counter-clockwise rotation of the gantry, the same pattern of error was observed but the error increased in the negative direction. Conclusion: The AutoMLCQA system was useful to evaluate the MLC leaf position error for various gantry angles without the EPID position error. The Gantry angle dependency should be considered during MLC leaf position error analysis

  8. "... moi korabl?"l K 195-letiju V.I. Dalja / Gennadi Kuznetsov

    Index Scriptorium Estoniae

    Kuznetsov, Gennadi

    1996-01-01

    Vene keeleteadlane Vladimir Dal ja tema suhted Eestiga. Ilmunud ka kogumikus: Kuznetsov, Gennadi. I tolko dushi ihh, kak svetshi : otsherki o russkoi Pribaltike. Tallinn : Tarbeinfo - Russkii Telegraf, 2003, lk. 86-101

  9. 40 CFR 80.195 - What are the gasoline sulfur standards for refiners and importers?

    Science.gov (United States)

    2010-07-01

    ... such joint venture refinery(ies) if the partner's corporate pool average meets the corporate pool... standards for any refinery(ies) owned by the joint venture that are not included in one partner's corporate... standards under § 80.240. (5)(i) Joint ventures, in which two or more parties collectively own and...

  10. 14 CFR Sec. 19-5 - Air transport traffic and capacity elements.

    Science.gov (United States)

    2010-01-01

    ... represent the industry designators described in the Appendix to section 25 of this part. A common private industry source of these industry designator codes is the Official Airline Guides (OAG). OAI will assign... particular operations. The Office of Airline Information (OAI) will assign or confirm codes upon request;...

  11. Pärnumaa areneb KOIT-kavast 195 miljoni krooniga / Silvia Paluoja

    Index Scriptorium Estoniae

    Paluoja, Silvia, 1956-

    2010-01-01

    Kohaliku omavalitsuse investeeringutoetuse kava tõotab Pärnumaalt esitatud ja projektide eelistus- ning reservnimekirja kantud objektide kogumaksumust arvestades tuua maakonda lähiaastatel üle 112 miljoni krooni. Vt. samas: KOIT-kava 2009-2012

  12. SU-E-T-195: Gantry Angle Dependency of MLC Leaf Position Error

    Energy Technology Data Exchange (ETDEWEB)

    Ju, S; Hong, C; Kim, M; Chung, K; Kim, J; Han, Y; Ahn, S; Chung, S; Shin, E; Shin, J; Kim, H; Kim, D; Choi, D [Department of Radiation Oncology, Samsung Medical Center, Sungkyunkwan University School of Medicine, Seoul (Korea, Republic of)

    2014-06-01

    Purpose: The aim of this study was to investigate the gantry angle dependency of the multileaf collimator (MLC) leaf position error. Methods: An automatic MLC quality assurance system (AutoMLCQA) was developed to evaluate the gantry angle dependency of the MLC leaf position error using an electronic portal imaging device (EPID). To eliminate the EPID position error due to gantry rotation, we designed a reference maker (RM) that could be inserted into the wedge mount. After setting up the EPID, a reference image was taken of the RM using an open field. Next, an EPID-based picket-fence test (PFT) was performed without the RM. These procedures were repeated at every 45° intervals of the gantry angle. A total of eight reference images and PFT image sets were analyzed using in-house software. The average MLC leaf position error was calculated at five pickets (-10, -5, 0, 5, and 10 cm) in accordance with general PFT guidelines using in-house software. This test was carried out for four linear accelerators. Results: The average MLC leaf position errors were within the set criterion of <1 mm (actual errors ranged from -0.7 to 0.8 mm) for all gantry angles, but significant gantry angle dependency was observed in all machines. The error was smaller at a gantry angle of 0° but increased toward the positive direction with gantry angle increments in the clockwise direction. The error reached a maximum value at a gantry angle of 90° and then gradually decreased until 180°. In the counter-clockwise rotation of the gantry, the same pattern of error was observed but the error increased in the negative direction. Conclusion: The AutoMLCQA system was useful to evaluate the MLC leaf position error for various gantry angles without the EPID position error. The Gantry angle dependency should be considered during MLC leaf position error analysis.

  13. Small angle neutron scattering analysis programs on the Rutherford Laboratory IBM 360/195 computers

    International Nuclear Information System (INIS)

    The implementation and operation of the suite of programs used for the analysis of small angle neutron scattering data originally written at the ILL (Grenoble) is described. The programs make use of a circulating data file which is also described and may be used by a variety of data analysis programs. (author)

  14. Biologic monitoring of exposure to organophosphorus pesticides in 195 Italian children.

    OpenAIRE

    Aprea, C.; Strambi, M; Novelli, M T; Lunghini, L; Bozzi, N

    2000-01-01

    One hundred ninety-five 6- to 7-year-old children who lived in the municipality of Siena (Tuscany, Italy), underwent biologic monitoring to evaluate urinary excretion of several alkylphosphates that are metabolites of organophosphorus pesticides. We evaluated dimethylphosphate (DMP), dimethylthiophosphate (DMTP), dimethyldithiophosphate (DMDTP), diethylphosphate (DEP), diethylthiophosphate (DETP), and diethyldithiophosphate (DEDTP). We obtained urine samples taken in the children's schools, a...

  15. What is and What is understood by Orobanche foetida Poir., Voy. Barbarie 2: 195[-196] (1789)?

    OpenAIRE

    Carlón Ruiz, Luis; Laínz Gallo, Manuel; Moreno Moral, Gonzalo; Sánchez Pedraja, Oscar

    2015-01-01

    Tras un detenido estudio de su protólogo y lectótipo, se concluye que Orobanche foetida Poir. (1789) es un sinónimo prioritario de Orobanche variegata Wallr. (1825) y no puede usarse para la especie del Mediterráneo occidental a la que en los últimos tiempos venía por lo general aplicándosele. Mientras la conservación en ese uso del binomen Orobanche foetida no sea propuesta y aprobada, esa especie ibérica y norteafricana debe llamarse Orobanche hookeriana Ball.

  16. 27 CFR 28.195b - Claims on spirits tax determined on and after January 1, 1980.

    Science.gov (United States)

    2010-04-01

    ... consist of a copy of each related dump and batch record, package gauge record as prescribed in 27 CFR part 19, and/or bottling and packaging record. The appropriate TTB officer may also require these or...

  17. Mesoporous high surface area Ce0.9Gd0.1O1.95 synthesized by spray drying

    DEFF Research Database (Denmark)

    Lundberg, Mats; Wang, Hsiang-Jen; Blennow Tullmar, Peter;

    2011-01-01

    Mesoporous gadolinium doped cerium dioxide with high surface area was produced by spray drying using Pluronic 123 as surfactant. The powder, when calcined at 400 °C, had a BET surface area of 136 m2 g−1 and was polycrystalline as confirmed by XRD and TEM. XEDS confirmed Ce, Gd and O, as the only......, corresponding to the crystallite size calculated from XRD data. The similar size range of the mesopores and the observed crystallite size indicates that the porosity is partly formed from intergranular mesoporosity. Using the spray drying method of a surfactant assisted liquid precursor solution it can be...

  18. The Effect of Sr Modification and Holding Time on Si Morphology and Mechanical Properties of ETIAL 195 Alloy

    Directory of Open Access Journals (Sweden)

    Muhammet Uludağ

    2015-12-01

    Full Text Available Hypereutectic Al-Si alloys are typically used in applications where wear resistance is required. The primary factor that determines the wear properties is the morphology of Si in these types of alloys. Pouring temperature is one of the ways to control Si size and shape. On the other hand, bifilm defects that may be present in the liquid can significantly alter the morphology of Si acting as a heterogeneous nucleant. Therefore in this work, castings were made at 800 °C with varying holding time and the effects of bifilm on the Si morphology was studied. Bifilm content was measured by Reduced Pressure Test and image analysis was used to characterize Si morphology. In addition, tensile tests were carried out to correlate Si morphology with mechanical properties.

  19. Shelf-Life of ɛ-Lysyl-3-(Trimethylstannyl)Benzamide Immunoconjugates, Precursors for 211At Labeling of Antibodies

    OpenAIRE

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per; Jensen, Holger; Holgersson, Stellan; Lindegren, Sture

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity and the complex radiochemistry of 211At are major obstacles for research and prospective clinical applications. In the present study, astatination of immunoconjugates, already prepared well in advance...

  20. DO PUBLIC POLICIES FOR ENTREPRENEURSHIP MAKE A DIFFERENCE? PROSPECTIVE SCENARIOS FOR CANADA, IRELAND, AND ITALY DOI:10.7444/fsrj.v4i1.95

    Directory of Open Access Journals (Sweden)

    Gilberto Sarfati

    2012-06-01

    Full Text Available Micro, small, and medium-sized enterprises (MSMEs constitute the majority of businesses and a significant part of developed and developing countries’ Gross Domestic Product (GDP. This article presents a series of prospective scenarios that investigate the effects of public policies on entrepreneurship in Canada, Ireland, and Italy. Public policies for this sector can be classified as regulatory policies (e.g., laws for the entrance and exit of businesses, labor and social laws, property laws, tax laws, intellectual property laws, bankruptcy laws, and laws that affect the liquidity and availability of capital and stimulus policies (e.g., promotion of cultural and educational programs to foster entrepreneurship and internationalization. Regulatory policies influence the business environment for MSMEs, and are generally designed to provide entrepreneurs with high growth potential (known as “gazelles”. Four scenarios involving the critical uncertainties surrounding political and economic integration and technological development are developed for each country. Each scenario is constructed based on public policies specific to each country. This article concludes that public policies are not a panacea capable of generating economic development, given that their effectiveness depends on other economic decisions and exogenous economic conditions. However, the absence of state intervention does not produce positive effects, even in the case of positive scenarios under exogenous conditions.

  1. Pumping Iron in Australia: Prevalence, Trends and Sociodemographic Correlates of Muscle Strengthening Activity Participation from a National Sample of 195,926 Adults

    OpenAIRE

    Bennie, Jason A; Zeljko Pedisic; Jannique G Z van Uffelen; Charity, Melanie J.; Harvey, Jack T; Banting, Lauren K; Ineke Vergeer; Biddle, Stuart J.H.; Eime, Rochelle M

    2016-01-01

    Objective The current Australian Physical Activity Guidelines recommend that adults engage in regular muscle-strengthening activity (e.g. strength or resistance training). However, public health surveillance studies describing the patterns and trends of population-level muscle-strengthening activity participation are sparse. The aim of this study is to examine the prevalence, trends and sociodemographic correlates of muscle-strengthening activity participation in a national-representative sam...

  2. Serpentine and brucite of ultramafic clasts from the South Chamorro Seamount (Ocean Drilling Program Leg 195, Site 1200): inferences for the serpentinization of the Mariana forearc mantle

    OpenAIRE

    D'Antonio, M.; Università Federico II, Dipartimento di scienze della terra e Instituto Nazionale di Geofisica e Vulcanologia, Osservatorio Vesuviano; Kristensen, M. B.; University of Aarhus, Department of Earth Sciences

    2004-01-01

    Serpentine minerals and brucite in ultramafic rocks from the South Chamorro Seamount were characterized chemically to investigate the serpentinization of the Mariana forearc mantle. Relict primary minerals of the serpentinites are olivine, enstatite and minor Cr-spinel and diopside. The secondary minerals are mostly serpentine and brucite with minor magnetite. The serpentine minerals, mostly lizardite and chrysotile, display large compositional variations. Al2O3 and Cr2O3 contents depend gene...

  3. The gene for human gap junction protein connexin37 (GJA4) maps to chromosome 1p35.1, in the vicinity of D1S195

    Energy Technology Data Exchange (ETDEWEB)

    Van Camp, G.; Coucke, P.; Willems, P.J. [Univ. of Antwerp (Belgium)] [and others

    1995-11-20

    Gap junctions are plasma membrane structures containing channels that allow the exchange of small molecules between cells. Each hemichannel is an oligomer of six subunit proteins called connexins. The formation of intercellular channels is possible through interaction with connexins in the plasma membrane of adjacent cells. Gapjunction channels allow the passage of different molecules up to 1 kDa, such as ions, many second messengers, and small metabolites. Connexins are numbered according to their molecular mass in kilodaltons, calculated from the gene sequences. They are found in the vast majority of cell types and facilitate intercellular communication between cells. Connexins are encoded by a family of homologous genes with highly conserved extracellular and transmembrane domains, whereas the cytoplasmic regions are specific for each subtype. All connexin genes described up to now contain no introns in the coding region. 17 refs., 1 fig.

  4. Shelf-life of ɛ-lysyl-3-(trimethylstannyl)benzamide immunoconjugates, precursors for 211At labeling of antibodies

    DEFF Research Database (Denmark)

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per;

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity ...

  5. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  6. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    International Nuclear Information System (INIS)

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons

  7. Separation of 211At from irradiated bismuth target and labelling of a model protein

    International Nuclear Information System (INIS)

    Astatine-211 is a promising radionuclide for therapeutic use in nuclear medicine. An efficient method (70%) for radiochemical separation from the irradiated Bi-target has been described. The level of Bi contamination in the purified 2'11At-solution was estimated. Finally labelling of a model protein has been tried. (author). 14 refs

  8. American Recovery and Reinvestment Act (ARRA) FEMP Technical Assistance U.S. General Services Administration – Project 195 John Seiberling Federal Office Building and U.S. Courthouse, Akron, Ohio

    Energy Technology Data Exchange (ETDEWEB)

    Arends, J.; Sandusky, William F.

    2010-05-28

    This report documents the findings from an onsite audit of the John Seiberling Federal building located in Akron, Ohio. The Federal landlord for this building is the General Services Administration (GSA). The focus of the audit was to identify various no-cost or low-cost energy efficiency opportunities that, once implemented, would reduce in either electrical and gas consumption and increase the operational efficiency of the building. This audit also provided an opportunity to identify potential capital cost projects that should be considered in the to acquire additional energy (electric and gas) and water savings to further increase the operational efficiency of the building.

  9. Multibeam collection for KN195-05: Multibeam data collected aboard Knorr from 2009-03-24 to 2009-04-05, departing from Puerto Ayora, Ecuador and returning to Puerto Ayora, Ecuador

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  10. Comment on "Origin of low-temperature shoulder internal friction peak of Snoek-Köster peak in a medium carbon high alloyed steel" by Lu et al. [Solid State Communications 195 (2014) 31

    Science.gov (United States)

    Hoyos, J. J.; Mari, D.

    2016-01-01

    We want to discuss the interpretation of low-temperature shoulder internal friction peak of Snoek-Köster peak (LTS-SK). Lu et al. (2015) [1] attributed it to the interaction between the carbon atoms and twin boundaries in martensite. Nevertheless, the decrease of the amplitude of LTS-SK peak due to carbon segregation is correlated with the interstitial carbon content in solid solution in martensite (Hoyos et al., 2015 [2]). Therefore, this peak can also be attributed to the presence of an internal friction athermal background, which is proportional to the concentration of interstitial carbon in solid solution (Tkalcec et al., 2015 [2,3]). In addition, they used an alloyed steel, in which ε carbide precipitated above of the LTS-SK peak temperature. As this behavior cannot be generalized for carbon and high alloyed steels, the carbide precipitates could made an additional contribution to the internal friction.

  11. Densification of Ce0.9Gd0.1O1.95 barrier layer by in-situ solid state reaction

    DEFF Research Database (Denmark)

    Ni, De Wei; Esposito, Vincenzo

    2014-01-01

    -step sintering process to promote the densification of the CGO-BL on dense yttria stabilized zirconia (YSZ) electrolyte. A pre-sintering step is carried out at temperature T1 (1150e1250 °C) to obtain porous and interconnected CGO-BL on dense electrolyte substrate. Impregnation of the porous BL is then carried...... proved on both screen printed and tape cast CGO-BL, showing feasibility for the densification of generic ceramic multilayer systems undergoing different constrained sintering conditions and for a large variety of materials. © 2014 Elsevier B.V. All rights reserved....

  12. DO PUBLIC POLICIES FOR ENTREPRENEURSHIP MAKE A DIFFERENCE? PROSPECTIVE SCENARIOS FOR CANADA, IRELAND, AND ITALY
    DOI:10.7444/fsrj.v4i1.95

    OpenAIRE

    Gilberto Sarfati

    2012-01-01

    Micro, small, and medium-sized enterprises (MSMEs) constitute the majority of businesses and a significant part of developed and developing countries’ Gross Domestic Product (GDP). This article presents a series of prospective scenarios that investigate the effects of public policies on entrepreneurship in Canada, Ireland, and Italy. Public policies for this sector can be classified as regulatory policies (e.g., laws for the entrance and exit of businesses, labor and social laws, property law...

  13. Student Consolidation Loans: Potential Effects of Making Fiscal Year 2006 Consolidation Loans Exclusively through the Direct Loan Program. Report to the Ranking Minority Member, Committee on Education and the Workforce, House of Representatives. GAO-06-195

    Science.gov (United States)

    Ashby, Cornelia M.

    2005-01-01

    Under the Federal Family Education Loan Program (FFELP) and the Federal Direct Loan Program (FDLP), the government guarantees and makes consolidation loans to help borrowers manage their student loan debt. By combining loans into one and extending repayment, monthly repayments are reduced. Unlike other student loans, consolidation loans carry a…

  14. Multibeam collection for KN195L03: Multibeam data collected aboard Knorr from 2009-01-12 to 2009-02-23, departing from Puntarenas, Costa Rica and returning to Honolulu, HI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  15. Karina Ramacciotti y Valobra Adriana (comp), Generando el peronismo. Estudios de cultura, política y género (1946-1955), Buenos Aires, Proyecto Editorial, 2004, 195 p.

    OpenAIRE

    Queirolo, Graciela

    2006-01-01

    El peronismo como fenómeno histórico de múltiples facetas atraviesa el siglo XX de la Argentina y le otorga a dicha sociedad un carácter tan particular que ha despertado el interés académico tanto nacional como internacional. Inagotables, y por lo tanto, renovados análisis han sido practicados por las ciencias sociales. Los ensayos compilados por Karina Ramacciotti y Adriana Valobra en Generando el peronismo se inscriben en esta línea y dialogan con las abundantes hipótesis que el campo histo...

  16. Multibeam collection for KN195-12: Multibeam data collected aboard Knorr from 2009-07-27 to 2009-08-09, departing from Honolulu, HI and returning to Honolulu, HI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  17. Hurdles for a Broader Use of 211At and for the Synthesis of 211At-Labelled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    One of the key impediments to the use of 211At is the very well known deleterious effect of high radiation fields caused by its alpha particles on the synthesis of 211At-labelled radiopharmaceuticals. This is problematic because radiolysis-mediated effects can produce diminishing efficiency of electrophilic astatination reactions due to increasing deposition of radiation dose with increasing activities and with the passage of the time. Astatine-211 has chemical properties that permit complex labelling strategies and a longer half-life than 213Bi that makes it more suitable when the targeting molecule does not gain immediate access to the tumour cells. The first clinical evaluation was published in 2001 [2] in patients with brain tumour. Although this study circumvents many of the challenges to entering clinical studies with 211At and many obstacles had to be surmounted before clinical studies could be initiated, several problems were encountered in maintaining efficient labelling with escalating radiation dose of α-particle even with fresh 211At elution [3]. Astatine-211 also has an additional hurdle to overcome before to its clinical application in labelled radiopharmaceuticals related with its production and distribution. Among the potential group of promising α- emitter it is the only one produced by cyclotrons, but due to the scarcity of cyclotrons equipped with 25−30 MeV α-particle beams, it will of necessity be utilized in distant locations from the site of production. It presents a major chemical challenge because the diminishing efficiency of electrophilic astatination reactions with the passage of the time is well known, a problem likely related to the radiolysis produced by the high LET (linear energy transfer) meaning that large amounts of energy are deposited in a highly localized manner. This problem has been most comprehensively investigated to understand and evaluate the role of the radiolysis effects of astatine alpha particles in the synthesis

  18. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  19. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  20. AcEST: BP912264 [AcEST

    Lifescience Database Archive (English)

    Full Text Available KGDALLFFSLHPSAVPDESSLHTGCPVIEGEKWSATKWIHVAAFEKPRPKNGACV 224 Query: 195 DEDESCGEWAAYGECQKNPTYMIGTSEQPGY 287 +...HGGCPVIEGEKWSATKWIHV S D G+C Sbjct: 200 AVKPRKGDALLFFNLHPDAIPDPLSLHGGCPVIEGEKWSATKWIHVDSFDRIVTPSGNCT 259 Query: 195 DEDESCG...GDALLFFNLHPDAIPDPLSLHGGCPVIEGEKWSATKWIHVDSFDRIVTPSGNCT 259 Query: 195 DEDESCGEWAAYGECQKNPTYMIGTSEQPGY 287 D ...HGGCPVIEGEKWSATKWIHVDSFDKILKPGGNCT 259 Query: 195 DEDESCGEWAAYGECQKNPTYMIGTSEQPG 284 DE++SC WAA GEC KNP YM+G...GDALLFYSLHPNATPDPLSLHGGCPVIQGEKWSATKWIHVDSFDKTVDTEGNCSD 256 Query: 198 EDESCGEWAAYGECQKNPTYMIGTSEQPGY 287 DE

  1. Radiopharmaceutical Chemistry of Targeted Radiopharmaceutics. Synthesis of 211At-Labeled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    Targeted α-particle radiotherapy is an appealing approach to cancer treatment because of the potential for delivering curative doses of radiation to tumor with minimal damage to normal tissue due to a range equivalent to only a few cell diameters. Compared with β-emitters they have significant advantages from a radiobiological perspective. The LET of 211At α-particles is more than 400 times higher than the β-particles emitted by 90Y, in addition the distance between ionizing events is almost the same as that between the two strands of DNA, yielding a high probability of creating non-repairable DNA damage. It gives the ability to kill cancer cells not compromised by hypoxia, dose rate effects or cell cycle position, enhancing their attractiveness for targeted radiotherapy. However, translation of the concept to the clinic has been slow, many obstacles had to be surmounted before clinical studies could be initiated, the first clinical evaluation of a 211At- labeled mAb was made in 2001. This study circumvents many of the challenges to entering clinical studies with 211At. But several problems were encountered in maintaining efficient labeling with escalating radiation dose of alpha-particle likely related to radiolysis. The impact of the radiolysis produced by the α-particle over the labeling chemistry is much higher in comparison with typical β-emitters due to a deposition of energy in the solvent in a highly localized manner two orders of magnitude per unit volume higher than 90Y or 131I. Due to these difficulties a comprehensive basic science study about the radiolytic effects of astatine alpha-particles over the synthesis of 211At-labeled radiopharmaceuticals was carried out. Its main goal was overcoming the problem of the synthesis of 211At-labeled radiopharmaceuticals at the high activities necessaries for therapy and also to extend the shelf life of astatine elutions. Briefly this study held several steps, the first one was to study the role of solvent

  2. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    International Nuclear Information System (INIS)

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211At and 124I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[211At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[211At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [124I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[124I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of macromolecules

  3. 211At production and recovery: first results of a new start

    International Nuclear Information System (INIS)

    Full text: 211At is the only alpha-emitting isotope which can be introduced into organic molecular structures by covalent chemical binding and possesses superior decay characteristics for therapeutic applications when compared with other alpha emitters. However, its production requires a minimum of 27,5 MeV alpha-particles, which are relatively rarely available. In view of the revival of alpha-therapy approaches a production of 211At has been set up at the MHH cyclotron (MC-35). The first aim of this project was to establish a target- and work-up-system for the reliable production of several ten MBq-quantities of 211At for animal- and cell-research. An aluminum-target-system holds a 1.3 cm diameter Bi-disc of 0.25 mm thickness. The disk is pressed onto a the aluminum backing with 2 tons/cm2. The front is covered with a 125 μm Al foil, cooled by a He jet which is separated from the vacuum by a 250 μm Ti foil. Starting with 27.5 MeV alpha-particles the resulting target-energy is 25 MeV. This relatively low energy is chosen to avoid any contamination with 210At and 210Po in the first experimental period. A beam current of 10 μA for 15 min (9 mCoulomb) yields 16.4 MBq 211At theoretically. Astatine is recovered from the target by a dry distillation technique, using various gases as a transport support-medium. The small all-quartz distillation-apparatus is heated up to 900 oC. Astatine is recovered in a small cool able vessel containing various trapping media. Distillation and trapping can be monitored with small radioactivity monitors. The whole system fits in a cubical 0.5 m glove box. Continuous monitoring of the distillation process allowed to optimize the heating rate, the transport support-medium and its flow-rate. Various trapping solutions were tested for their efficiency. Different beam dispersion in the target seems to influence the release and distillation of astatine from the molten bismuth-target. Two different release patterns were observed. The first

  4. Protein (Viridiplantae): 224086357 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 4:195 predicted protein Populus trichocarpa MATTLKSLSSFVILLIVNSLFFTGTTEARPFNIMKSGNSAASRGTESFFDGLSLGGIKEGPSPGAGHEFTNSGTLGGIKEEGPS...PSAGHGFTSSGTLGGIKEGPSPGAGHGFTNSGTLGGIKEGPSPGVGHGFTNSGTLEGIKKEGPSPTNSGTLGGIKEGPS...PGAGHGFTNSETLGGIKEGPSPGVGHEFTNSGTLGGIKEGPSPGVGHGFTNSGTLEGIKKEGPSPTNSGTLGGIKEGPSPGAGHGFTNSETLGGIKEGPS...PGGIKEGSSPGVGHAFTNSGTLGGIKEGPSPGAGHAFTNSGTLGGIKEGPSPGAGHGFTNSGTLGGIKEGSSPGVGHGFTNSGTLGGIKEGPSPCCGNKYTTGTKH ...

  5. 76 FR 25576 - Pipeline Safety: Applying Safety Regulations to All Rural Onshore Hazardous Liquid Low-Stress Lines

    Science.gov (United States)

    2011-05-05

    ... mandate. Phase one, through a final rule published on June 3, 2008, (73 FR 31634), applied full Part 195... 195. This was part of phase one, as discussed above. (2) On July 31, 2008, (73 FR 44800) OMB Control... Federal Register on June 22, 2010, (75 FR 35366) that proposed to extend Part 195 safety requirements...

  6. Comparison of absorption, luminescence and scintillation characteristics in Lu.sub.1.95./sub.Y.sub.0.05./sub.SiO.sub.5./sub.:Ce,Ca and Y.sub.2./sub.SiO.sub.5./sub.:Ce scintillators

    Czech Academy of Sciences Publication Activity Database

    Chewpraditkul, W.; Wanarak, C.; Szczesniak, T.; Moszynski, M.; Jarý, Vítězslav; Beitlerová, Alena; Nikl, Martin

    2013-01-01

    Roč. 35, č. 9 (2013), s. 1679-1684. ISSN 0925-3467 R&D Projects: GA ČR GAP204/12/0805 Institutional support: RVO:68378271 Keywords : LYSO:Ce,Ca * YSO:Ce * Ce 4+ center * scintillation decays * coincidence timing resolution Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.075, year: 2013 http://dx.doi.org/10.1016/j.optmat.2013.04.024

  7. Scholars in International Relations Cite Books More Frequently than Journals: More Research is Needed to Better Understand Research Behaviour and Use. A Review of: Zhang, Li. ʺCitation Analysis for Collection Development: A Study of International Relations Journal Literature.ʺ Library Collections, Acquisitions, and Technical Services 31.3‐4 (2007: 195‐207.

    Directory of Open Access Journals (Sweden)

    Megan von Isenburg

    2009-09-01

    Full Text Available Objective – To determine primary type, format, language and subject category of research materials used by U.S. scholars of international relations. Also, to investigate whether research method, qualitative or quantitative, can be correlated with the type and age of sources that scholars use.Design – Citation analysis.Setting – Research articles published in three journals on international relations with high impact factors: International Organization, International Studies Quarterly, and World Politics.Subjects – A random sample of cited references taken from the 410 full‐length research articles published in these journals from 2000 to 2005. Cited references of articles written by authors of foreign institutions (i.e., non‐American institutions, as well as cited references of editorial and research notes, comments, responses, and review essays were excluded.Methods – Cited references were exported from ISI’s Social Science Citation Index (SSCI to MS Excel spreadsheets for analysis. Data was verified against original reference lists. Citations were numbered and identified by source format, place of publication (foreign or domestic, age, and language used, if other than English. The author used a random number generator to select a random sample of 651 from a total of 29,862 citations. Citations were randomly drawn from each journal according to the proportion of the journals’ citations to the total. These citations were analyzed by material type and language. The author also used the Library of Congress Classification Outline to identify the subject category of each book and journal citation in the sample. A separate sampling method was used to investigate if there is a relationship between research methodology and citation behaviour. Each of the original 410 articles was categorized according to research method: quantitative, qualitative or a combination of the two. Two articles representing qualitative research and two representing quantitative research were randomly selected from each of the three journals for each of the six years. Subsequently, five citations from each of the resulting pool of 72 articles were randomly selected to create a sample of 360 citations. These citations were analyzed by material type and age of source.Main Results – Analysis of the citation data showed that books (including monographs, edited books, book chapters and dictionaries made up 48.2% of the total citations; journals (including scholarly and non‐scholarly titles made up 38.4% of the citations; and government publications made up 4.5% of the citations. Electronic resources, which primarily refer to Web sites and digital collections in this study, represented 1.7% of the citations. Other sources of citations included magazines (1.1%, newspapers (1.1%, working papers (1.1%, theses (0.9%, conference papers not yet published as articles (0.6%, and a miscellaneous category, which included items such as committee minutes, radio broadcasts, unpublished materials and personal communications (2.5%. The average age of book citations was 14.3 years and the median age was 8 years. Foreign language citations represented 3.7% of the 651 total citations. The top ranked foreign languages were German (7, French (5, Russian (4, Spanish (3, Korean (2 and Swedish (number not given. Subject analysis of the citations revealed that 38% of all citations were from international relations and two related disciplines, political science, political theory, and public administration. Subject areas outside international relations included social sciences (23.4% ‐ including economics, commerce, industries and finance, history (16.3%, sociology (6.2%, and law (5.9%. Citations from philosophy, psychology, military science and general works together made up 7.3% of the total citations. Citations from science, linguistics, literature, geography and medicine made up less than 2% of the total.Authors of qualitative research articles were more likely to cite books (56.7% than journals (29.4% while authors of quantitative research articles were more likely to cite journals (58.3% than books (28.9%. Authors of qualitative research articles were also more likely to cite government publications and electronic resources than those of quantitative articles. However, authors of quantitative research articles were more likely to cite other materials, such as dissertations, conference papers, working papers and unpublished materials.The age of cited materials for both qualitative and quantitative research articles is similar. Citations to recent materials up to 5 years old were most frequent, followed by materials 6 to 10 years old, materials 11 to 15 years old, and those 26 or more years old. The least frequently cited materials were 16 to 20 and 21 to 25 years old.Conclusion – Scholars in international relations primarily cite books, followed by journals and government publications. Citations to electronic resources such as Web sites and digital collections, and to other materials are far less common. Scholars primarily cite English‐language materials on international relations and related subjects. Authors of qualitative research articles are more likely to cite books than journals, while authors of quantitative research articles are more likely to cite journals than books. Recent materials are more frequently cited than older materials, though materials that are more than 26 years old are still being cited regularly.

  8. High-Performance Microchanneled Asymmetric Gd0.1Ce0.9O1.95-La0.6Sr0.4FeO3-δ-Based Membranes for Oxygen Separation

    DEFF Research Database (Denmark)

    Cheng, Shiyang; Huang, Hua; Ovtar, Simona;

    2016-01-01

    -like" microchannels. The oxygen permeation flux through the membrane with and without catalytic surface layers was investigated under a variety of oxygen partial pressure gradients. At 900 degrees C, the oxygen permeation flux of the bare membrane was 1.6 (STP) ml cm(-2) min(-1) for the air/He-case and 10.10 (STP) ml.......00 (STP) ml cm(-2) min(-1) was observed between air/CO/CO2 over 200 h at 850 degrees C. Partial surface decomposition was observed on the permeate side exposed to CO, in line with predictions from thermodynamic calculations. In a mixture of CO, CO2, H-2, and H2O at similar oxygen activity the material...... cm(-2) min(-1) for the air/CO-case. Oxygen, flux measurements as well as electrical conductivity relaxation show that the oxygen flux through the bare membrane without catalyst is limited by the oxygen surface exchange. The surface exchange can be enhanced by introduction of catalyst on the membrane...

  9. Scholars in International Relations Cite Books More Frequently than Journals: More Research is Needed to Better Understand Research Behaviour and Use. A Review of: Zhang, Li. ʺCitation Analysis for Collection Development: A Study of International Relations Journal Literature.ʺ Library Collections, Acquisitions, and Technical Services 31.3‐4 (2007): 195‐207.

    OpenAIRE

    Megan von Isenburg

    2009-01-01

    Objective – To determine primary type, format, language and subject category of research materials used by U.S. scholars of international relations. Also, to investigate whether research method, qualitative or quantitative, can be correlated with the type and age of sources that scholars use.Design – Citation analysis.Setting – Research articles published in three journals on international relations with high impact factors: International Organization, International Studies Quarterly, and Wor...

  10. Inclusive measurement of (p,πsup(-)xn) double charge exchange reactions on bismuth from threshold to 800 MeV

    International Nuclear Information System (INIS)

    The energy dependence of the total angle-integrated cross section for the production of astatine isotopes from (p,πsup(-)xn) double charge exchange reactions on bismuth (sup(209)Bi) was measured from 120 to 800 MeV using activation and radiochemical techniques. Chemical yields were estimated by direct radioassaying of sup(211)At activity in thin (approximately 1 mg/cmsup(2)), irradiated bismuth targets. Calculations of the contributions of secondary (2-step) reactions to these measured astatine yields were performed, based partially upon the observed sup(211)At activity although even at the highest energies, the contribution to products lighter than sup(207)At was negligible. These data for products with as many as 7 neutrons removed from the doubly coherent product (sup(210)At) display nearby gaussian shapes for the mass distributions of the astatine residues with the maximum occurring for about sup(204)At. The most probable momentum transfer deduced from these distributions for the initial πsup(-) production step was 335 MeV/c. The observed excitation functions display a behaviour similar to that observed for the yield of sup(210)Po from a (p,πsup(O)) reaction on sup(209)Bi, but radically different from that observed for inclusive πsup(-) reactions on a heavy nucleus. These data are discussed in terms of recent theoretical approaches to negative pion production from bismuth. In addition, a simple, schematic model is developed to treat the rapidly decreasing percentage of the total inclusive πsup(-) emission which is observed for this double charge exchange reaction. This model reflects the capacity of a nucleus to a source of internal energetic protons

  11. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    OpenAIRE

    BAYRAM, Ali

    1998-01-01

    In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 1...

  12. Human radiation studies: Remembering the early years: Oral history of Dr. Patricia Wallace Durbin, Ph.D., conducted November 11, 1994

    International Nuclear Information System (INIS)

    This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches

  13. Diffusion of Implanted Radioisotopes in Solids

    CERN Multimedia

    2002-01-01

    Implantation of radioisotopes into metal and semiconductor samples is performed. The implanted isotope or its decay-product should have a half-life long enough for radiotracer diffusion experiments. Such radioisotopes are utilized to investigate basic diffusion properties in semiconductors and metals and to improve our understanding of the atomic mechanisms of diffusion. For suitably chosen systems the combination of on-line production and clean implantation of radioisotopes at the ISOLDE facility opens new possibilities for diffusion studies in solids. \\\\ \\\\ The investigations are concentrated on diffusion studies of $^{195}$Au in amorphous materials. The isotope $^{195}$Au was obtained from the mass 195 of the mercury beam. $^{195}$Hg decays into $^{195}$Au which is a very convenient isotope for diffusion experiments. \\\\ \\\\ It was found that $^{195}$Au is a slow diffusor in amorphous Co-Zr alloys, whereas Co is a fast diffusor in the same matrix. The ``asymmetry'' in the diffusion behaviour is of considerab...

  14. New data on cross-sections of deuteron induced nuclear reactions on gold up to 50 MeV and comparison of production routes of medically relevant Au and Hg radioisotopes

    CERN Document Server

    Tárkányi, F; Ditrói, F; Takács, S; Adam-Rebeles, R

    2016-01-01

    Investigations of cross-sections of deuteron induced nuclear reactions on gold were extended up to 50 MeV by using the standard stacked foil irradiation technique and high resolution gamma-ray spectrometry. New cross-sections are reported for the $^{197}$Au(d,xn)$^{197m,197g,195m,195g,193m,193g}$Hg and $^{197}$Au(d,x)$^{198m,198g,196m,196g,195,194}$Au nuclear reactions. The application for production of the medically relevant isotopes $^{198}$Au and $^{195m,195g,197m,197g}$Hg is discussed, including the comparison with other charged particle induced production routes. The possible use of the $^{197}$Au(d,x)$^{197m,197g,195m,193m}$Hg and $^{196m,196g}$Au reactions for monitoring deuteron beam parameters is also investigated.

  15. Enhancement of NOx removal performance for (La0.85Sr0.15)0.99MnO3/Ce0.9Gd0.1O1.95 electrochemical cells by NOx storage/reduction adsorption layers

    DEFF Research Database (Denmark)

    Shao, Jing; Kammer Hansen, Kent

    2013-01-01

    cell with a suitable NSR adsorption layer. The improvement for NOx reduction by the adsorption layers was mainly contributed by the promotion of the adsorption and surface diffusion of NOx species at/near the triple phase boundary (TPB) regions of the electrode and probably the formation of a short and...

  16. Enhancement of NOx removal performance for (La0.85Sr0.15)0.99MnO3/Ce0.9Gd0.1O1.95 electrochemical cells by NOx storage/reduction adsorption layers

    DEFF Research Database (Denmark)

    Shao, Jing; Kammer Hansen, Kent

    2013-01-01

    effective reaction path for NOx reduction. A stronger capability for oxidizing NO and/or trapping NOx under the test conditions may have contributed to the superior performance of the K–Pt–Al2O3 adsorption layer relative to the Ba–Pt–Al2O3 layer. © 2012 Elsevier Ltd. All rights reserved....

  17. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  18. A route for polonium 210 production from alpha-particle irradiated bismuth-209 target

    International Nuclear Information System (INIS)

    A method is proposed for production of polonium-210 via the 209Bi(α,3n)210 At nuclear reaction. Bombardment of a bismuth-209 target was performed with a 37 MeV alpha-particle beam that leads to the production of astatine-210 (T1/2 = 8.1 h), which decays to polonium-210. It is purified from the bismuth target matrix by employing liquid-liquid extraction using tributyl phosphate (TBP) in para-xylene from 7 M hydrochloric acid. Back extraction of polonium-210 was performed by 9 M nitric acid. This method allows to purify a tracer amount of Po-210 (2.6 x 10-13 mol) from macroscopic amount of Bi (2.8 x 10-2 mol).

  19. Effective bond orders from two-step spin–orbit coupling approaches: The I{sub 2}, At{sub 2}, IO{sup +}, and AtO{sup +} case studies

    Energy Technology Data Exchange (ETDEWEB)

    Maurice, Rémi, E-mail: remi.maurice@subatech.in2p3.fr; Montavon, Gilles [SUBATECH, CNRS UMR 6457, IN2P3/EMN Nantes/Université de Nantes, 4 rue Alfred Kastler, BP 20722, 44307 Nantes Cedex 3 (France); Réal, Florent; Gomes, André Severo Pereira; Vallet, Valérie [Laboratoire PhLAM, CNRS UMR 8523, Université de Lille, 59655 Villeneuve d’Ascq Cedex (France); Galland, Nicolas [CEISAM, UMR CNRS 6230, Université de Nantes, 2 rue de la Houssinière, BP 92208, 44322 Nantes Cedex 3 (France)

    2015-03-07

    The nature of chemical bonds in heavy main-group diatomics is discussed from the viewpoint of effective bond orders, which are computed from spin–orbit wave functions resulting from spin–orbit configuration interaction calculations. The reliability of the relativistic correlated wave functions obtained in such two-step spin–orbit coupling frameworks is assessed by benchmark studies of the spectroscopic constants with respect to either experimental data, or state-of-the-art fully relativistic correlated calculations. The I{sub 2}, At{sub 2}, IO{sup +}, and AtO{sup +} species are considered, and differences and similarities between the astatine and iodine elements are highlighted. In particular, we demonstrate that spin–orbit coupling weakens the covalent character of the bond in At{sub 2} even more than electron correlation, making the consideration of spin–orbit coupling compulsory for discussing chemical bonding in heavy (6p) main group element systems.

  20. Effective bond orders from two-step spin–orbit coupling approaches: The I2, At2, IO+, and AtO+ case studies

    International Nuclear Information System (INIS)

    The nature of chemical bonds in heavy main-group diatomics is discussed from the viewpoint of effective bond orders, which are computed from spin–orbit wave functions resulting from spin–orbit configuration interaction calculations. The reliability of the relativistic correlated wave functions obtained in such two-step spin–orbit coupling frameworks is assessed by benchmark studies of the spectroscopic constants with respect to either experimental data, or state-of-the-art fully relativistic correlated calculations. The I2, At2, IO+, and AtO+ species are considered, and differences and similarities between the astatine and iodine elements are highlighted. In particular, we demonstrate that spin–orbit coupling weakens the covalent character of the bond in At2 even more than electron correlation, making the consideration of spin–orbit coupling compulsory for discussing chemical bonding in heavy (6p) main group element systems

  1. Different ways to improve the clinical effectiveness of radioimmunotherapy in solid tumors

    Directory of Open Access Journals (Sweden)

    Chatal Jean-Francois

    2009-09-01

    Full Text Available Radioimmunotherapy (RIT has been proven effective in the treatment of radiosensitive non-Hodgkin lymphoma but, for radioresistant solid tumors, new approaches are necessary to improve the clinical effectiveness. A real improvement has been the introduction of the pretargeting technology which appeared to be able to significantly increase tumor-to-normal organ uptake ratios.Another very promising approach consists in associating RIT with other treatment modalities. Finally the use of alpha particle-emitting radionuclides such as astatin-211 or bismuth-213 (alpha-RIT should allow to efficiently eradicate disseminated microscopic clusters of tumor cells or isolated tumor cells which fit well with the short path length of alpha particles.

  2. Sequential radioimmunotherapy with 177Lu- and 211At-labeled monoclonal antibody BR96 in a syngeneic rat colon carcinoma model

    DEFF Research Database (Denmark)

    Eriksson, Sophie E; Elgström, Erika; Bäck, Tom;

    2014-01-01

    UNLABELLED: Alpha-particle emitters, such as astatine-211 (211At), are generally considered suitable for the treatment of small cell clusters due to their short path length, while beta-particle emitters, for example, Lutetium-177 (177Lu), have a longer path length and are considered better for...... small, established tumors. A combination of such radionuclides may be successful in regimens of radioimmunotherapy. In this study, rats were treated by sequential administration of first a 177Lu-labeled antibody, followed by a 211At-labeled antibody 25 days later. METHODS: Rats bearing solid colon...... carcinoma tumors were treated with 400 MBq/kg body weight 177Lu-BR96. After 25 days, three groups of animals were given either 5 or 10 MBq/kg body weight of 211At-BR96 simultaneously with or without a blocking agent reducing halogen uptake in normal tissues. Control animals were not given any 211At-BR96...

  3. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  4. Development of 211At Chemistry for Labelling Biomolecules

    International Nuclear Information System (INIS)

    Our studies have demonstrated that high recovery of 211At can be obtained using a “wet chemistry” approach to isolation from the bismuth target. We have also demonstrated that direct labelling of antibody-B10 conjugates with 211At can be performed in high yields, and that the astatinated antibodies are stable to in vivo deastatination. While these results will allow us to enter clinical studies with 211At-labelled antibodies, the chemistry associated with 211At is not fully understood. Therefore, it is important that many more basic studies to be conducted with 211At, so the optimal labelling reagent for each type of disease-targeting agent becomes apparent

  5. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena;

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... levels of γH2AX decreased during the first 24h in both cycling and stationary cultures and complete repair was seen in all cultures but cycling cells exposed to (211)At. Compared to stationary cells alpha particles were more harmful for cycling cultures, an effect also seen at the pChk2 levels...... cultures at a modest level of damage, clearly demonstrating that cell cycle status influences the relative effectiveness of alpha particles....

  6. Book Review: Organizations: A Systems Approach

    DEFF Research Database (Denmark)

    Schoeneborn, Dennis

    2016-01-01

    Review of: Stefan Kühl: Organizations. A Systems Approach (trans. P. Schmitz). Farnham: Gower Publishing, 2013. 195 pp. £14.99. ISBN 9781472413413.......Review of: Stefan Kühl: Organizations. A Systems Approach (trans. P. Schmitz). Farnham: Gower Publishing, 2013. 195 pp. £14.99. ISBN 9781472413413....

  7. Unigene BLAST: CBRC-CELE-02-0065 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-02-0065 gnl|UG|Cel#S5801979 Caenorhabditis elegans Serpentine Receptor, c...lass H family member (srh-195) (srh-195) mRNA, complete cds /cds=p(1,1005) /gb=NM_061785 /gi=17535634 /ug=Cel.14586 /len=1005 1e-117 54% ...

  8. Is cardiac tolerance to acute ischemia in spontaneously hypertensive rats age- and sex- dependent?

    Czech Academy of Sciences Publication Activity Database

    Szárszoi, O.; Bešík, J.; Chvojková, Zuzana; Kuneš, Jaroslav; Ošťádalová, Ivana; Kolář, František; Pirk, J.; Ošťádal, Bohuslav

    Elsevier. Roč. 42, č. 6 (2007), S195-S195. ISSN 0022-2828. [World Congress of the ISHR /19./. 22.06.2007-26.06.2007, Bologna] R&D Projects: GA MŠk(CZ) 1M0510 Institutional research plan: CEZ:AV0Z50110509 Keywords : gender * spontaneously hypertensive rats * ischemia/reperfusion injury Subject RIV: ED - Physiology

  9. FFT analysis of planar distribution of oscillations in a thermal plasma jet

    Czech Academy of Sciences Publication Activity Database

    Gruber, Jan; Hlína, Jan; Šonský, Jiří; Chvála, František

    Prague : Institute of Plasma Physics AS CR, 2007. s. 195-195. ISBN 978-80-87026-00-7. [International Conference on Phenomena in Ionized Gases-ICPIG 2007 /28./. 15.07.2007-20.07.2007, Prague] Institutional research plan: CEZ:AV0Z20570509 Keywords : plasma jet * oscillation phenomena * tomographical reconstruction Subject RIV: BL - Plasma and Gas Discharge Physics

  10. 75 FR 68543 - Airworthiness Directives; Cessna Aircraft Company Models 150, 152, 170, 172, 175, 177, 180, 182...

    Science.gov (United States)

    2010-11-08

    ... Regulatory Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant... Company Models 150, 152, 170, 172, 175, 177, 180, 182, 185, 188, 190, 195, 206, 207, 210, T303, 336, and..., 177, 180, 182, 185, 188, 190, 195, 206, 207, 210, T303, 336, and 337 series airplanes. AD 87-20-03...

  11. NCBI nr-aa BLAST: CBRC-MMUS-03-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-03-0072 ref|YP_181793.1| tail tape measure protein, TP901 family [Dehaloc...occoides ethenogenes 195] gb|AAW39679.1| tail tape measure protein, TP901 family [Dehalococcoides ethenogenes 195] YP_181793.1 0.56 23% ...

  12. Resonance tube or lax vox?

    Czech Academy of Sciences Publication Activity Database

    Tyrmi, J.; Radolf, Vojtěch; Horáček, Jaromír; Laukkanen, A. M.

    Firenze: Firenze University Press, 2015 - (Manfredi, C.). s. 195-195 ISBN 978-88-6655-794-4. [Pan European Voice Conference : PEVOC /11./. 31.08.2015-02.09.2015, Firenze] R&D Projects: GA ČR(CZ) GAP101/12/1306 Institutional support: RVO:61388998 Keywords : phonation into tube * voice therapy * flow resistance * contact quotient Subject RIV: BI - Acoustics

  13. An improved synthesis of an 125I and 211At labelled benzamide for melanoma imaging

    International Nuclear Information System (INIS)

    Recent studies have indicated that benzamides can exhibit affinity for malignant melanoma and may be exploited diagnostically in the treatment of this cancer. Radioiodinated N-(2-diethylaminoethyl)-3-[123I/131I]iodo-4-methoxybenzamide (*I-IMBA) is a benzamide with promising diagnostic properties. A new synthesis procedure was developed to obtain 125I-IMBA suitable for use in vivo. The assets of the procedure include the use of less toxic reagents and better reproducible results when radiolabelling the precursor. The procedure also facilitates the synthesis of the astatinated N-(2-diethylaminoethyl)-3-[211At]astatine-4-methoxybenzamide (211At-AMBA), a new benzamide with a therapeutic potential. The regiospecific no-carrier-added 125I- and 211At-labeling of the benzamide is performed by demetalation of an organotin precursor. Using tributylstannyl as a leaving group, the radiochemical yield obtained after 15 minutes of reaction was 70 %-90 % for both 125I-IMBA and 211At-AMBA. The labelling was performed in a solution of MeOH:AcOH with NCS as the oxidising agent. The organotin precursor N-(2-diethylaminoethyl)-3-(tri-n-butylstannyl)-4-methoxy-benzamide was synthesized from 3-bromo-4-methoxybenzoic acid, with n-BuLi (2 eq) and Bu3SnCl (1 eq) in THF, giving 3-(tri-n-butylstannyl)-4-methoxybenzoic acid. The amide function was introduced by converting the acid group into an active N-succinimidyl-ester, a good leaving group in the reaction with 2-(diethylamino)ethylamine. The overall yield of the organotin precursor was 65 %

  14. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Energy Technology Data Exchange (ETDEWEB)

    Marsh, B.A., E-mail: bruce.marsh@cern.ch [CERN, CH-1211 Geneva (Switzerland); Andel, B. [Comenius University, Bratislava (Slovakia); Andreyev, A.N. [University of York, Department of Physics, York YO10 5DD (United Kingdom); Antalic, S. [Comenius University, Bratislava (Slovakia); Atanasov, D. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Barzakh, A.E. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, 188300 Gatchina (Russian Federation); Bastin, B. [Grand Accérateur National d’Ions Lourds (GANIL), Bd Henri Becquerel, F-14076 Caen (France); Borgmann, Ch. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Capponi, L. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Cocolios, T.E.; Day Goodacre, T. [CERN, CH-1211 Geneva (Switzerland); University of Manchester, Manchester (United Kingdom); Dehairs, M. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Derkx, X. [University of the West of Scotland, School of Engineering, Paisley PA1 2BE (United Kingdom); De Witte, H. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fedorov, D.V. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, 188300 Gatchina (Russian Federation); Fedosseev, V.N.; Focker, G.J. [CERN, CH-1211 Geneva (Switzerland); Fink, D.A. [Ruprecht-Karls Universität, Seminarstr. 2, 69117 Heidelberg (Germany); CERN, CH-1211 Geneva (Switzerland); Flanagan, K.T. [University of Manchester, Manchester (United Kingdom); Franchoo, S. [CSNSM-IN2P3-CNRS, Université Paris-Sud, 91406 Orsay (France); and others

    2013-12-15

    Highlights: • Upgrade of the lasers, detectors and data acquisition for in-source resonance ionization spectroscopy at ISOLDE. • First use of the ISOLTRAP MR-ToF MS in combination with laser spectroscopy at ISOLDE. • Resonance ionization of astatine for the study of its nuclear structure. -- Abstract: At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  15. Superdeformed bands of odd nuclei in A=190 region in the quasiparticle picture

    International Nuclear Information System (INIS)

    Properties of the superdeformed (SD) bands of 195Pb and 193Hg have been studied by the cranked Hartree-Fock-Bogoliubov method. The calculations reproduce the flat behavior of the dynamical moment of inertia of two of the SD bands of 195Pb measured recently. Possible configuration assignments for the observed bands 3 and 4 of 195Pb are discussed. The two interacting SD bands of 193Hg have also been calculated. The analysis confirms the superiority of a density-dependent pairing force over a seniority pairing interaction. (author)

  16. Dicty_cDB: Contig-U15784-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gth = 4185 Score = 1088 bits (549), Expect = 0.0 Identities = 549/549 (100%) Strand = Plus / Plus Quer...07 tttaaattt 1615 Score = 807 bits (407), Expect = 0.0 Identities = 407/407 (100%) Strand = Plus / Plus Quer...gatggaagtaaatcaccaccaactaatagt 2232 Score = 571 bits (288), Expect = e-162 Identities = 288/288 (100%) Strand = Plus / Plus Quer...its (195), Expect = e-106 Identities = 195/195 (100%) Strand = Plus / Plus Query: 780 caccacaatcaccatcatcatc...gaaa 477 Score = 283 bits (143), Expect = 1e-75 Identities = 143/143 (100%) Strand = Plus / Plus Quer

  17. Comparing i-Tree modeled ozone deposition with field measurements in a periurban Mediterranean forest

    Czech Academy of Sciences Publication Activity Database

    Morani, A.; Nowak, D.; Hirabayashi, S.; Guidolotti, G.; Medori, M.; Muzzini, V.; Fares, S.; Scarascia-Mugnozza, G.; Calfapietra, Carlo

    2014-01-01

    Roč. 195, DEC 2014 (2014), s. 202-209. ISSN 0269-7491 Institutional support: RVO:67179843 Keywords : Ball–Berry * ozone flux * mediterranean region Subject RIV: EH - Ecology, Behaviour Impact factor: 4.143, year: 2014

  18. Sdílená suverenita. Boj o solidaritu v evropské integraci

    Czech Academy of Sciences Publication Activity Database

    Hrubec, Marek

    Praha: Academia, 2014 - (Hlaváček, P.), s. 189-195 ISBN 978-80-200-2361-2 Institutional support: RVO:67985955 Keywords : shared sovereignty * European Union * European integration * Habermas Subject RIV: AA - Philosophy ; Religion

  19. Eimuntas Nekroshiuse teatripoeetika / Ruta Mazheikiene ; tõlk. Tiina Kattel

    Index Scriptorium Estoniae

    Mazheikiene, Ruta

    2004-01-01

    E. Nekroshiuse lavastustele iseloomulikest joontest, toetudes tema lavastustele "Hamlet" "Macbeth", "Othello", "Onu Vanja", "Nina". Samuti näitlejatega töötamise strateegiast. Kasut. kirjandus, lk. 194-195

  20. 77 FR 61826 - Pipeline Safety: Communication During Emergency Situations

    Science.gov (United States)

    2012-10-11

    ... American Petroleum Institute's (API) Recommended Practice (RP) 1162. Incorporated by reference into Sec. Sec. 192.616 and 195.440, API RP 1162 further requires operators to provide notice of, and...

  1. Tench broodstock management in breeding station under conditions of pond culture: a review

    Czech Academy of Sciences Publication Activity Database

    Gela, David; Flajšhans, Martin; Kocour, Martin; Rodina, Marek; Linhart, Otomar

    2006-01-01

    Roč. 14, 2 (2006), s. 195-203. ISSN 0967-6120 Institutional research plan: CEZ:AV0Z50450515 Keywords : broodstock * farming cycle * fish identification Subject RIV: GL - Fishing Impact factor: 0.943, year: 2006

  2. Population Migration in the Territory of Former Yugoslavia in the 20th Century

    Czech Academy of Sciences Publication Activity Database

    Škerlová, Jana

    Praha: Historický ústav, 2015, s. 169-195 ISBN 978-80-7286-260-3 Institutional support: RVO:67985963 Keywords : population migration * forced migration s * resettlement * Yugoslavia * 20th century Subject RIV: AB - History

  3. The Theory of Global Governance, Constitutionalization and Comparative Constitutional Law

    Czech Academy of Sciences Publication Activity Database

    Blahož, Josef

    2013-01-01

    Roč. 3, č. 3 (2013), s. 195-207. ISSN 1805-8396 Institutional support: RVO:68378122 Keywords : globalization of political culture * global constitutionalism * comparative constitutional law Subject RIV: AG - Legal Sciences

  4. 48 CFR 1823.570 - Drug- and alcohol-free workforce.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION SOCIOECONOMIC PROGRAMS ENVIRONMENT, ENERGY AND WATER EFFICIENCY, RENEWABLE ENERGY TECHNOLOGIES.... 2473, 72 Stat. 429; and Civil Space Employee Testing Act of 1991, Public Law 102-195, sec. 21, 105...

  5. The Caloplaca crenulatella species complex; its intricate taxonomy and description of a new species

    Czech Academy of Sciences Publication Activity Database

    Vondrák, Jan; Říha, P.; Redchenko, O.; Vondráková, O.; Hrouzek, P.; Khodosovtsev, A.

    2011-01-01

    Roč. 43, č. 3 (2011), s. 467-481. ISSN 0024-2829 Institutional research plan: CEZ:AV0Z60050516 Keywords : lichens * paraphyletic taxa * phylogeny Subject RIV: EF - Botanics Impact factor: 1.195, year: 2011

  6. The effect of Bt-corn on decomposers and decomposition rates of corn post-harvest residues under laboratory and field conditions

    Czech Academy of Sciences Publication Activity Database

    Frouz, Jan; Elhottová, Dana; Kocourek, J.

    Rouen: Université de Rouen, 2004. s. 195. [International Colloquium on Soil Zoology and Ecology /14./. 30.08.2004-03.09.2004, Rouen] Keywords : Bt-corn * decomposition rates * corn post - harvest residues Subject RIV: EH - Ecology, Behaviour

  7. Skryto za vlnou vítězství. Devadesátá léta

    Czech Academy of Sciences Publication Activity Database

    Gjuričová, Adéla

    Praha : DOX, Centre for Contemporary Art, 2014 - (Anděl, J.), s. 195-198 ISBN 978-80-87446-30-0 Institutional support: RVO:68378114 Keywords : development after 1989 * globalization * East-Central Europe Subject RIV: AB - History

  8. Dvojí druh apriorního poznání v Platónových dialozích

    Czech Academy of Sciences Publication Activity Database

    Chvatík, Ivan

    Červený Kostelec: Pavel Mervart, 2011 - (Kůrka, P.; Matoušek, A.), s. 195-210 ISBN 978-80-7465-012-3 Institutional support: RVO:67985955 Keywords : mathema * phronesis Subject RIV: AA - Philosophy ; Religion

  9. Structure and Bonding in Binuclear Metal Carbonyls. Classical Paradigms vs. Insights from Modern Theoretical Calculations

    Czech Academy of Sciences Publication Activity Database

    Ponec, Robert

    2015-01-01

    Roč. 1053, SI (2015), s. 195-213. ISSN 2210-271X Institutional support: RVO:67985858 Keywords : binuclear metal carbonyls * DAFH analysis * 18-electron rule Subject RIV: CC - Organic Chemistry Impact factor: 1.545, year: 2014

  10. Processing Methodology and Dialectological Aspects of the Dictionary of Moravian and Silesian Anoikonyms (Minor Place Names)

    Czech Academy of Sciences Publication Activity Database

    Čižmárová, Libuše

    2010-01-01

    Roč. 3, č. 1 (2010), s. 183-195. ISSN 1855-6302 Institutional research plan: CEZ:AV0Z90610518 Keywords : onomastics, dialectology * electronic dictionary * anoikonyms * digitization * Moravia * Silesia * minor place names Subject RIV: AI - Linguistics

  11. BIOLOGY OF GREGARINES AND THEIR HOST-PARASITE INTERACTIONS

    Czech Academy of Sciences Publication Activity Database

    Schrevel, J.; Desportes, I.; Goldstein, S.; Kuriyama, R.; Prensier, G.; Vávra, Jiří

    Pa Leiden: BRILL, 2013 - (Desportes, I.; Schrevel, J.), s. 25-195 ISBN 978-90-04-25602-6 Institutional support: RVO:60077344 Keywords : Scolopendra cingulata * 3 cortical membranes * Anthonomus grandis boheman Subject RIV: EG - Zoology

  12. Neuromuscular paralysis induced in insect larvae by the proteinic venom of a parasitic wasp

    Czech Academy of Sciences Publication Activity Database

    Sláma, Karel

    New York: Nova Science Publishers, 2012 - (Berhardt, L.), s. 195-212 ISBN 978-1-62100-889-7 Institutional research plan: CEZ:AV0Z50070508 Keywords : neuromuscular paralysis Subject RIV: ED - Physiology

  13. Victor Heinrich Riecke a Brno jako osvícenské srdce moravského protestantismu

    Czech Academy of Sciences Publication Activity Database

    Bolom-Kotari, Sixtus

    2015-01-01

    Roč. 28, [1] (2015), s. 195-225. ISSN 0524-689X Institutional support: RVO:67985963 Keywords : Protestantism * late Enlightenment * philanthropy * secret societies * Czech-German relations Subject RIV: AB - History

  14. Wisconsin Gravity Data for the Rhinelader Area

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The gravity station data (195 records) were compiled by Barbara Eckstein. This data base was received in January 1987. Principal gravity parameters include Free-Air...

  15. Úvod: Sociální práva podle Cécile Fabreové

    Czech Academy of Sciences Publication Activity Database

    Hrubec, Marek

    Praha : Filosofia, 2004, s. 5-8 ISBN 80-7007-195-8. - (Parva philosophica. 15) Institutional research plan: CEZ:AV0Z9009908 Keywords : Social Rights * Constitution Subject RIV: AA - Philosophy ; Religion

  16. Drug: D09967 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ide bridge: 23-89; 135-195; H230-L215, Dimer) Peptide Uveitis, rheumatoid arthritis, psoriasis ATC code: L04...teraction hsa05323(3605) Rheumatoid arthritis map07050 Antirheumatics - DMARDs and biological agents Anatomi

  17. Eight-Membered Cyclic 1,2,3-Trithiocane Derivatives from Perophora viridis, an Atlantic Tunicate

    Czech Academy of Sciences Publication Activity Database

    Řezanka, Tomáš; Dembitsky, V. M.

    - (2002), s. 2400-2404. ISSN 1434-193X Institutional research plan: CEZ:AV0Z5020903 Keywords : natural * products * sulfur heterocycles Subject RIV: EE - Microbiology, Virology Impact factor: 2.195, year: 2002

  18. Kunstkamera jako Švankmajerův mikrokosmos

    Czech Academy of Sciences Publication Activity Database

    Purš, Ivo

    Řevnice : Arbor vitae , 2012 - (Dryje, F.; Schmitt, B.), s. 195-217 ISBN 978-80-7467-015-2 Institutional support: RVO:68378033 Keywords : surrealism * fine art * film Subject RIV: AL - Art, Architecture, Cultural Heritage

  19. Structuring mobile and contextual learning

    NARCIS (Netherlands)

    Glahn, Christian; Specht, Marcus

    2011-01-01

    Glahn, C., & Specht, M. (2011). Structuring mobile and contextual learning. In Proceedings of the 10th World Conference on Mobile and Contextual Learning (pp. 188-195). October, 18-21, 2011, Beijing, China.

  20. Development of eight polymorphic microsatellite markers in the Black and Rufous sengi, Rhynchocyon petersi

    Czech Academy of Sciences Publication Activity Database

    Sabuni, C. A.; Van Houtte, N.; Maganga, S. L. S.; Makundi, R. H.; Leirs, H.; Goüy de Bellocq, Joëlle

    2015-01-01

    Roč. 7, č. 1 (2015), s. 193-195. ISSN 1877-7252 Institutional support: RVO:68081766 Keywords : Rhynchocyon petersi * Vulnerable afrotherian * Microsatellites * 454 Sequencing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.172, year: 2014

  1. CERN'S Fire and Rescue Group Gets New Ambulance

    CERN Multimedia

    2000-01-01

    The ambulance is to replace another based on the off-road vehicle design which was originally acquired for the civil engineering phase of LEP construction. Just one figure, in 1999, the CERN ambulance was called out 195 times.

  2. The Future Is Coming: Electronic Health Records

    Science.gov (United States)

    ... example, if you've ever suffered from a bad back or aching joints—and who hasn't!— ... Act's $19.5 billion investment in health information technology can best save money, improve patient care, and ...

  3. Absolute absorption cross-section measurements of ozone in the wavelength region 238-335 nm and the temperature dependence

    Science.gov (United States)

    Yoshino, K.; Freeman, D. E.; Esmond, J. R.; Parkinson, W. H.

    1988-01-01

    The absolute absorption cross-section of ozone has been experimentally determined at the temperatures 195, 228, and 295 K at several discrete wavelengths in the 238-335-nm region. The present results for ozone at 295 K are found to be in agreement with those of Hearn (1961). Absolute cross-section measurements of ozone at 195 K have confirmed previous (Freeman et al., 1984) relative cross-section measurements throughout the 240-335-nm region.

  4. Genetic and bibliographic information: EYA4 [GenLibi

    Lifescience Database Archive (English)

    Full Text Available EYA4 eyes absent homolog 4 (Drosophila) human Cardiomyopathy, Dilated (MeSH); dilat...ed cardiomyopathy; sensorineural hearing loss Cardiovascular Diseases (C14) > Heart Diseases (C14.280) > Card...iomegaly (C14.280.195) > Cardiomyopathy, Dilated (C14.280.195.160) Cardiovascular Diseases (C14) > Heart Diseases (C14.280) > Card...iomyopathies (C14.280.238) > Cardiomyopathy, Dilated (C14.280.238.070) 05A0344219 ...

  5. NCBI nr-aa BLAST: CBRC-PTRO-04-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-04-0021 ref|NP_000570.1| chemokine (C-C motif) receptor 5 [Homo sapiens] ref|NP_001093 ... ptor type 5 (C-C CKR-5) (CC-CKR-5) (CCR-5) (CCR5) (HIV -1 fusion coreceptor) (CHEMR13) (CD195 antigen) [Ho ... ptor type 5 (C-C CKR-5) (CC-CKR-5) (CCR-5) (CCR5) (HIV -1 fusion coreceptor) (CHEMR13) (CD195 antigen) emb ...

  6. Gene : CBRC-HSAP-03-0025 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-03-0025 3 A Chemokines and chemotactic factors receptors CCR5_HUMAN 0.0 100% ref|NP_00 ... ptor type 5 (C-C CKR-5) (CC-CKR-5) (CCR-5) (CCR5) (HIV -1 fusion coreceptor) (CHEMR13) (CD195 antigen) [Ho ... ptor type 5 (C-C CKR-5) (CC-CKR-5) (CCR-5) (CCR5) (HIV -1 fusion coreceptor) (CHEMR13) (CD195 antigen) emb ...

  7. Gene : CBRC-HSAP-26-0010 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-26-0010 UN A Chemokines and chemotactic factors receptors CCR5_HUMAN 0.0 100% ref|NP_0 ... ptor type 5 (C-C CKR-5) (CC-CKR-5) (CCR-5) (CCR5) (HIV -1 fusion coreceptor) (CHEMR13) (CD195 antigen) [Ho ... ptor type 5 (C-C CKR-5) (CC-CKR-5) (CCR-5) (CCR5) (HIV -1 fusion coreceptor) (CHEMR13) (CD195 antigen) emb ...

  8. NCBI nr-aa BLAST: CBRC-PABE-26-0846 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-26-0846 ref|NP_000570.1| chemokine (C-C motif) receptor 5 [Homo sapiens] ref|NP_001093 ... ptor type 5 (C-C CKR-5) (CC-CKR-5) (CCR-5) (CCR5) (HIV -1 fusion coreceptor) (CHEMR13) (CD195 antigen) [Ho ... ptor type 5 (C-C CKR-5) (CC-CKR-5) (CCR-5) (CCR5) (HIV -1 fusion coreceptor) (CHEMR13) (CD195 antigen) emb ...

  9. NCBI nr-aa BLAST: CBRC-HSAP-26-0010 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-26-0010 ref|NP_000570.1| chemokine (C-C motif) receptor 5 [Homo sapiens] ref|NP_001093 ... ptor type 5 (C-C CKR-5) (CC-CKR-5) (CCR-5) (CCR5) (HIV -1 fusion coreceptor) (CHEMR13) (CD195 antigen) [Ho ... ptor type 5 (C-C CKR-5) (CC-CKR-5) (CCR-5) (CCR5) (HIV -1 fusion coreceptor) (CHEMR13) (CD195 antigen) emb ...

  10. NCBI nr-aa BLAST: CBRC-HSAP-03-0025 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-03-0025 ref|NP_000570.1| chemokine (C-C motif) receptor 5 [Homo sapiens] ref|NP_001093 ... ptor type 5 (C-C CKR-5) (CC-CKR-5) (CCR-5) (CCR5) (HIV -1 fusion coreceptor) (CHEMR13) (CD195 antigen) [Ho ... ptor type 5 (C-C CKR-5) (CC-CKR-5) (CCR-5) (CCR5) (HIV -1 fusion coreceptor) (CHEMR13) (CD195 antigen) emb ...

  11. NCBI nr-aa BLAST: CBRC-TSYR-01-0757 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-0757 ref|NP_670963.1| hypothetical protein y3668 [Yersinia pestis KIM] ref|NP_99494 ... n YPF_0815 [Yersinia pestis biovar Orientalis str. India ... 195] ref|ZP_04515858.1| hypothetical protein YP516 ... n YPF_0815 [Yersinia pestis biovar Orientalis str. India ... 195] gb|EEO86808.1| hypothetical protein YPH_2732 ...

  12. NCBI nr-aa BLAST: CBRC-MEUG-01-1857 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-1857 ref|NP_670963.1| hypothetical protein y3668 [Yersinia pestis KIM] ref|NP_99494 ... n YPF_0815 [Yersinia pestis biovar Orientalis str. India ... 195] ref|ZP_04515858.1| hypothetical protein YP516 ... n YPF_0815 [Yersinia pestis biovar Orientalis str. India ... 195] gb|EEO86808.1| hypothetical protein YPH_2732 ...

  13. AcEST: BP920922 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000143_D08 599 Adiantum capillus-veneris mRNA. clone: YMU001_000143_D08. BP920922 - Show ... .....................done Score E Sequences producing s ignificant alignments: (bits) Value sp|P20973|UBE1 ... ositives = 161/195 (82%) Frame = -2 Query: 598 AMSSNGS PSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAG ... ositives = 159/195 (81%) Frame = -2 Query: 598 AMSSNGS PSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAG ... Positives = 123/192 (64%) Frame = -2 Query: 595 MSSNGS PSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAG ...

  14. Search for shipwrecks in Goa water

    Digital Repository Service at National Institute of Oceanography (India)

    Thakkar, M.

    stream_size 3 stream_content_type text/plain stream_name 2_Indian_Conf_Mar_Archaeol_I.O._Countries_1990_195.pdf.txt stream_source_info 2_Indian_Conf_Mar_Archaeol_I.O._Countries_1990_195.pdf.txt Content-Encoding ISO-8859-1 Content...-Type text/plain; charset=ISO-8859-1 ...

  15. Culture, Cross-Role Consistency, and Adjustment: Testing Trait and Cultural Psychology Perspectives

    OpenAIRE

    Church, A. Timothy; Anderson-Harumi, Cheryl A.; del Prado, Alicia M.; Curtis, Guy J.; Tanaka-Matsumi, Junko; Valdez Medina, José L.; Mastor, Khairul A.; White, Fiona A.; Miramontes, Lilia A.; Katigbak, Marcia S.

    2008-01-01

    Trait and cultural psychology perspectives on cross-role consistency and its relation to adjustment were examined in two individualistic cultures, the United States (N = 231) and Australia (N = 195), and four collectivistic cultures, Mexico (N = 199), Philippines (N = 195), Malaysia (N = 217), and Japan (N = 180). Cross-role consistency in trait ratings was evident in all cultures, supporting trait perspectives. Cultural comparisons of mean consistency provided support for cultural psychology...

  16. A NEW PROBE-BASED METHOD FOR MEASURING THE DIFFUSION COEFFICIENT IN THE TOKAMAK EDGE REGION

    Czech Academy of Sciences Publication Activity Database

    Brotánková, Jana; Martines, E.; Adámek, Jiří; Popa, G.; Costin, C.; Schrittwieser, R.; Ionita, C.; Stöckel, Jan; Van Oost, G.; van de Peppel, L.

    Frascati : European Physical Society, 2006 - (De Marco, F.; Vlad, G.), P-2.195-P-2.195 ISBN 2-914771-40-1. - (Europhysics Conference Abstracts. 301). [EPS Conference on Plasma Physics /33rd./. Řím (IT), 19.06.2006-23.06.2006] R&D Projects: GA AV ČR(CZ) KJB100430601 Institutional research plan: CEZ:AV0Z20430508 Keywords : probe measurements * plasma edge * diffusion Subject RIV: BL - Plasma and Gas Discharge Physics

  17. Low cost removal of reactive dyes using wheat bran

    International Nuclear Information System (INIS)

    In this study, the adsorption of Reactive Blue 19 (RB 19), Reactive Red 195 (RR 195) and Reactive Yellow 145 (RY 145) onto wheat bran, generated as a by-product material from flour factory, was studied with respect to initial pH, temperature, initial dye concentration, adsorbent concentration and adsorbent size. The adsorption of RB 19, RR 195 and RY 145 onto wheat bran increased with increasing temperature and initial dye concentration while the adsorbed RB 19, RR 195 and RY 145 amounts decreased with increasing initial pH and adsorbent concentration. The Langmuir and Freundlich isotherm models were applied to the experimental equilibrium data depending on temperature and the isotherm constants were determined by using linear regression analysis. The monolayer covarage capacities of wheat bran for RB 19, RR 195 and RY 145 dyes were obtained as 117.6, 119.1 and 196.1 mg/g at 60 deg. C, respectively. It was observed that the reactive dye adsorption capacity of wheat bran decreased in the order of RY 145 > RB 19 > RR 195. The pseudo-second order kinetic and Weber-Morris models were applied to the experimental data and it was found that both the surface adsorption as well as intraparticle diffusion contributed to the actual adsorption processes of RB 19, RR 195 and RY 145. Regression coefficients (R 2) for the pseudo-second order kinetic model were higher than 0.99. Thermodynamic studies showed that the adsorption of RB 19, RR 195 and RY 145 dyes onto wheat bran was endothermic in nature

  18. Medial patellofemoral ligament injury patterns and associated pathology in lateral patella dislocation: an MRI study

    Directory of Open Access Journals (Sweden)

    Guerrero Patrick

    2009-07-01

    Full Text Available Abstract Background Lateral Patella dislocations are common injuries seen in the active and young adult populations. Our study focus was to evaluate medial patellofemoral ligament (MPFL injury patterns and associated knee pathology using Magnetic Resonance Imaging studies. Methods MRI studies taken at one imaging site between January, 2007 to January, 2008 with the final diagnosis of patella dislocation were screened for this study. Of the 324 cases that were found, 195 patients with lateral patellar dislocation traumatic enough to cause bone bruises on the lateral femoral trochlea and the medial facet of the patella were selected for this study. The MRI images were reviewed by three independent observers for location and type of MPFL injury, osteochondral defects, loose bodies, MCL and meniscus tears. The data was analyzed as a single cohort and by gender. Results This study consisted of 127 males and 68 females; mean age of 23 yrs. Tear of the MPFL at the patellar attachment occurred in 93/195 knees (47%, at the femoral attachment in 50/195 knees (26%, and at both the femoral and patella attachment sites in 26/195 knees (13%. Attenuation of the MPFL without rupture occurred in 26/195 knees (13%. Associated findings included loose bodies in 23/195 (13%, meniscus tears 41/195 (21%, patella avulsion/fracture in 14/195 (7%, medial collateral ligament sprains/tears in 37/195 (19% and osteochondral lesions in 96/195 knees (49%. Statistical analysis showed females had significantly more associated meniscus tears than the males (27% vs. 17%, p = 0.04. Although not statistically significant, osteochondral lesions were seen more in male patients with acute patella dislocation (52% vs. 42%, p = 0.08. Conclusion Patients who present with lateral patella dislocation with the classic bone bruise pattern seen on MRI will likely rupture the MPFL at the patellar side. Females are more likely to have an associated meniscal tear than males; however, more males

  19. Hepatorenal protective effect of Antistax ® against chemically-induced toxicity

    Directory of Open Access Journals (Sweden)

    Atallah F Ahmed

    2015-01-01

    Full Text Available Background: Antioxidant natural products and chemoprevention are considered nowadays as an effective approach against health various disorders and diseases induced by oxidative stress or free radicals. Objective: The aim of this study was to assess the hepato- and nephroprotective activity of a standardized red vine leaf aqueous extract AS195 (Antistax ® . Methods: The protective activity of AS195 (100 mg/kg was investigated on carbon tetrachloride (CCl 4 -intoxicated rats in comparison with silymarin. The flavonoid/proanthocyanidin nature of AS195 was identified by phytochemical and nuclear magnetic resonance (NMR analyses, while its total phenol/proanthocyanidin/flavonoid content and antioxidant activity were determined by Folin-Ciocalteau, vanillin-sulfuric acid, AlCl 3 , and 2,2-diphenyl-2-picrylhydrazyl radical scavenging assays, respectively. Results: Relative to the control CCl 4 -intoxicated group, pretreatment with AS195 could significantly suppressed the elevated serum levels of alanine aminotransferase, alkaline phosphatase, γ-glutamyl transferase, total cholesterol, low-density lipoprotein cholesterol, very low-density lipoprotein cholesterol, triglycerides, bilirubin, creatinine, uric acid, and calcium, whereas it significantly increased the diminished serum levels of high-density lipoprotein cholesterol, albumin and total protein. Moreover, AS195 significantly decreased malondialdehyde formation in the tissues of liver and kidney, whereas it significantly elevated and nonprotein sulfhydryl groups, compared with the intoxicated control. The improvement in biochemical parameters by AS195 was obviously observed and further confirmed by restoration of normal histological features in the two organs. Conclusions: The results of the present study revealed the capacity of AS195 to enhance the recovery from xenobiotic-induced hepatorenal toxicity initiated by free radicals.

  20. The biokinetics of alpha-particle emitting radiopharmaceuticals

    International Nuclear Information System (INIS)

    The past two decades have seen wide interest in the application of alpha-particle emitting radionuclides for targeted endoradiotherapy and a large number of compounds labeled with 211At (T1/2 7.21 h), 212Bi (T1/2 1 h) or 213Bi (T1/2 0.78 h) have been studied. Knowledge of the biokinetic behaviour of such agents is important both for their optimal clinical exploitation and for general radiological protection purposes. Animal studies of the distribution and retention of 211At compounds, including ionic astatide, substituted aromatic compounds and labelled monoclonal antibodies, have provided new information on the biochemistry of astatine. With respect the thyroid gland the uptake of the astatide ion has been shown to be very much lower than that of the iodide ion. Less information is available for 212Bi-labelled radiopharmaceuticals. The available data for both 211At and 212Bi radiopharmaceuticals are reviewed. Cautious generic biokinetic models for inorganic and simple organic compounds of 211At and 212Bi; for [211At]-, and [212Bi]-biphosphonates and for [211At]-, and [212Bi]-monoclonal antibodies, are proposed for use in general radiological protection when compound-specific data are not available. (orig.)

  1. The radiolabeled monoclonal antibodies in immunoscintigraphy and radioimmunotherapy: current state and perspectives

    International Nuclear Information System (INIS)

    The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)

  2. Biological toxicity of intracellular radionuclide decay. Part of a coordinated programme on radiation biology of Auger emitters and their therapeutic applications

    International Nuclear Information System (INIS)

    Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125I-labelled Synkavit would be desirable for clinical application

  3. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  4. The biokinetics of alpha-particle emitting radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, D.M. [School of Chemistry, Cardiff Univ., Cardiff (United Kingdom); Duffield, J.R. [Faculty of Applied Sciences, Univ. of the West of England, Bristol (United Kingdom)

    2005-07-01

    The past two decades have seen wide interest in the application of alpha-particle emitting radionuclides for targeted endoradiotherapy and a large number of compounds labeled with {sup 211}At (T{sup 1}/{sub 2} 7.21 h), {sup 212}Bi (T{sup 1}/{sub 2} 1 h) or {sup 213}Bi (T{sup 1}/{sub 2} 0.78 h) have been studied. Knowledge of the biokinetic behaviour of such agents is important both for their optimal clinical exploitation and for general radiological protection purposes. Animal studies of the distribution and retention of {sup 211}At compounds, including ionic astatide, substituted aromatic compounds and labelled monoclonal antibodies, have provided new information on the biochemistry of astatine. With respect the thyroid gland the uptake of the astatide ion has been shown to be very much lower than that of the iodide ion. Less information is available for {sup 212}Bi-labelled radiopharmaceuticals. The available data for both {sup 211}At and {sup 212}Bi radiopharmaceuticals are reviewed. Cautious generic biokinetic models for inorganic and simple organic compounds of {sup 211}At and {sup 212}Bi; for [{sup 211}At]-, and [{sup 212}Bi]-biphosphonates and for [{sup 211}At]-, and [{sup 212}Bi]-monoclonal antibodies, are proposed for use in general radiological protection when compound-specific data are not available. (orig.)

  5. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    International Nuclear Information System (INIS)

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 (211At-cMAb U36). Effects on 211At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  6. Tumor immunotargeting using innovative radionuclides.

    Science.gov (United States)

    Kraeber-Bodéré, Françoise; Rousseau, Caroline; Bodet-Milin, Caroline; Mathieu, Cédric; Guérard, François; Frampas, Eric; Carlier, Thomas; Chouin, Nicolas; Haddad, Ferid; Chatal, Jean-François; Faivre-Chauvet, Alain; Chérel, Michel; Barbet, Jacques

    2015-01-01

    This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality. PMID:25679452

  7. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  8. Proceedings of transuranium elements

    International Nuclear Information System (INIS)

    The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium

  9. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  10. Development and radiotherapeutic application of 211At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    International Nuclear Information System (INIS)

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated

  11. Nuclear and chemical data for life sciences

    International Nuclear Information System (INIS)

    Use of reactor produced radionuclides is popular in life sciences. However, cyclotron production of proton rich radionuclides are being more focused in recent times. These radionuclides have already gained attention in various fields, including life sciences, provided they are obtained in pure form. This article is a representative brief of our contributions in generating nuclear data for the production of proton rich radionuclides of terbium, astatine, technetium, ruthenium, cadmium, niobium, zirconium, rhenium, etc., which may have application in clinical, biological, agriculture studies or in basic research. The chemical data required to separate the product isotopes from the corresponding target matrix have been presented along with a few propositions of radiopharmaceuticals. It also emphasizes on the development of simple empirical technique, based on the nuclear reaction model analysis, to generate reliable nuclear data for the estimation of yield and angular distribution of emitted neutrons and light charged particles from light as well as heavy ion induced reactions on thick stopping targets. These data bear utmost important in radiation dosimetry. (author)

  12. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  13. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    Energy Technology Data Exchange (ETDEWEB)

    Nestor, Marika, E-mail: marika.nestor@bms.uu.s [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden); Sundstroem, Magnus [Unit of Molecular Pathology, Department of Genetics and Pathology, Uppsala University (Sweden); Anniko, Matti [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden)

    2011-01-15

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ({sup 211}At-cMAb U36). Effects on {sup 211}At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with {sup 211}At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced {sup 211}At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  14. Alpha particle emitters in medicine

    International Nuclear Information System (INIS)

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 (211At) and natural bismuth-212 (212Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 (223Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs

  15. Preparation of 211At-labeled humanized anti-Tac using 211At produced in disposable internal and external bismuth targets

    International Nuclear Information System (INIS)

    These studies describe the production and purification of 211At as well as the procedure for labeling humanized anti-Tac, the antibody to the α-chain of the IL-2 receptor (IL-2Rα), which has been shown to be a useful target for immunotherapy. The optimized protocol combines the advantages of the two-stage dry distillation procedure with the astatination of trialkylstannyl substances as labeling compounds for proteins. The 211At was produced by bombarding either an external or a recently developed disposable internal bismuth target with α-particles from a Cyclotron Corporation CS-30 cyclotron. The 211At was found to contain less than 0.01% 210At. The production rate for the external target was 0.15 mCi ± 0.056 μA-1 h-1 (n = 9) (5.55 MBq μA-1 h-1). The production rate for the internal target was 0.44 ± 0.14 mCi μA-1 h-1 (n = 16) (16.28 MBq μA-1 h-1)

  16. Accuracy of implant positioning for minimally invasive total knee arthroplasty in patients with severe varus deformity.

    Science.gov (United States)

    Niki, Yasuo; Matsumoto, Hideo; Otani, Toshiro; Enomoto, Hiroyuki; Toyama, Yoshiaki; Suda, Yasunori

    2010-04-01

    Minimally invasive surgery (MIS) in total knee arthroplasty (TKA) reportedly yields decreased patient morbidity and a rapid return of function, but how much deformity can be accepted for MIS-TKA remains unclear. This study investigated 238 knees from 218 consecutive patients who underwent MIS-TKA. Patients were divided into groups with tibiofemoral mechanical axis (TFM) 195 degrees or greater and TFM less than 195 degrees, then clinical and radiographic results were compared. Similar improvements in knee score at 3 months postoperatively were obtained in the both groups, whereas radiographic accuracy of the coronal alignment in the TFM >or=195 degrees group was inferior to that in TFM angle of the femoral shaft (LBFS) 4 degrees or greater, and 53% of patients in the TFM >or=195 degrees group displayed LBFS 4 degrees or greater, explaining the inferior radiographic accuracy in this group compared with the TFM <195 degrees group. These results indicate that use of MIS techniques decreases radiographic accuracy, particularly in patients with severe genu varum and increased LBFS. PMID:20347714

  17. Application of labelled compound produced by reactor to medicament

    International Nuclear Information System (INIS)

    Enriched platinum(mw:194) metals were irradiated in the hydralic conveyer of KUR with a thermalneutron flux of approx. 8.15 x 1013 n · cm-2 · sec-1 for 20 hrs. Two days after irradiation, sample were dissolved in aquaregia, and reduced by hydazin to Pt++. To synthesize 195mPt-labelled CDDP, NH4OH was added to the reaction mixture, and the amination reaction was proceeded under the wild heating condition. The separation and purification of CDDP were carried out using HPLC (Shordex OHpak columm). Present results indicated that the use of HPLC is useful to obtain 195mPt-CDDP with the highest chemical and radiochemical purities. The specific-activity of 195mPt-CDDP was about 100 μCi/mg-CDDP at the present experimental condition. (author)

  18. Activation cross sections of proton induced nuclear reactions on gold up to 65MeV.

    Science.gov (United States)

    Ditrói, F; Tárkányi, F; Takács, S; Hermanne, A

    2016-07-01

    Activation cross sections of proton induced reactions on gold for production of (197m,197g,195m,195g, 193m,193g,192)Hg, (196m,196g(cum),195g(cum),194,191(cum))Au, (191(cum))Pt and (192)Ir were measured up to 65MeV proton energy, some of them for the first time. The new data are in acceptably good agreement with the recently published earlier experimental data in the overlapping energy region. The experimental data are compared with the predictions of the TALYS 1.6 (results in TENDL-2015 on-line library) and EMPIRE 3.2 code. PMID:27156194

  19. Dicty_cDB: SFH150 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lcctrsfxwwfi**csryvvnwchylyfimwfptilcfisklii* knfxr*l*fprtrmdscl*tcqsfh*klncqrsrstsycqtms**plalw**sinwfxc* s...ulus 13 days embryo lung c... 195 1e-48 (Q8IU85) RecName: Full=Calcium/calmodulin-dependent protein kina... ...195 1e-48 AY335686_1( AY335686 |pid:none) Synthetic construct Homo sapiens C... 195 1e-48 (Q8BW96) RecName: Full=Calcium/cal... AB076903 |pid:none) Ciona intestinalis Ci-CaM-K mRNA f... 197 2e-49 BC074183_1( BC074183 |pid:none) Xenopus...SF (Link to library) SFH150 (Link to dictyBase) - - - Contig-U11996-1 SFH150P (Link to Original

  20. Spectroscopy of A˜190 Ir-Pt-Au Nuclei Near Stability from Complete and Incomplete Fusion Reaction

    Science.gov (United States)

    Fang, Y. D.; Zhang, Y. H.; Zhou, X. H.; Liu, M. L.; Wang, J. G.; Guo, Y. X.; Lei, X. G.; Hua, W.; Ma, F.; Wang, S. C.; Gao, B. S.; Li, S. C.; Wu, X. G.; He, C. Y.; Zheng, Y.; Wang, Z. M.; Shi, Y.; Xu, F. R.

    2013-11-01

    High-spin states of 194, 195Au, 195Pt and 193Ir have been studied using an in-beam γ-ray spectroscopic technique following the reaction of 7Li on an 192Os target at 44 MeV. The emitted γ rays were observed using an array of 14 Compton-suppressed HPGe detectors. Several bands in these nuclei have been identified and extended up to high-spin states. The α and t emission channels leading to 193Ir and 195Pt, respectively, are strongly enhanced which may be explained by incomplete fusion reaction; the t and α fragments from the break-up of weakly bound 7Li nucleus fusion with 192Os target.

  1. Structural mutations of C-domains in members of the Ig superfamily. Consequences for the interactions between the T cell antigen receptor and the zeta 2 homodimer

    DEFF Research Database (Denmark)

    Geisler, C; Rubin, B; Caspar-Bauguil, S; Champagne, E; Vangsted, A; Hou, X; Gajhede, M

    1992-01-01

    not fully understood. We locate critical amino acid residues for TCR assembly in the Ti-alpha and -beta extracellular C-domains. A point mutation (phenylalanine195----valine) in a highly conserved residue in the Ti-alpha chain of the Jurkat variant J79 was identified by DNA sequencing. This mutation......-alpha-deficient Jurkat variant. Computer model analysis showed that the Ti-alpha phenylalanine195 directly contributed to the beta-sheet facing away from the Ti-beta chain, indicating that it could be directly involved in the interactions between one or more of the CD3 chains or the zeta 2 dimer. Site...

  2. From the UV to the static-field limit: Rates and scaling laws for intense-field ionization of helium

    International Nuclear Information System (INIS)

    We present high-accuracy calculations of ionization rates of helium at UV (195 nm) wavelengths. The numerical results are obtained from full-dimensional numerical integration of the two-electron time-dependent Schroedinger equation. Comparison is made between ionization rates at 195 nm with previously obtained data at 390 nm and 780 nm. In addition, we have obtained quantitatively accurate solutions of the full-dimensional time-dependent Schroedinger equation for static-field ionization of helium. We compare our numerically integrated rates with those of time-independent calculations, and obtain good agreement over a wide range of intensities.

  3. Radiation-induced synthesis of low molecular weight of PTFE and their crosslinking in acetone medium

    International Nuclear Information System (INIS)

    Polytetrafluoroethylene was obtained by radiation-induced polymerization of tetrafluoroethylene in acetone at 195 K. An average diameter of the products was very small compared with the commercial one; it was about 0.2 μm. The yield was reached to 100% with a dose of 4 kGy. The crystallinity of the products is decreasing with increasing dose. The crystallinity becomes low, for higher irradiation doses. It was found that PTFE obtained by irradiation of TFE in acetone at 195 K has Y-type crosslinking structure. This was demonstrated by means of 19F MAS NMR

  4. Radiation induced synthesis of low molecular weight of PTFE and their crosslinking in acetone medium

    International Nuclear Information System (INIS)

    Polytetrafluoroethylene was obtained by radiation induced polymerization of tetrafluoroethylene in acetone at 195 K. An average diameter of the products was very small compared with commercial one; it was about 0.3 micro-meters. The yield was reached to 100% with a dose of 4 kGy. The crystallinity of the products is decreasing with increasing dose. The products become amorphous, for higher irradiation doses. It was found that PTFE obtained by irradiation of TFE in acetone at 195 K has branching structure. This was demonstrated by means of 19F MAS NMR. (Author)

  5. Adequacy of iodine intake in three different Japanese adult dietary patterns: a nationwide study

    OpenAIRE

    Katagiri, Ryoko; Asakura, Keiko; Uechi, Ken; Masayasu, Shizuko; Sasaki, Satoshi

    2015-01-01

    Background Iodine intake is considered to be high in Japan due to regular seaweed consumption. Subgroups that do not have a traditional Japanese-style diet may consume insufficient amounts of iodine. Method Three hundred and ninety apparently healthy adults (195 men and 195 women) aged 20 to 69 years from 20 areas throughout Japan completed four-day diet records and collected a 24-h urine sample. Dietary patterns were extracted from 31 food groups by cluster analysis. The iodine adequacy of e...

  6. Mechanism of rigid overlaying of carboniferous strata failure in face mining in the case of multiseams deposit

    Czech Academy of Sciences Publication Activity Database

    Jiránková, E.; Staš, Lubomír; Kajzar, Vlastimil; Doležalová, Hana

    2013-01-01

    Roč. 10, č. 2 (2013), s. 189-195. ISSN 1214-9705 R&D Projects: GA MŠk ED2.1.00/03.0082; GA MV VG20102014034 Institutional support: RVO:68145535 Keywords : subsidence trough * rock mass * overlaying strata * longwall mining * tensor stress measurement Subject RIV: DH - Mining , incl. Coal Mining Impact factor: 0.667, year: 2013 http://www.irsm.cas.cz/materialy/acta_content/2013_02/acta_170_08_Jirankova_189-195.pdf

  7. Pretreatment on Corn Stover with Low Concentration of Formic Acid

    DEFF Research Database (Denmark)

    Xu, Jian; Thomsen, Mette Hedegaard; Thomsen, Anne Belinda

    2009-01-01

    the cellulose easily degraded into sugars and further fermented to ethanol. In this work, hydrothermal pretreatment on corn stover at 195 degrees for 15 min with and without lower concentration of formic acid was compared in terms of sugar recoveries and ethanol fermentation. For pretreatment with...... following pretreatment without formic acid. Toxicity tests of liquor parts showed that there were no inhibitions found for both pretreatment conditions. After simultaneous saccharification and fermentation (SSF) of the pretreated corn stover with Baker's yeast, the highest ethanol yield of 76.5% of the...... theoretical was observed from corn stover pretreated at 195 degrees for 15min with formic acid....

  8. Mammalian Flavin-Containing Monooxygenase (FMO) as a Source of Hydrogen Peroxide

    OpenAIRE

    Siddens, Lisbeth K.; Krueger, Sharon K.; Henderson, Marilyn C.; Williams, David E.

    2014-01-01

    Flavin-containing monooxygenase (FMO) oxygenates drugs/xenobiotics containing a soft nucleophile through a C4a hydroperoxy-FAD intermediate. Human FMOs 1, 2 and 3, expressed in Sf9 insect microsomes, released 30–50% of O2 consumed as H2O2 upon addition of NADPH. Addition of substrate had little effect on H2O2 production. Two common FMO2 (the major isoform in the lung) genetic polymorphisms, S195L and N413K, were examined for generation of H2O2. FMO2 S195L exhibited higher “l...

  9. Guaranteed and fully computable two-sided bounds of Friedrichs' constant

    Czech Academy of Sciences Publication Activity Database

    Vejchodský, Tomáš

    Prague : Institute of Math ematics, Academy of Sciences of the Czech Republic, 2013 - (Chleboun, J.; Segeth, K.; Šístek, J.; Vejchodský, T.), s. 195-201 ISBN 978-80-85823-62-2. [Programy a algoritmy numerické matematiky /16./. Dolní Maxov (CZ), 03.06.2012-08.06.2012] R&D Projects: GA AV ČR(CZ) IAA100190803 Institutional support: RVO:67985840 Keywords : numerical methods * computing Subject RIV: BA - General Math ematics http://users. math .cas.cz/~panm/Panm16/proceedings_final/195_vejchodsky.pdf

  10. Dicty_cDB: Contig-U04845-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available caaat 195 Score = 69.9 bits (35), Expect = 2e-12 Identities = 35/35 (100%) Strand = Plus...tities = 33/33 (100%) Strand = Plus / Plus Query: 1 caatattcaaactttattaatagataattcatc 33 |||||||||||||||||||...|||||||||||||| Sbjct: 1 caatattcaaactttattaatagataattcatc 33 Score = 48.1 bits (24), Expect = 7e-06 Identities = 24/24 (100%) Stran... 195 Score = 69.9 bits (35), Expect = 2e-12 Identities = 35/35 (100%) Strand = Plus / Plus Query: 274 ctcaataataatttattatattactacat... Length = 1912 Score = 38.2 bits (19), Expect = 0.007 Identities = 19/19 (100%) Strand = Plus / Minus Query: 174 attttaaataattatta

  11. Análise de fatores associados à não aceitação da vacina contra hepatite B em adolescentes escolares de baixa renda Analysis of factors associated with non-acceptance of hepatitis B vaccine among low income adolescent students

    OpenAIRE

    Michelle Dias da Silva Oliveira; Valéria Paggoto; Marcos André de Matos; Aline Garcia Kozlowski; Nádia Rúbia da Silva; Ana Luiza Neto Junqueira; Sandra Maria Brunini Souza; Regina Maria Bringel Martins; Sheila Araujo Teles

    2007-01-01

    Para avaliar os fatores de predição da não adesão à vacina contra o vírus da hepatite B (VHB) em adolescentes escolares de baixa renda da Região Metropolitana de Goiânia, Goiás, 304 indivíduos suscetíveis ao VHB, matriculados em duas escolas, foram entrevistados e a vacina contra hepatite foi oferecida. Somente 195 (64%) adolescentes aceitaram a primeira dose da vacina. Por outro lado, 182/195 (93,3%) receberam o esquema completo. Verificou-se que fatores escolares exerceram um papel na aceit...

  12. Physical Activity

    DEFF Research Database (Denmark)

    Andersen, Lars Bo; Anderssen, Sigmund Alfred; Wisløff, Ulrik;

    2014-01-01

    Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers.......Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers....

  13. EST Table: CK533832 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK533832 rswgb0_001886.y1 10/09/29 44 %/195 aa ref|XP_974065.1| PREDICTED: similar to Outer dense fiber... protein 2 (Outer dense fiber of sperm tails protein 2) (84 kDa outer dense fiber protei.../168 aa gnl|Amel|GB14311-PA 10/09/10 44 %/195 aa gi|91078946|ref|XP_974065.1| PREDICTED: similar to Outer dense fiber... protein 2 (Outer dense fiber of sperm tails protein 2) (84 kDa outer dense fiber protein) (Cenexin) [Tribolium castaneum] CK536834 swg ...

  14. Dicty_cDB: AFK493 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available elim): 0 length of query: 195 length of database: 80,480,566 effective HSP length: 17 effective... length of query: 178 effective length of database: 78,821,179 effective search space: 14030169862 effective... Number of sequences better than 10.0: 0 length of query: 195 length of database: Z,213,015,108 effective HSP length: 22 effective... length of query: 173 effective length of database: Y,388,266,194 effective... search space: 7160170051562 effective search space used: 7160170051562 T: 0 A: 0 X1: 6 (11.

  15. Kategorie výzdobného stylu na lineární keramice z Bylan

    Czech Academy of Sciences Publication Activity Database

    Květina, Petr; Končelová, Markéta

    2011-01-01

    Roč. 63, č. 2 (2011), s. 195-219. ISSN 0323-1267 R&D Projects: GA ČR(CZ) GAP405/11/1590 Institutional research plan: CEZ:AV0Z80020508 Keywords : Early Neolithic * style of pottery decoration * Bylany Subject RIV: AC - Archeology, Anthropology, Ethnology

  16. Chování některých prvků při zvětrávání granitoidů melechovského masivu

    Czech Academy of Sciences Publication Activity Database

    Procházka, V.; Žáček, M.; Vlček, V.; Langrová, Anna

    2009-01-01

    Roč. 2008, - (2009), s. 189-195. ISSN 0514-8057 Institutional research plan: CEZ:AV0Z30130516 Keywords : granite * Melechov massif * chemical weathering * boreholes Subject RIV: DD - Geochemistry http://www.geology.cz/zpravy/obsah/2008/2008-53.pdf

  17. The astrophysical consequences of the bimodal hydrodynamic solution of the super star cluster winds

    Czech Academy of Sciences Publication Activity Database

    Palouš, Jan; Wünsch, Richard; Tenorio-Tagle, G.; Silich, S.

    2009-01-01

    Roč. 324, 2-4 (2009), s. 195-198. ISSN 0004-640X R&D Projects: GA MŠk(CZ) LC06014 Institutional research plan: CEZ:AV0Z10030501 Keywords : stellar wind s * star cluster s * HII regions Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.404, year: 2009

  18. Vliv koroze pod napětím na bezpečnost provozu plynovodu (2. část)

    Czech Academy of Sciences Publication Activity Database

    Gajdoš, Lubomír; Šperl, Martin

    2009-01-01

    Roč. 89, č. 9 (2009), s. 195-199. ISSN 0032-1761 R&D Projects: GA MPO(CZ) FT-TA5/076 Institutional research plan: CEZ:AV0Z20710524 Keywords : corrosion cracking * pipeline * fracture toughness Subject RIV: JL - Materials Fatigue, Friction Mechanics

  19. Bolestná Panna Marie, kolem 1510

    Czech Academy of Sciences Publication Activity Database

    Dáňová, Helena; Gubíková, R.

    Chomutov: Oblastní muzeum v Chomutově, 2014 - (Dáňová, H.; Gubíková, R.), s. 191-195 ISBN 978-80-87898-07-9 Institutional support: RVO:68378033 Keywords : Our Lady of Sorrows * Saxony * Freiberg Subject RIV: AL - Art, Architecture, Cultural Heritage

  20. Complete Toluene Oxidation on Pt/CeO2-ZrO2-ZnO Catalysts

    Directory of Open Access Journals (Sweden)

    Nobuhito Imanaka

    2013-08-01

    Full Text Available A 0.4 wt%Pt/Ce0.76Zr0.19Zn0.05O1.95 catalyst was prepared by the evaporative drying method. The catalytic toluene oxidation activity of the catalyst was investigated and the calcination temperature dependence on the toluene oxidation activity was characterized. It was confirmed that only CO2 and steam were produced by the complete oxidation of toluene, and no toluene-derived compounds were detected as by-products with a gas chromatography-mass spectrometer. Toluene was completely oxidized at 320 °C on the 0.4 wt%Pt/Ce0.76Zr0.19Zn0.05O1.95 catalyst calcined at 500 °C. The toluene oxidation activity slightly decreased with increasing the calcination temperature of the catalyst. However, significant deactivation was not recognized in the present 0.4 wt%Pt/Ce0.76Zr0.19Zn0.05O1.95 catalyst, and toluene was completely oxidized at 360 °C even after calcination at 1000 °C. From these results, it became obvious that the 0.4 wt%Pt/Ce0.76Zr0.19Zn0.05O1.95 catalyst has high thermal stability for toluene oxidation activity.

  1. 78 FR 50120 - Self-Regulatory Organizations; EDGA Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2013-08-16

    ... education program upon availability in WebCRD , the central licensing and registration system operated by... 56 Exam and Continuing Education Fees The Exchange proposes to add to its Fee Schedule a $195 fee per... and its related continuing education. However, Members would continue to submit the exam fee to...

  2. Low-temperature Fabrication of Highly-Efficient, Optically-Transparent (FTO-free) Graphene Cathode for Co-Mediated Dye-Sensitized Solar Cells with Acetonitrile-free Electrolyte Solution

    Czech Academy of Sciences Publication Activity Database

    Kavan, Ladislav; Liska, P.; Zakeeruddin, S. M.; Grätzel, M.

    2016-01-01

    Roč. 195, MAR 2016 (2016), s. 34-42. ISSN 0013-4686 R&D Projects: GA ČR GA13-07724S Institutional support: RVO:61388955 Keywords : dye sensitized solar cell * electrochemical impedance spectroscopy * stainless-steel Subject RIV: CG - Electrochemistry Impact factor: 4.504, year: 2014

  3. The Struggle Within

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    For Chinalco, the country’s largest aluminum maker, this year’s goal is about revival China Aluminum Corp. (Chinalco) stunned the world with its high- profile $19.5-billion investment plan for Australian mining company Rio Tinto Group. But the aluminum giant’ s financial health may not be as sound as headlines suggest.

  4. Magnetic fluctuations in La1.95Ba0.05CuO4

    DEFF Research Database (Denmark)

    Hayden, S.M.; Aeppli, G.; Mook, H.; Rytz, D.; Hundley, M.F.; Fisk, Z.

    1991-01-01

    Neutron-scattering and resistivity experiments on single crystals of La1.95Ba0.05CuO4 are described. On warming to as high as 250 K, the correlation length does not change, and the temperature dependence of the generalized susceptibility chi(Q, omega) is due solely to the temperature dependence of...

  5. To Ink or Not to Ink: The Meaning of Tattoos among College Students

    Science.gov (United States)

    Dickson, Lynda; Dukes, Richard L.; Smith, Hilary; Strapko, Noel

    2015-01-01

    We examine the process of getting a tattoo and its meaning among 195 tattooed and 257 non-tattooed undergraduates. Most tattooed respondents contemplate getting a tattoo for months, get a professional tattoo, can cover it easily, and like it. Respondents acquire first tattoos to represent important role transitions and as a form of identity and…

  6. 76 FR 35130 - Pipeline Safety: Control Room Management/Human Factors

    Science.gov (United States)

    2011-06-16

    ... on December 3, 2009, in 49 CFR 192.631 and 195.446 (74 FR 63310), as corrected February 3, 2010 (75 FR 5536). By this amendment to the Control Room Management/Human Factors (CRM) rule, an operator must... benefit of this rulemaking action is an expedited implementation deadline of the CRM rule that...

  7. Class Attendance in College: A Meta-Analytic Review of the Relationship of Class Attendance with Grades and Student Characteristics

    Science.gov (United States)

    Crede, Marcus; Roch, Sylvia G.; Kieszczynka, Urszula M.

    2010-01-01

    A meta-analysis of the relationship between class attendance in college and college grades reveals that attendance has strong relationships with both class grades (k = 69, N = 21,195, p = 0.44) and GPA (k = 33, N = 9,243, p = 0.41). These relationships make class attendance a better predictor of college grades than any other known predictor of…

  8. Montreal Modern

    DEFF Research Database (Denmark)

    Handberg, Kristian

    2015-01-01

    Through analyses of the retro scenes in Montreal, Canada, the article discusses retro culture’s role as cultural memory. It is shown how Montreal’s cultural identity is formed by memories of modern culture such as the Red-light and Sin City reputation of the illicit nightlife of the 1940s and 195...

  9. The Underrecording of Suicides in State and National Records, Alaska, 1983-1984.

    Science.gov (United States)

    Hlady, W. Gary; Middaugh, John P.

    1988-01-01

    Searched state and national vital statistics records for suicides in Alaska (1983-1984). Of 195 deaths meeting case definition of suicide, 141 appeared in state records; 112 in national records. Native suicides were more likely to be underrecorded that non-Native suicides. Errors resulted primarily from delayed determinations of cause of death and…

  10. Národopisci a sociokulturní antropologové v měnícím se českém prostředí

    Czech Academy of Sciences Publication Activity Database

    Uherek, Zdeněk

    2007-01-01

    Roč. 43, č. 1 (2007), s. 195-203. ISSN 0038-0288 Institutional research plan: CEZ:AV0Z90580513 Keywords : social anthropology * Czech Republic * Central Europe Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 0.169, year: 2007

  11. Children's Perceptions of Maternal Hostility as a Mediator of the Link between Discipline and Children's Adjustment in Four Countries

    Science.gov (United States)

    Lansford, Jennifer E.; Malone, Patrick S.; Dodge, Kenneth A.; Chang, Lei; Chaudhary, Nandita; Tapanya, Sombat; Oburu, Paul; Deater-Deckard, Kirby

    2010-01-01

    Using data from 195 dyads of mothers and children (age range = 8-12 years; M = 10.63) in four countries (China, India, the Philippines, and Thailand), this study examined children's perceptions of maternal hostility as a mediator of the links between physical discipline and harsh verbal discipline and children's adjustment. Both physical…

  12. Generational Differences among a Small Group of Hmong Americans

    Science.gov (United States)

    Vang, Pa Der

    2013-01-01

    Few studies have looked at the differences in culture, language, and educational attainments among generations of Hmong in the United States since the beginning of their immigration to the United States. This study of 195 Hmong participants examines the effects of generational status on Hmong immigrants across several factors including marriage…

  13. Between Truth and Beauty. Symposium 194e – 201c

    Czech Academy of Sciences Publication Activity Database

    Boháček, Kryštof

    2010-01-01

    Roč. 2, International Issue 1 (2010), s. 173-195. ISSN 1803-7860 Institutional support: RVO:67985955 Keywords : Plato * Symposium * Gorgias * Agathon * tragic thought * rhetoric * philosophy of power Subject RIV: AA - Philosophy ; Religion http://hdl.handle.net/11104/0236437

  14. Kuidas kirjutatakse ajalugu? / Alain Corbin ; interv. Marek Tamm

    Index Scriptorium Estoniae

    Corbin, Alain

    2007-01-01

    Pariis I Ülikooli emeriitprofessori A. Corbini teoste temaatikast ja uurimistöödest. Varem ilm.: Emotsioonid, tunded ja kired : intervjuu Alain Corbiniga // Corbin, Alain. Kannibalide küla : hirm ja raev 19. sajandi Prantsusmaal. - Tallinn, 2000. - Lk. 187-195

  15. Optimal timing of TV commercials: symmetrical model

    Czech Academy of Sciences Publication Activity Database

    Kadlec, Tomáš

    2002-01-01

    Roč. 2002, č. 195 (2002), s. 1-27. ISSN 1211-3298 R&D Projects: GA AV ČR KSK9058117 Institutional research plan: CEZ:AV0Z7085904 Keywords : TV commercials * behavior * TV viewer Subject RIV: AH - Economics

  16. Lamin A/C and emerin regulate MKL1-SRF activity by modulating actin dynamics.

    Science.gov (United States)

    Ho, Chin Yee; Jaalouk, Diana E; Vartiainen, Maria K; Lammerding, Jan

    2013-05-23

    Laminopathies, caused by mutations in the LMNA gene encoding the nuclear envelope proteins lamins A and C, represent a diverse group of diseases that include Emery-Dreifuss muscular dystrophy (EDMD), dilated cardiomyopathy (DCM), limb-girdle muscular dystrophy, and Hutchison-Gilford progeria syndrome. Most LMNA mutations affect skeletal and cardiac muscle by mechanisms that remain incompletely understood. Loss of structural function and altered interaction of mutant lamins with (tissue-specific) transcription factors have been proposed to explain the tissue-specific phenotypes. Here we report in mice that lamin-A/C-deficient (Lmna(-/-)) and Lmna(N195K/N195K) mutant cells have impaired nuclear translocation and downstream signalling of the mechanosensitive transcription factor megakaryoblastic leukaemia 1 (MKL1), a myocardin family member that is pivotal in cardiac development and function. Altered nucleo-cytoplasmic shuttling of MKL1 was caused by altered actin dynamics in Lmna(-/-) and Lmna(N195K/N195K) mutant cells. Ectopic expression of the nuclear envelope protein emerin, which is mislocalized in Lmna mutant cells and also linked to EDMD and DCM, restored MKL1 nuclear translocation and rescued actin dynamics in mutant cells. These findings present a novel mechanism that could provide insight into the disease aetiology for the cardiac phenotype in many laminopathies, whereby lamin A/C and emerin regulate gene expression through modulation of nuclear and cytoskeletal actin polymerization. PMID:23644458

  17. Ilias Arie »Zefiretti lusinghieri«. Eine Prager Einfügung im Idomeneo-Autograph

    Czech Academy of Sciences Publication Activity Database

    Jonášová, Milada

    Tutzing: Hans Schneider , 2010 - (Schmid, M.), s. 195-224 ISBN 9783862960019 R&D Projects: GA ČR GA408/09/2006 Institutional research plan: CEZ:AV0Z90580513 Keywords : Mozart´ autograph * Idomeneo * aria of Ilia * Zeffiretti lusinghieri * Prague copyist Subject RIV: AL - Art, Architecture, Cultural Heritage

  18. Dicty_cDB: VFM777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFM777 (Link to dictyBase) - - - Contig-U15456-1 VFM777P (Link to Original ... _1( U60995 |pid:none) Schistosoma mansoni aspartic proteinas ... 195 2e-48 FN357312_67( FN357312 |pid:none) Schi ...

  19. Peer Social Skills and Theory of Mind in Children with Autism, Deafness, or Typical Development

    Science.gov (United States)

    Peterson, Candida; Slaughter, Virginia; Moore, Chris; Wellman, Henry M.

    2016-01-01

    Consequences of theory of mind (ToM) development for daily social lives of children are uncertain. Five to 13-year-olds (N = 195) with typical development, autism, or deafness (both native and late signers) took ToM tests and their teachers reported on their social skills for peer interaction (e.g., leadership, group entry). Groups differed in…

  20. Palaeomagnetism in the Sines massif (SW Iberia) revisited: evidences for Late Cretaceous hydrothermal alteration and associated partial remagnetization

    Czech Academy of Sciences Publication Activity Database

    Ribeiro, P.; Silva, P. F.; Moita, P.; Kratinová, Zuzana; Marques, F. O.; Henry, B.

    2013-01-01

    Roč. 195, č. 1 (2013), s. 176-191. ISSN 0956-540X Grant ostatní: FCT(PT) PTDC/CTE-GIX/098696/2008 Institutional support: RVO:67985530 Keywords : magnetic fabrics and anisotropy * magnetic mineralogy and petrology * palaeomagnetism applied to tectonics Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 2.724, year: 2013

  1. Chemical characteristics of zircon from A-type granites and comparison to zircon of S-type granites

    Czech Academy of Sciences Publication Activity Database

    Breiter, Karel; Lamarão, C. N.; Krás Borges, R. M.; Dall'Agnol, R.

    1192/195, April (2014), s. 208-225. ISSN 0024-4937 Institutional support: RVO:67985831 Keywords : zircon * A-type granites * S-type granites * Wiborg batholith * Brazil * Krušné hory/Erzgebirge Subject RIV: DD - Geochemistry Impact factor: 4.482, year: 2014

  2. Viability, longevity, and egg production of Drosophila melanogaster are regulated by the miR-282 microDNA

    Czech Academy of Sciences Publication Activity Database

    Vilmos, P.; Bujna, Á.; Szuperák, M.; Havelda, Z.; Várallyay, É.; Szabad, J.; Kučerová, Lucie; Somogyi, K.; Kristó, I.; Lukácsovich, T.; Jankovics, F.; Henn, L.; Erdélyi, M.

    2013-01-01

    Roč. 195, č. 2 (2013), s. 469-480. ISSN 0016-6731 Grant ostatní: Hungarian National Science Foundation(HU) NK84121; Hungarian National Science Foundation(HU) K108538 Institutional support: RVO:60077344 Keywords : Drosophila melanogaster Subject RIV: ED - Physiology Impact factor: 4.389, year: 2012

  3. Dicty_cDB: VHA180 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ophrenia region contig 1 section 5 of 11 of the complete...11 clone RP11-195I23, WORKING DRAFT SEQUENCE, 25 unordered pieces. 44 0.15 4 AE014308 |AE014308.1 Homo sapiens chromosome 13q34 schiz

  4. AcEST: DK960660 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|Q05BQ1|TUTLA_MOUSE Protein turtle homolog A OS=Mus musculus G... 31 7.1 sp|Q8UGV3|Y932_AGRT5 UPF0260 pro... IS+GG Sbjct: 166 LGTRCVRCEPTFVNTSRSCSCSEPH------ISTGG 195 >sp|Q05BQ1|TUTLA_MOUSE Protein turtle homolog A O

  5. Enzymatic hydrolysis and fermentability of corn stover pretreated by lactic acid and/or acetic acid

    DEFF Research Database (Denmark)

    Xu, Jian; Thomsen, Mette Hedegaard; Thomsen, Anne Belinda

    2009-01-01

    Four different pretreatments with and without addition of low concentration organic acids were carried out on corn stover at 195 °C for 15 min. The highest xylan recovery of 81.08% was obtained after pretreatment without acid catalyst and the lowest of 58.78% after pretreatment with both acetic and...

  6. Ethanol production from hydrothermal pretreated corn stover with a loop reactor

    DEFF Research Database (Denmark)

    Xu, Jian; Thomsen, Mette Hedegaard; Thomsen, Anne Belinda

    2010-01-01

    Hydrothermal pretreatment on raw corn stover (RCS) with a loop reactor was investigated at 195 °C for different times varying between 10 min and 30 min. After pretreatment, the slurry was separated into water-insoluble solid (WIS) and liquid phase. Glucan and xylan were found in the both phases...

  7. Fuel ethanol production from wet oxidised corn stover by S. cerevisiae

    DEFF Research Database (Denmark)

    Qiang, zhang; Thomsen, Anne Belinda

    2012-01-01

    In order to find out appropriate process for ethanol production from corn stover, wet oxidation (195°C, 15 minutes) and simultaneous saccharification and fermentation (SSF) was carried out to produce ethanol. The results showed that the cellulose recovery of 92.9% and the hemicellulose recovery of...

  8. Investigation of acetic acid-catalyzed hydrothermal pretreatment on corn stover

    DEFF Research Database (Denmark)

    Xu, Jian; Thomsen, Mette Hedegaard; Thomsen, Anne Belinda

    2010-01-01

    Acetic acid (AA)-catalyzed liquid hot water (LHW) pretreatments on raw corn stover (RCS) were carried out at 195 °C at 15 min with the acetic acid concentrations between 0 and 400 g/kg RCS. After pretreatment, the liquor fractions and water-insoluble solids (WIS) were collected separately and...

  9. Unique and Interactive Effects of Empathy and Social Status on Involvement in Bullying

    Science.gov (United States)

    Caravita, Simona C. S.; Di Blasio, Paola; Salmivalli, Christina

    2009-01-01

    This study investigated the relationships between affective and cognitive empathy, social preference and perceived popularity, and involvement in bullying situations by bullying others or defending the victimized children. The participants were 266 primary and 195 secondary school students. Affective and cognitive empathy, as well as the status…

  10. Stress, Social Support, and Health among College Students after September 11, 2001

    Science.gov (United States)

    MacGeorge, Erina L.; Samter, Wendy; Feng, Bo; Gillihan, Seth J.; Graves, Angela R.

    2004-01-01

    The current study was designed to examine associations among stress due to the 9/11 terrorist attacks, social support, and health (depression and physical illness) in a college student sample. In December 2001, students from Eastern universities (N = 666; 482 women, 184 men; average age 19.5 yrs.) completed measures of stress from terrorism…

  11. Svatý Kopeček u Olomouce. Poutní kostel Navštívení Panny Marie

    Czech Academy of Sciences Publication Activity Database

    Mádl, Martin

    Praha: Artefactum, 2013 - (Mádl, M.), s. 195-240 ISBN 978-80-86890-60-9 R&D Projects: GA ČR GA408/09/0949 Institutional support: RVO:68378033 Keywords : ceiling paintings * Martin Antonín Lublinský * Giacomo Tencalla * Johann Steger Subject RIV: AL - Art, Architecture, Cultural Heritage

  12. Large boson number IBM calculations and their relationship to the Bohr model

    Czech Academy of Sciences Publication Activity Database

    Thiamová, Gabriela; Rowe, D. J.

    2009-01-01

    Roč. 41, č. 2 (2009), s. 189-195. ISSN 1434-6001 Institutional research plan: CEZ:AV0Z10480505 Keywords : COLLECTIVE NUCLEAR-STATES * O(6) DESCRIPTION * LIMIT Subject RIV: BE - Theoretical Physics Impact factor: 1.968, year: 2009

  13. 76 FR 73570 - Pipeline Safety: Miscellaneous Changes to Pipeline Safety Regulations

    Science.gov (United States)

    2011-11-29

    ... transported in accordance with the American Petroleum Institute's (API) Recommended Practices 5L1. An... ANSI/API Recommended Practice 651 to show the correct source and reference material as Sec. Sec. 195... published in the Federal Register on April 11, 2000 (70 FR 19477), or visit http://dms.dot.gov . FOR...

  14. Study of the lipidic and humic fractions from organic wastes before and after the composting process

    OpenAIRE

    García Izquierdo, Carlos; Hernández Fernández Muñoz, María Teresa; Costa, F.; Río Andrade, José Carlos del

    1989-01-01

    10 pages, 3 figures, 5 tables, 16 references. 1) Centro de Edafología y Biología Aplicada del Segura, Apartado 195, 30080, Murcia (Spain) 2) Instituto de Recursos Naturales y Agrobiología, Apartado 1052, 41080 Sevilla (Spain)

  15. Using Theory to Tell It Like It Is

    Science.gov (United States)

    Waterman, Stephanie J.

    2013-01-01

    In this article a graduate level diversity course, "Diversity & Equity in Higher Education" that is based on Johnson's (2005) "Privilege, Power, and Difference," and Critical Race Theory (CRT) (Tate in "Rev Res Educ" 22:195-247, 1997) is described. Johnson's concepts, such as paths of least resistance,…

  16. Measurement Tools and Target Symptoms/Skills Used to Assess Treatment Response for Individuals with Autism Spectrum Disorder

    Science.gov (United States)

    Bolte, Erin Elizabeth; Diehl, Joshua John

    2013-01-01

    This study examined the measurement tools and target symptoms/skills used to assess treatment response during Autism Spectrum Disorder (ASD) intervention trials from 2001 through 2010. Data from 195 prospective trials were analyzed. There were 289 unique measurement tools, of which 61.6% were used only once, and 20.8 % were investigator-designed.…

  17. Conveying Campus Sexual Misconduct Policy Information to College and University Students: Results from a 7-Campus Study

    Science.gov (United States)

    Potter, S. J.; Edwards, K. M.; Banyard, V. L.; Stapleton, J. G.; Demers, J. M.; Moynihan, M. M.

    2016-01-01

    Objective: To examine the efficacy of different methods (ie, in-class policy reading; in-class policy reading and discussion; no reading or discussion) to deliver campus sexual misconduct policy information to students on 7 campuses. Participants: A total of 1,195 participants at 7 colleges and universities participated in the study from August to…

  18. 77 FR 21981 - Economic Impact Policy

    Science.gov (United States)

    2012-04-12

    ... From the Federal Register Online via the Government Publishing Office ] EXPORT-IMPORT BANK OF THE UNITED STATES Economic Impact Policy This notice is to inform the public that the Export-Import Bank of the United States has received an application for a $19.5 million long- term guarantee to support...

  19. Translating Greek Drama: Three Czech Electras

    Czech Academy of Sciences Publication Activity Database

    Sarkissian, Alena

    Cambridge : Cambridge Scholars Press, 2007 - (Šípová, P.; Sarkissian, A.), s. 183-195 ISBN 978-1-84718-318-7 Institutional research plan: CEZ:AV0Z90090514 Keywords : drama * translation * theatre Subject RIV: AB - History

  20. Proof of Causation in Medical Malpractice Cases in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Doležal, Adam; Doležal, Tomáš

    2015-01-01

    Roč. 5, č. 3 (2015), s. 195-205. ISSN 1805-8396 R&D Projects: GA ČR GAP408/12/2574 Institutional support: RVO:68378122 Keywords : causation * liability * medical malpractice cases Subject RIV: AG - Legal Sciences