WorldWideScience

Sample records for astatine 195

  1. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  2. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-09-15

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Discovery of the astatine, radon, francium, and radium isotopes

    Science.gov (United States)

    Fry, C.; Thoennessen, M.

    2013-09-01

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration

    2011-11-30

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  6. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Science.gov (United States)

    Uusitalo, J.; Jakobsson, U.

    2011-11-01

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  7. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy.

    Science.gov (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  9. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others

    2015-10-15

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  10. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Science.gov (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.

    2015-10-01

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  11. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  12. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  13. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  14. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  15. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  16. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  17. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  18. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study

    Science.gov (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi

    2018-01-01

    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).

  19. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  20. 49 CFR 195.111 - Fracture propagation.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Fracture propagation. 195.111 Section 195.111... PIPELINE Design Requirements § 195.111 Fracture propagation. A carbon dioxide pipeline system must be designed to mitigate the effects of fracture propagation. [Amdt. 195-45, 56 FR 26926, June 12, 1991] ...

  1. 32 CFR 195.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 195.5 Section 195.5 National... RIGHTS ACT OF 1964 § 195.5 Responsibilities. (a) The Assistant Secretary of Defense (Manpower) shall be...) to fulfill this responsibility in accordance with § 195.2(b). (c) The Assistant Secretary of Defense...

  2. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  3. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  4. 49 CFR 195.224 - Welding: Weather.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Welding: Weather. 195.224 Section 195.224 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... PIPELINE Construction § 195.224 Welding: Weather. Welding must be protected from weather conditions that...

  5. 49 CFR 195.420 - Valve maintenance.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Valve maintenance. 195.420 Section 195.420 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... PIPELINE Operation and Maintenance § 195.420 Valve maintenance. (a) Each operator shall maintain each valve...

  6. 49 CFR 195.110 - External loads.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false External loads. 195.110 Section 195.110 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... PIPELINE Design Requirements § 195.110 External loads. (a) Anticipated external loads (e.g.), earthquakes...

  7. 29 CFR 19.5 - Certification.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Certification. 19.5 Section 19.5 Labor Office of the Secretary of Labor RIGHT TO FINANCIAL PRIVACY ACT § 19.5 Certification. Prior to obtaining the requested records pursuant to a formal written request, a senior official designated by the head of the requesting...

  8. 49 CFR 195.50 - Reporting accidents.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Reporting accidents. 195.50 Section 195.50 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... PIPELINE Annual, Accident, and Safety-Related Condition Reporting § 195.50 Reporting accidents. An accident...

  9. 49 CFR 195.102 - Design temperature.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Design temperature. 195.102 Section 195.102... PIPELINE Design Requirements § 195.102 Design temperature. (a) Material for components of the system must be chosen for the temperature environment in which the components will be used so that the pipeline...

  10. 49 CFR 195.440 - Public awareness.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Public awareness. 195.440 Section 195.440 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... PIPELINE Operation and Maintenance § 195.440 Public awareness. (a) Each pipeline operator must develop and...

  11. 49 CFR 195.214 - Welding procedures.

    Science.gov (United States)

    2010-10-01

    ... accordance with welding procedures qualified under Section 5 of API 1104 or Section IX of the ASME Boiler and Pressure Vessel Code (incorporated by reference, see § 195.3) . The quality of the test welds used to... 49 Transportation 3 2010-10-01 2010-10-01 false Welding procedures. 195.214 Section 195.214...

  12. 49 CFR 195.434 - Signs.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Signs. 195.434 Section 195.434 Transportation... PIPELINE Operation and Maintenance § 195.434 Signs. Each operator must maintain signs visible to the public around each pumping station and breakout tank area. Each sign must contain the name of the operator and a...

  13. Dicty_cDB: SFL195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFL195 (Link to dictyBase) - - - Contig-U16317-1 SFL195P (Link to Original site) SF...L195F 549 SFL195Z 612 SFL195P 1161 - - Show SFL195 Library SF (Link to library) Clone ID SF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SF/SFL1-D/SFL195Q.Seq.d/ Representative seq. ID SF...L195P (Link to Original site) Representative DNA sequence >SFL195 (SFL195Q) /CSM/SF/SFL1-D/SFL...ttlqt ilk--- ---xkfqellixdfmvlxkvwvhqkl*vefivqt*nlatlyslxhylsfkikmltsslvw ic*svxksfwi*ievyyklqmkrlnsfmkki*rr

  14. 49 CFR 195.118 - Fittings.

    Science.gov (United States)

    2010-10-01

    ... PIPELINE Design Requirements § 195.118 Fittings. (a) Butt-welding type fittings must meet the marking, end...) There may not be any buckles, dents, cracks, gouges, or other defects in the fitting that might reduce...

  15. Nuclear Data Sheets for A = 195

    Science.gov (United States)

    Huang, Xiaolong; Kang, Mengxiao

    2014-09-01

    Experimental structure and decay data for all nuclides with mass number A=195 (Re, Os, Ir, Pt, Au, Hg, Tl, Pb, Bi, Po, At, Rn) have been revised, updated, and incorporated into the ENSDF data file. All literature available by March 2014 has been considered. This evaluation supersedes the previous one for this mass chain (Zhou Chunmei, Nuclear Data Sheets 86, 645 (1999), 1999Zh11). The detailed level schemes, decay schemes, experimental reaction and decay data on which they are based are summarized and presented here. References, Jπ arguments, and comments are given in the text. No excited state data are yet available for 195Re and 195Rn. The adopted levels for 195At are firstly presented in this evaluation. In addition, Q values have been updated based on 2012Wa38.

  16. Nuclear Data Sheets for A = 195

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Xiaolong; Kang, Mengxiao

    2014-09-15

    Experimental structure and decay data for all nuclides with mass number A=195 (Re, Os, Ir, Pt, Au, Hg, Tl, Pb, Bi, Po, At, Rn) have been revised, updated, and incorporated into the ENSDF data file. All literature available by March 2014 has been considered. This evaluation supersedes the previous one for this mass chain (Zhou Chunmei, Nuclear Data Sheets 86, 645 (1999), 1999Zh11). The detailed level schemes, decay schemes, experimental reaction and decay data on which they are based are summarized and presented here. References, Jπ arguments, and comments are given in the text. No excited state data are yet available for {sup 195}Re and {sup 195}Rn. The adopted levels for {sup 195}At are firstly presented in this evaluation. In addition, Q values have been updated based on 2012Wa38.

  17. 40 CFR 68.195 - Required corrections.

    Science.gov (United States)

    2010-07-01

    ...) CHEMICAL ACCIDENT PREVENTION PROVISIONS Risk Management Plan § 68.195 Required corrections. The owner or... accident history information—For any accidental release meeting the five-year accident history reporting...

  18. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  19. Dicty_cDB: SLC195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s*ysfriigsslsklnwcry*ir lyrswyvcnscs*kgck*krlfrsy**sy*ilc*i*cnfkiyal*lnffkkkkknfiyis Frame C: ---VLMYGPPGTGKTLC...SL (Link to library) SLC195 (Link to dictyBase) - - - Contig-U13989-1 SLC195Z (Link... to Original site) - - SLC195Z 714 - - - - Show SLC195 Library SL (Link to library) Clone ID SLC195 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC1-D/SLC195Q.Seq.d/ Representative seq. ID SLC19...5Z (Link to Original site) Representative DNA sequence >SLC195 (SLC195Q) /CSM/SL/SLC1-D/SLC195Q.Seq.d/ XXXXX

  20. Dicty_cDB: SLB195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB195 (Link to dictyBase) - - - Contig-U16455-1 SLB195Z (Link... to Original site) - - SLB195Z 709 - - - - Show SLB195 Library SL (Link to library) Clone ID SLB195 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLB1-D/SLB195Q.Seq.d/ Representative seq. ID SLB19...5Z (Link to Original site) Representative DNA sequence >SLB195 (SLB195Q) /CSM/SL/SLB1-D/SLB195Q.Seq.d/ XXXXX... ) Dictyostelium discoideum slug cDNA, clone SLE193. 1298 0.0 1 ( AU034146 ) Dictyostelium discoideum slug cDNA, clone SLB

  1. 49 CFR 195.114 - Used pipe.

    Science.gov (United States)

    2010-10-01

    ... strength or the wall thickness is not known, it is determined in accordance with § 195.106 (b) or (c) as appropriate. (b) There may not be any: (1) Buckles; (2) Cracks, grooves, gouges, dents, or other surface... was manufactured; or (3) Corroded areas where the remaining wall thickness is less than the minimum...

  2. 34 CFR 300.195 - Decision.

    Science.gov (United States)

    2010-07-01

    ... REHABILITATIVE SERVICES, DEPARTMENT OF EDUCATION ASSISTANCE TO STATES FOR THE EDUCATION OF CHILDREN WITH DISABILITIES State Eligibility By-Pass for Children in Private Schools § 300.195 Decision. (a) The designee who... 30 days of the date the party receives the designee's decision. (c) The Secretary adopts, reverses...

  3. 40 CFR 270.195 - When will my RAP expire?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false When will my RAP expire? 270.195 Section 270.195 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES...) How May My Rap Be Modified, Revoked and Reissued, Or Terminated? § 270.195 When will my RAP expire...

  4. 49 CFR 195.216 - Welding: Miter joints.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Welding: Miter joints. 195.216 Section 195.216 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... PIPELINE Construction § 195.216 Welding: Miter joints. A miter joint is not permitted (not including...

  5. 49 CFR 195.226 - Welding: Arc burns.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Welding: Arc burns. 195.226 Section 195.226 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... PIPELINE Construction § 195.226 Welding: Arc burns. (a) Each arc burn must be repaired. (b) An arc burn may...

  6. 49 CFR 195.208 - Welding of supports and braces.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Welding of supports and braces. 195.208 Section 195.208 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS... HAZARDOUS LIQUIDS BY PIPELINE Construction § 195.208 Welding of supports and braces. Supports or braces may...

  7. 49 CFR 195.222 - Welders: Qualification of welders.

    Science.gov (United States)

    2010-10-01

    ... be qualified in accordance with section 6 of API 1104 (incorporated by reference, see § 195.3) or section IX of the ASME Boiler and Pressure Vessel Code, (incorporated by reference, see § 195.3) except... 49 Transportation 3 2010-10-01 2010-10-01 false Welders: Qualification of welders. 195.222 Section...

  8. 49 CFR 195.446 - Control room management.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Control room management. 195.446 Section 195.446... PIPELINE Operation and Maintenance § 195.446 Control room management. (a) General. This section applies to... written control room management procedures that implement the requirements of this section. The procedures...

  9. 46 CFR 154.195 - Aluminum cargo tank: Steel enclosure.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Aluminum cargo tank: Steel enclosure. 154.195 Section 154.195 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS... Equipment Hull Structure § 154.195 Aluminum cargo tank: Steel enclosure. (a) An aluminum cargo tank and its...

  10. 49 CFR 572.195 - Thorax with arm.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 7 2010-10-01 2010-10-01 false Thorax with arm. 572.195 Section 572.195... Dummy, Small Adult Female § 572.195 Thorax with arm. (a) The thorax is part of the upper torso assembly shown in drawing 180-3000. For the thorax with arm impact test, the dummy is tested as a complete...

  11. Dicty_cDB: CHP195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP195 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) CHP195F 138 - - - - - - Show CHP195 Library CH (Link to library) Clone ID CHP195 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...qilkvstnk**IKNYYVNRVYEIIIIINICTYKKK--- Translated Amino Acid sequence (All Frames) Frame A: tvgllvfsnt*gink*...iin*kllck*sl*nnnynkymyi*kk--- Frame B: llaywffqilkvstnk**IKNYYVNRVYEIIIIINICTYKKK--- Frame C: cwptgffkylryqq

  12. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.

    2017-04-01

    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  13. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination.

    Science.gov (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick

    2007-01-01

    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  14. 46 CFR 195.11-20 - Marking and label plate.

    Science.gov (United States)

    2010-10-01

    ... plate. (a) All vans shall be provided with a label plate stating light weight, gross weight, and power requirements where applicable. (b) For vans subject to inspection label plates shall provide space for the date... 46 Shipping 7 2010-10-01 2010-10-01 false Marking and label plate. 195.11-20 Section 195.11-20...

  15. 49 CFR 195.207 - Transportation of pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Transportation of pipe. 195.207 Section 195.207 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY...

  16. 49 CFR 195.52 - Telephonic notice of certain accidents.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Telephonic notice of certain accidents. 195.52... TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Annual, Accident, and Safety-Related Condition Reporting § 195.52 Telephonic notice of certain accidents. (a) At the earliest practicable moment following discovery of a...

  17. 49 CFR 195.3 - Incorporation by reference.

    Science.gov (United States)

    2010-10-01

    ....307(e). (7) 2007 ASME Boiler & Pressure Vessel Code, Section IX: “Qualification Standard for Welding... & Pressure Vessel Code, Section VIII, Division 1 “Rules for Construction of Pressure Vessels” (2007 edition, July 1, 2007) § 195.124; 195.307(e). (6) 2007 ASME Boiler & Pressure Vessel Code, Section VIII...

  18. 40 CFR 792.195 - Retention of records.

    Science.gov (United States)

    2010-07-01

    ... ACT (CONTINUED) GOOD LABORATORY PRACTICE STANDARDS Records and Reports § 792.195 Retention of records... retained only as long as the quality of the preparation affords evaluation. Specimens obtained from...

  19. Preclinical imaging characteristics and quantification of Platinum-195m SPECT

    Energy Technology Data Exchange (ETDEWEB)

    Aalbersberg, E.A.; Wit-van der Veen, B.J. de; Vegt, E.; Vogel, Wouter V. [The Netherlands Cancer Institute (NKI-AVL), Department of Nuclear Medicine, Amsterdam (Netherlands); Zwaagstra, O.; Codee-van der Schilden, K. [Nuclear Research and Consultancy Group (NRG), Petten (Netherlands)

    2017-08-15

    In vivo biodistribution imaging of platinum-based compounds may allow better patient selection for treatment with chemo(radio)therapy. Radiolabeling with Platinum-195m ({sup 195m}Pt) allows SPECT imaging, without altering the chemical structure or biological activity of the compound. We have assessed the feasibility of {sup 195m}Pt SPECT imaging in mice, with the aim to determine the image quality and accuracy of quantification for current preclinical imaging equipment. Enriched (>96%) {sup 194}Pt was irradiated in the High Flux Reactor (HFR) in Petten, The Netherlands (NRG). A 0.05 M HCl {sup 195m}Pt-solution with a specific activity of 33 MBq/mg was obtained. Image quality was assessed for the NanoSPECT/CT (Bioscan Inc., Washington DC, USA) and U-SPECT{sup +}/CT (MILabs BV, Utrecht, the Netherlands) scanners. A radioactivity-filled rod phantom (rod diameter 0.85-1.7 mm) filled with 1 MBq {sup 195m}Pt was scanned with different acquisition durations (10-120 min). Four healthy mice were injected intravenously with 3-4 MBq {sup 195m}Pt. Mouse images were acquired with the NanoSPECT for 120 min at 0, 2, 4, or 24 h after injection. Organs were delineated to quantify {sup 195m}Pt concentrations. Immediately after scanning, the mice were sacrificed, and the platinum concentration was determined in organs using a gamma counter and graphite furnace - atomic absorption spectroscopy (GF-AAS) as reference standards. A 30-min acquisition of the phantom provided visually adequate image quality for both scanners. The smallest visible rods were 0.95 mm in diameter on the NanoSPECT and 0.85 mm in diameter on the U-SPECT{sup +}. The image quality in mice was visually adequate. Uptake was seen in the kidneys with excretion to the bladder, and in the liver, blood, and intestine. No uptake was seen in the brain. The Spearman correlation between SPECT and gamma counter was 0.92, between SPECT and GF-AAS it was 0.84, and between GF-AAS and gamma counter it was0.97 (all p < 0

  20. Synthesis of ( sup 195m Pt)-tetraplatin

    Energy Technology Data Exchange (ETDEWEB)

    Wyrick, S.D. (North Carolina Univ., Chapel Hill, NC (USA). School of Pharmacy); Chaney, S.G. (North Carolina Univ., Chapel Hill, NC (USA). School of Medicine)

    1990-07-01

    (Trans d,1)-1,2-diaminocyclohexanetetrachloroplatinum(IV) (tetraplatin) is a second generation platinum antitumor agent which exhibits less toxicity than cisplatin and is effective in cell lines with acquired resistance to cisplatin. We previously reported the synthesis of tritium labelled tetraplatin which was utilized in both tissue culture and in vivo studies. Loss of the labelled diaminocyclohexane carrier moiety during the in vivo studies necessitated the synthesis of ({sup 195m}Pt)-tetraplatin from ({sup 195m}Pt)-potassium hexachloroplatinate as described herein. (author).

  1. A new high-spin isomer in {sup 195}Bi

    Energy Technology Data Exchange (ETDEWEB)

    Roy, T.; Mukherjee, G.; Rana, T.K.; Bhattacharya, Soumik; Asgar, Md.A.; Bhattacharya, C.; Bhattacharya, S.; Bhattacharyya, S.; Pai, H. [Variable Energy Cyclotron Centre, Kolkata (India); Madhavan, N.; Bala, I.; Gehlot, J.; Gurjar, R.K.; Jhingan, A.; Kumar, R.; Muralithar, S.; Nath, S.; Singh, R.P.; Varughese, T. [Inter University Acclerator Centre, New Delhi (India); Basu, K.; Bhattacharjee, S.S.; Ghugre, S.S.; Raut, R.; Sinha, A.K. [UGC-DAE-CSR Kolkata Centre, Kolkata (India); Palit, R. [Tata Institute of Fundamental Research, Department of Nuclear and Atomic Physics, Mumbai (India)

    2015-11-15

    A new high-spin isomer has been identified in {sup 195}Bi at the focal plane of the HYbrid Recoil mass Analyser (HYRA) used in the gas-filled mode. The fusion evaporation reactions {sup 169}Tm ({sup 30}Si, x n) {sup 193,} {sup 195}Bi were used with the beam energies on targets of 168 and 146MeV for 6n and 4n channels, respectively. The evaporation residues, separated from the fission fragments, and their decays were detected at the focal plane of HYRA using MWPC, Si-Pad and clover HPGe detectors. The half-life of the new isomer in {sup 195}Bi has been measured to be 1.6(1) μs. The configuration of the new isomer has been proposed and compared with the other isomers in this region. The Total Routhian Surface (TRS) calculations for the three-quasiparticle configurations corresponding to the new isomer suggest an oblate deformation for this isomeric state. The same calculations for different configurations in {sup 195}Bi and for the even-even {sup 194}Pb core indicate that the proton i{sub 13/2} orbital has a large shape driving effect towards oblate shape in these nuclei. (orig.)

  2. 49 CFR 195.57 - Filing offshore pipeline condition reports.

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Annual, Accident, and Safety-Related Condition Reporting § 195.57... inspected. (5) Length and date of installation of each exposed pipeline segment, and location; including, if... tract. (6) Length and date of installation of each pipeline segment, if different from a pipeline...

  3. Phenotype abnormality: 195 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 195 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u701i decreased number... of seminal root in organ named whole plant ... whole plant ... present in fewer numbers in organism ... seminal root ...

  4. A new high-spin isomer in 195Bi

    Science.gov (United States)

    Roy, T.; Mukherjee, G.; Madhavan, N.; Rana, T. K.; Bhattacharya, Soumik; Asgar, Md. A.; Bala, I.; Basu, K.; Bhattacharjee, S. S.; Bhattacharya, C.; Bhattacharya, S.; Bhattacharyya, S.; Gehlot, J.; Ghugre, S. S.; Gurjar, R. K.; Jhingan, A.; Kumar, R.; Muralithar, S.; Nath, S.; Pai, H.; Palit, R.; Raut, R.; Singh, R. P.; Sinha, A. K.; Varughese, T.

    2015-11-01

    A new high-spin isomer has been identified in 195Bi at the focal plane of the HYbrid Recoil mass Analyser (HYRA) used in the gas-filled mode. The fusion evaporation reactions 169Tm (30Si, x n) 193, 195Bi were used with the beam energies on targets of 168 and 146MeV for 6n and 4n channels, respectively. The evaporation residues, separated from the fission fragments, and their decays were detected at the focal plane of HYRA using MWPC, Si-Pad and clover HPGe detectors. The half-life of the new isomer in 195Bi has been measured to be 1.6(1)μs. The configuration of the new isomer has been proposed and compared with the other isomers in this region. The Total Routhian Surface (TRS) calculations for the three-quasiparticle configurations corresponding to the new isomer suggest an oblate deformation for this isomeric state. The same calculations for different configurations in 195Bi and for the even-even 194Pb core indicate that the proton i 13/2 orbital has a large shape driving effect towards oblate shape in these nuclei.

  5. Phenotype-gene: 195 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available uence of brassinosteroid for AT4G33430 ... decreased sensitivity toward under influence... 195 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1193i decreased sensitivity toward under infl

  6. 27 CFR 46.195 - Floor stocks requirements.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Floor stocks requirements... CIGARETTE PAPERS AND TUBES Floor Stocks Tax on Certain Tobacco Products, Cigarette Papers, and Cigarette Tubes Held for Sale on April 1, 2009 General § 46.195 Floor stocks requirements. (a) Take inventory. The...

  7. 37 CFR 2.195 - Receipt of trademark correspondence.

    Science.gov (United States)

    2010-07-01

    ..., DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES General Information and Correspondence in Trademark Cases § 2.195 Receipt of trademark correspondence. (a) Date of receipt and Express Mail date of... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Receipt of trademark...

  8. 14 CFR 61.195 - Flight instructor limitations and qualifications.

    Science.gov (United States)

    2010-01-01

    ... Instructors Other than Flight Instructors With a Sport Pilot Rating § 61.195 Flight instructor limitations and... instructor certificate with the applicable category and class rating; and (2) If appropriate, a type rating... instrument rating, a type rating not limited to VFR, or the instrument training required for commercial pilot...

  9. 21 CFR 1271.195 - Environmental control and monitoring.

    Science.gov (United States)

    2010-04-01

    ... Section 1271.195 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... expected to cause contamination or cross-contamination of HCT/Ps or equipment, or accidental exposure of... activities or systems: (1) Temperature and humidity controls; (2) Ventilation and air filtration; (3...

  10. 49 CFR 195.557 - Which pipelines must have coating for external corrosion control?

    Science.gov (United States)

    2010-10-01

    ... corrosion control? 195.557 Section 195.557 Transportation Other Regulations Relating to Transportation...) PIPELINE SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Corrosion Control § 195.557 Which pipelines must have coating for external corrosion control? Except bottoms of aboveground breakout tanks, each...

  11. 49 CFR 195.559 - What coating material may I use for external corrosion control?

    Science.gov (United States)

    2010-10-01

    ... corrosion control? 195.559 Section 195.559 Transportation Other Regulations Relating to Transportation...) PIPELINE SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Corrosion Control § 195.559 What coating material may I use for external corrosion control? Coating material for external corrosion control under...

  12. 49 CFR 195.561 - When must I inspect pipe coating used for external corrosion control?

    Science.gov (United States)

    2010-10-01

    ... corrosion control? 195.561 Section 195.561 Transportation Other Regulations Relating to Transportation...) PIPELINE SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Corrosion Control § 195.561 When must I inspect pipe coating used for external corrosion control? (a) You must inspect all external pipe coating...

  13. Paediatric MRCP: 10 year experience with 195 patients.

    Science.gov (United States)

    Philpott, Cristina; Rosenbaum, Jeremy; Moon, Anna; Bekhit, Elhamy; Kumbla, Surekha

    2013-04-01

    Magnetic resonance cholangiopancreatography (MRCP) has now largely substituted endoscopic retrograde cholangiopancreatography (ERCP) in evaluating the biliary tree in adults giving its high sensitivity and specificity. Whilst smaller series published to date suggests this may be extrapolated to the paediatric population, its routine use in children is still debatable. The aim of our study is therefore to review the utility of MRCP in a large series of paediatric patients. All MRCPs performed in our institution were examined for diagnostic quality, spectrum of diagnoses and correlation with direct cholangiography (DC) were available. Correlation with histopathology results and final clinical diagnosis was made in the subset of patients in whom a MRCP had been performed to evaluate the presence of primary sclerosing cholangitis (PSC). There were 245 MRCP examinations performed on 195 patients and 219 were diagnostic. There was 100% MRCP and DC concordance in the 16 cases where both had been performed. MRCP yielded a sensitivity of 89% in the subset of patients with PSC. MRCP was a valuable diagnostic tool in our paediatric population. Image quality is sufficiently diagnostic and shows good correlation with clinical diagnosis in conditions encountered in our population, including primary sclerosing cholangitis, post liver transplant biliary strictures, post surgical complications, dilated common bile ducts, choledochal cysts, cholelithiasis and choledocholithaisis. Copyright © 2013. Published by Elsevier Ireland Ltd.

  14. 49 CFR 195.579 - What must I do to mitigate internal corrosion?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false What must I do to mitigate internal corrosion? 195... SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Corrosion Control § 195.579 What must I do to mitigate internal corrosion? (a) General. If you transport any hazardous liquid or carbon dioxide that...

  15. 46 CFR 195.07-5 - Ocean, coastwise, or Great Lakes service.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Ocean, coastwise, or Great Lakes service. 195.07-5 Section 195.07-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH... Ocean, coastwise, or Great Lakes service. (a) Vessels in ocean, coastwise, or Great Lakes service shall...

  16. 27 CFR 44.195 - To Government vessels and aircraft for consumption as supplies.

    Science.gov (United States)

    2010-04-01

    ... aircraft for consumption as supplies. 44.195 Section 44.195 Alcohol, Tobacco Products and Firearms ALCOHOL... TOBACCO PRODUCTS AND CIGARETTE PAPERS AND TUBES, WITHOUT PAYMENT OF TAX, OR WITH DRAWBACK OF TAX Removal of Shipments of Tobacco Products and Cigarette Papers and Tubes by Manufacturers and Export Warehouse...

  17. 28 CFR 19.5 - Report to the Office of Juvenile Justice and Delinquency Prevention.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Report to the Office of Juvenile Justice and Delinquency Prevention. 19.5 Section 19.5 Judicial Administration DEPARTMENT OF JUSTICE USE OF... Justice and Delinquency Prevention. DOJ will compile and submit to OJJDP, by June 30, 1987, a consolidated...

  18. 49 CFR 173.195 - Hydrogen cyanide, anhydrous, stabilized (hydrocyanic acid, aqueous solution).

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Hydrogen cyanide, anhydrous, stabilized (hydrocyanic acid, aqueous solution). 173.195 Section 173.195 Transportation Other Regulations Relating to... (hydrocyanic acid, aqueous solution). (a) Hydrogen cyanide, anhydrous, stabilized, must be packed in...

  19. 49 CFR 195.4 - Compatibility necessary for transportation of hazardous liquids or carbon dioxide.

    Science.gov (United States)

    2010-10-01

    ... hazardous liquids or carbon dioxide. 195.4 Section 195.4 Transportation Other Regulations Relating to... necessary for transportation of hazardous liquids or carbon dioxide. No person may transport any hazardous liquid or carbon dioxide unless the hazardous liquid or carbon dioxide is chemically compatible with both...

  20. MiR-195 enhances cardiomyocyte apoptosis induced by hypoxia/reoxygenation injury via downregulating c-myb.

    Science.gov (United States)

    Chen, C; Jia, K-Y; Zhang, H-L; Fu, J

    2016-08-01

    In this study, we explored the regulative effect of miR-195 on c-myb expression and also investigated the role of miR-195 and c-myb in cardiomyocyte apoptosis induced by hypoxia/reoxygenation (H/R) injury. QRT-PCR analysis was performed to measure mature miR-195 expression. H9c2 cells were transfected for miR-195 overexpression or knockdown or c-myb overexpression using Lipofectamine 2000. The cells were subjected to H/R treatment and following flow cytometric analysis of active caspase-3 or florescent study of reactive oxygen species (ROS) generation. The binding sites between miR-195 and 3'UTR of MYB mRNA were predicted using TargetScan 7.0. The binding sites were verified using dual luciferase assay and Western blot analysis. MiR-195 is significantly upregulated after H/R treatment in H9c2 cells. H/R injury induced active caspase-3 expression. However, the cells with miR-195 suppression had substantially lower ratio of cells with active caspase-3. MiR-195 can decrease c-myb protein expression. Dual luciferase assay verified two binding sites between miR-195 and 3'UTR of MYB mRNA. C-myb overexpression can suppress mitochondrial superoxide generation and cardiomyocyte apoptosis after H/R. MiR-195 is significantly increased due to H/R and can enhance cardiomyocyte apoptosis. MYB is a target gene of miR-195 in cardiomyocytes. The miR-195-MYB axis is involved in regulation of cardiomyocyte apoptosis induced by H/R.

  1. 36 CFR 223.195 - Procedures for identifying and marking unprocessed timber.

    Science.gov (United States)

    2010-07-01

    ... Conservation and Shortage Relief Act of 1990 Program § 223.195 Procedures for identifying and marking unprocessed timber. (a) Highway yellow paint. The use of highway yellow paint on unprocessed logs west of the... or placed in storage must be marked on both ends with yellow paint. (c) National Forest System logs...

  2. 14 CFR 121.195 - Airplanes: Turbine engine powered: Landing limitations: Destination airports.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplanes: Turbine engine powered: Landing...: CERTIFICATION AND OPERATIONS OPERATING REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Airplane Performance Operating Limitations § 121.195 Airplanes: Turbine engine powered: Landing limitations...

  3. 49 CFR 195.573 - What must I do to monitor external corrosion control?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false What must I do to monitor external corrosion... SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Corrosion Control § 195.573 What must I do to monitor external corrosion control? (a) Protected pipelines. You must do the following to determine...

  4. 49 CFR 195.583 - What must I do to monitor atmospheric corrosion control?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false What must I do to monitor atmospheric corrosion... SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Corrosion Control § 195.583 What must I do to monitor atmospheric corrosion control? (a) You must inspect each pipeline or portion of pipeline that is...

  5. 9 CFR 381.195 - Definitions; requirements for importation into the United States.

    Science.gov (United States)

    2010-01-01

    ... INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY... Imported Poultry Products § 381.195 Definitions; requirements for importation into the United States. (a) When used in this part, the following terms shall be construed to mean: (1) Import (Imported). To bring...

  6. 49 CFR 195.589 - What corrosion control information do I have to maintain?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false What corrosion control information do I have to... SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Corrosion Control § 195.589 What corrosion control... sufficient detail to demonstrate the adequacy of corrosion control measures or that corrosion requiring...

  7. 15 CFR 19.5 - How will Commerce entities add interest, penalty charges, and administrative costs to a Commerce...

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false How will Commerce entities add interest, penalty charges, and administrative costs to a Commerce debt? 19.5 Section 19.5 Commerce and Foreign Trade Office of the Secretary of Commerce COMMERCE DEBT COLLECTION Procedures To Collect Commerce...

  8. 25 CFR 900.195 - Does FTCA coverage extend to the contractor's health care practitioners providing services to...

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Does FTCA coverage extend to the contractor's health care practitioners providing services to private patients on a fee-for-services basis when such personnel (not the self-determination contractor) receive the fee? 900.195 Section 900.195 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR, AND...

  9. Downregulated miR-195 detected in preeclamptic placenta affects trophoblast cell invasion via modulating ActRIIA expression.

    Directory of Open Access Journals (Sweden)

    Yang Bai

    Full Text Available Preeclampsia (PE is a pregnancy-specific syndrome manifested by on-set of hypertension and proteinuria after 20 weeks of gestation. Abnormal placenta development has been generally accepted as initial cause of the disorder. Recently, miR-195 was found to be down-regulated in preeclamptic placentas compared with normal pregnant ones, indicating possible association of this small molecule with placental pathology of preeclampsia. By far the function of miR-195 in the development of placenta remains unknown.Bioinformatic assay predicted ActRIIA as one of the targets for miR-195. By using Real-time PCR, Western blotting and Dual Luciferase Assay, we validated that ActRIIA was the direct target of miR-195 in human trophoblast cells. Transwell insert invasion assay showed that miR-195 could promote cell invasion in trophoblast cell line, HTR8/SVneo cells, and the effect could be abrogated by overexpressed ActRIIA. In preeclamptic placenta tissues, pri-miR-195 and mature miR-195 expressions were down-regulated, whereas ActRIIA level appeared to be increased when compared with that in gestational-week-matched normal placentas.This is the first report on the function of miR-195 in human placental trophoblast cells which reveals an invasion-promoting effect of the small RNA via repressing ActRIIA. Aberrant expression of miR-195 may contribute to the occurrence of preeclampsia through interfering with Activin/Nodal signaling mediated by ActRIIA in human placenta.

  10. Global Transcriptomic and Proteomic Responses of Dehalococcoides ethenogenes Strain 195 to Fixed Nitrogen Limitation

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Patrick K. H. [University of California, Berkeley; Dill, Brian [ORNL; Louie, Tiffany S. [University of California, Berkeley; Shah, Manesh B [ORNL; Verberkmoes, Nathan C [ORNL; Andersen, Gary L. [Lawrence Berkeley National Laboratory (LBNL); Zinder, Stephen H. [Cornell University; Alvarez-Cohen, Lisa [Lawrence Berkeley National Laboratory (LBNL)

    2012-01-01

    Bacteria of the genus Dehalococcoides play an important role in the reductive dechlorination of chlorinated ethenes. A systems level approach was taken in this study to examine the global transcriptomic and proteomic responses of exponentially growing D. ethenogenes strain 195 to fixed nitrogen limitation (FNL) as dechlorination activity and cell yield both decrease during FNL. As expected, the nitrogen-fixing (nif) genes were differentially up-regulated in the transcriptome and proteome of strain 195 during FNL. Aside from the nif operon, a putative methylglyoxal synthase-encoding gene (DET1576), the product of which is predicted to catalyze the formation of the toxic electrophile methylglyoxal and implicated in the uncoupling of anabolism from catabolism in bacteria, was strongly up-regulated in the transcriptome and could potentially play a role in the observed growth inhibition during FNL. Carbon catabolism genes were generally down regulated in response to FNL and a number of transporters were differentially regulated in response to nitrogen limitation, with some playing apparent roles in nitrogen acquisition while others were associated with general stress responses. A number of genes related to the functions of nucleotide synthesis, replication, transcription, translation, and post-translational modifications were also differentially expressed. One gene coding for a putative reductive dehalogenase (DET1545) and a number coding for oxidoreductases, which have implications in energy generation and redox reactions, were also differentially regulated. Interestingly, most of the genes within the multiple integrated elements were not differentially expressed. Overall, this study elucidates the molecular responses of strain 195 to FNL and identifies differentially expressed genes that are potential biomarkers to evaluate environmental cellular nitrogen status.

  11. Sustainable syntrophic growth of Dehalococcoides ethenogenes strain 195 with Desulfovibrio vulgaris Hildenborough and Methanobacterium congolense: Global transcriptomic and proteomic analyses

    Energy Technology Data Exchange (ETDEWEB)

    Men, Y.; Feil, H.; VerBerkmoes, N.C.; Shah, M.B.; Johnson, D.R.; Lee, P.K.H; West, K.A.; Zinder, S.H.; Andersen, G.L.; Alvarez-Cohen, L.

    2011-03-01

    Dehalococcoides ethenogenes strain 195 (DE195) was grown in a sustainable syntrophic association with Desulfovibrio vulgaris Hildenborough (DVH) as a co-culture, as well as with DVH and the hydrogenotrophic methanogen Methanobacterium congolense (MC) as a tri-culture using lactate as the sole energy and carbon source. In the co- and tri-cultures, maximum dechlorination rates of DE195 were enhanced by approximately three times (11.0±0.01 lmol per day for the co-culture and 10.1±0.3 lmol per day for the tri-culture) compared with DE195 grown alone (3.8±0.1 lmol per day). Cell yield of DE195 was enhanced in the co-culture (9.0±0.5 x 107 cells per lmol Cl{sup -} released, compared with 6.8±0.9x 107 cells per lmol Cl{sup -} released for the pure culture), whereas no further enhancement was observed in the tri-culture (7.3±1.8x 107 cells per lmol Cl{sup -} released). The transcriptome of DE195 grown in the co-culture was analyzed using a whole-genome microarray targeting DE195, which detected 102 significantly up- or down-regulated genes compared with DE195 grown in isolation, whereas no significant transcriptomic difference was observed between co- and tri-cultures. Proteomic analysis showed that 120 proteins were differentially expressed in the co-culture compared with DE195 grown in isolation. Physiological, transcriptomic and proteomic results indicate that the robust growth of DE195 in co- and tri-cultures is because of the advantages associated with the capabilities of DVH to ferment lactate to provide H2 and acetate for growth, along with potential benefits from proton translocation, cobalamin-salvaging and amino acid biosynthesis, whereas MC in the tri-culture provided no significant additional benefits beyond those of DVH.

  12. Studies on UV/NaOCl/TiO2/Sep photocatalysed degradation of Reactive Red 195.

    Science.gov (United States)

    Karaoğlu, M Hamdi; Uğurlu, Mehmet

    2010-02-15

    The photocatalytic degradation of Reactive Red 195 (RR195) has been investigated in aqueous suspensions by using ultraviolet (UV), sodium hypochlorite (NaOCl) and TiO(2)/Sep nanoparticles together. To get the TiO(2)/Sep nanoparticle, the nanocrystalline TiO(2) anatase phase on sepiolite was obtained using a sufficient thermal treatment by gradually increasing the temperature from 300, 400 and 500 degrees C for 3h. Then, TiO(2)/Sep materials were characterized using different spectral and technical structural analyses with scanning electron microscopy (SEM) and X-ray diffraction (XRD). The influence of pH, catalyst amount, oxidant and initial dye concentration was investigated in all the experiments. Maximum colour and chemical oxygen demand (COD) removal were 99.9% and 78% respectively, at a dye concentration of 250 mg L(-1), NaOCl dosage of 50.37 mM, 0.1 g L(-1) weight of TiO(2)/Sep and pH of 5.45 in 3h. In addition, the pseudo-first order model was applied and r(2) values were noted from 0.92 to 0.99.

  13. The red-vine-leaf extract AS195 increases nitric oxide synthase-dependent nitric oxide generation and decreases oxidative stress in endothelial and red blood cells.

    Science.gov (United States)

    Grau, Marijke; Bölck, Birgit; Bizjak, Daniel Alexander; Stabenow, Christina Julia Annika; Bloch, Wilhelm

    2016-02-01

    The red-vine-leaf extract AS195 improves cutaneous oxygen supply and the microcirculation in patients suffering from chronic venous insufficiency. Regulation of blood flow was associated to nitric oxide synthase (NOS)-dependent NO (nitric oxide) production, and endothelial and red blood cells (RBC) have been shown to possess respective NOS isoforms. It was hypothesized that AS195 positively affects NOS activation in human umbilical vein endothelial cells (HUVECs) and RBC. Because patients with microvascular disorders show increased oxidative stress which limits NO bioavailability, it was further hypothesized that AS195 increases NO bioavailability by decreasing the content of reactive oxygen species (ROS) and increasing antioxidant capacity. Cultured HUVECs and RBCs from healthy volunteers were incubated with AS195 (100 μmol/L), tert-butylhydroperoxide (TBHP, 1 mmol/L) to induce oxidative stress and with both AS195 and TBHP. Endothelial and red blood cell-nitric oxide synthase (RBC-NOS) activation significantly increased after AS195 incubation. Nitrite concentration, a marker for NO production, increased in HUVEC but decreased in RBC after AS195 application possibly due to nitrite scavenging potential of flavonoids. S-nitrosylation of RBC cytoskeletal spectrins and RBC deformability were increased after AS195 incubation. TBHP-induced ROS were decreased by AS195, and antioxidative capacity was significantly increased in AS195-treated cells. TBHP also reduced RBC deformability, but reduction was attenuated by parallel incubation with AS195. Adhesion of HUVEC was also reduced after AS195 treatment. Red-vine-leaf extract AS195 increases NOS activation and decreases oxidative stress. Both mechanisms increase NO bioavailability, improve cell function, and may thus account for enhanced microcirculation in both health and disease.

  14. Alterations in erythrocyte survival parameters in rats after 19.5 days aboard Cosmos 782

    Science.gov (United States)

    Leon, H. A.; Serova, L. V.; Cummins, J.; Landaw, S. A.

    1978-01-01

    Rats were subjected to 19.5 days of weightless space flight aboard the Soviet biosatellite, Cosmos 782. Based on the output of CO-14, survival parameters of a cohort of erythrocytes labeled 15.5 days preflight were evaluated upon return from orbit. These were compared to vivarium control rats injected at the same time. Statistical evaluation indicates that all survival factors were altered by the space flight. The mean potential lifespan, which was 63.0 days in the control rats, was decreased to 59.0 days in the flight rats, and random hemolysis was increased three-fold in the flight rats. The measured size of the cohort was decreased, lending further support to the idea that hemolysis was accelerated during some portion of the flight. A number of factors that might be contributory to these changes are discussed, including forces associated with launch and reentry, atmospheric and environmental parameters, dietary factors, radiation, and weightlessness.

  15. 41 CFR 102-37.195 - Does a SASP have to have a donee in mind to request surplus property?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Does a SASP have to have...) Screening and Requesting Property § 102-37.195 Does a SASP have to have a donee in mind to request surplus property? Generally yes, you should have a firm requirement or an anticipated demand for any property that...

  16. 41 CFR 102-118.195 - What documents must a transportation service provider (TSP) send to receive payment for a...

    Science.gov (United States)

    2010-07-01

    ... transportation service provider (TSP) send to receive payment for a transportation billing? 102-118.195 Section... must a transportation service provider (TSP) send to receive payment for a transportation billing? For shipments bought on a TD, the TSP must submit an original properly certified GBL, PPGBL, or bill of lading...

  17. Characterization of Ce0.9Gd0.1O1.95 powders synthesized by spray drying

    DEFF Research Database (Denmark)

    Blennow Tullmar, Peter; Chen, Weiwu; Lundberg, Mats

    2009-01-01

    Ce0.9Gd0.1O1.95 powders were synthesized by spray drying and successive calcinations. The phase purity, BET surface area, and particle morphology of as-sprayed and calcined powders were characterized. After calcination above 300 °C, the powders were single phase and showed a BET surface area of 68...

  18. k195hw.m77t and k195hw.h77t: MGD77T data and header files for single-beam bathymetry data for field activity K-1-95-HW in in Hawaii from 06/14/1995 to 06/18/1995

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of the U.S. Geological Survey cruise K-1-95-HW. The cruise was conducted in Oahu,...

  19. The First Outbreak Caused by Acinetobacter baumannii ST208 and ST195 in China

    Directory of Open Access Journals (Sweden)

    Junyan Qu

    2016-01-01

    Full Text Available This study aimed to analyze the clinical characteristics of patients and molecular mechanisms of the first outbreak mainly caused by sequence types (STs 208 multidrug resistant (MDR Acinetobacter baumannii in China. A total of 10 clinical samples were collected from 5 patients who were involved in the outbreak. Bacterial identification and antibiotic sensitivity tests were performed by the VITEK-2 COMPACT automated system. MICs of tigecycline for clinical isolates were determined using broth microdilution. The clonal relatedness of A. baumannii clinical isolates in our local settings was determinated by pulsed-field gel electrophoresis (PFGE and multilocus sequence typing (MLST. A total of 7 A. baumannii strains were isolated and all were MDR strains; two of them were carbapenem-nonsusceptible strains. blaOXA-23 was the only acquired carbapenemase gene in the isolates. The isolates belonged to a single clonal pulsotype determined by PFGE and two sequences types (STs determined by MLST. The isolates belonged to the globally disseminated clonal complex 92, among which ST195 and ST208 were the most common sequence types (71.43% and 28.57%. The outbreak was successfully controlled by stringent infection control measures, especially improving the hand hygiene compliance and enhancing antimicrobial stewardship. In conclusion, this is the first description of an outbreak caused mainly by A. baumannii of ST208 in China. Infection control measures should be strengthened when infection outbreaks in hospital.

  20. Health Effects of Overweight and Obesity in 195 Countries over 25 Years.

    Science.gov (United States)

    Afshin, Ashkan; Forouzanfar, Mohammad H; Reitsma, Marissa B; Sur, Patrick; Estep, Kara; Lee, Alex; Marczak, Laurie; Mokdad, Ali H; Moradi-Lakeh, Maziar; Naghavi, Mohsen; Salama, Joseph S; Vos, Theo; Abate, Kalkidan H; Abbafati, Cristiana; Ahmed, Muktar B; Al-Aly, Ziyad; Alkerwi, Ala’a; Al-Raddadi, Rajaa; Amare, Azmeraw T; Amberbir, Alemayehu; Amegah, Adeladza K; Amini, Erfan; Amrock, Stephen M; Anjana, Ranjit M; Ärnlöv, Johan; Asayesh, Hamid; Banerjee, Amitava; Barac, Aleksandra; Baye, Estifanos; Bennett, Derrick A; Beyene, Addisu S; Biadgilign, Sibhatu; Biryukov, Stan; Bjertness, Espen; Boneya, Dube J; Campos-Nonato, Ismael; Carrero, Juan J; Cecilio, Pedro; Cercy, Kelly; Ciobanu, Liliana G; Cornaby, Leslie; Damtew, Solomon A; Dandona, Lalit; Dandona, Rakhi; Dharmaratne, Samath D; Duncan, Bruce B; Eshrati, Babak; Esteghamati, Alireza; Feigin, Valery L; Fernandes, João C; Fürst, Thomas; Gebrehiwot, Tsegaye T; Gold, Audra; Gona, Philimon N; Goto, Atsushi; Habtewold, Tesfa D; Hadush, Kokeb T; Hafezi-Nejad, Nima; Hay, Simon I; Horino, Masako; Islami, Farhad; Kamal, Ritul; Kasaeian, Amir; Katikireddi, Srinivasa V; Kengne, Andre P; Kesavachandran, Chandrasekharan N; Khader, Yousef S; Khang, Young-Ho; Khubchandani, Jagdish; Kim, Daniel; Kim, Yun J; Kinfu, Yohannes; Kosen, Soewarta; Ku, Tiffany; Defo, Barthelemy Kuate; Kumar, G Anil; Larson, Heidi J; Leinsalu, Mall; Liang, Xiaofeng; Lim, Stephen S; Liu, Patrick; Lopez, Alan D; Lozano, Rafael; Majeed, Azeem; Malekzadeh, Reza; Malta, Deborah C; Mazidi, Mohsen; McAlinden, Colm; McGarvey, Stephen T; Mengistu, Desalegn T; Mensah, George A; Mensink, Gert B M; Mezgebe, Haftay B; Mirrakhimov, Erkin M; Mueller, Ulrich O; Noubiap, Jean J; Obermeyer, Carla M; Ogbo, Felix A; Owolabi, Mayowa O; Patton, George C; Pourmalek, Farshad; Qorbani, Mostafa; Rafay, Anwar; Rai, Rajesh K; Ranabhat, Chhabi L; Reinig, Nikolas; Safiri, Saeid; Salomon, Joshua A; Sanabria, Juan R; Santos, Itamar S; Sartorius, Benn; Sawhney, Monika; Schmidhuber, Josef; Schutte, Aletta E; Schmidt, Maria I; Sepanlou, Sadaf G; Shamsizadeh, Moretza; Sheikhbahaei, Sara; Shin, Min-Jeong; Shiri, Rahman; Shiue, Ivy; Roba, Hirbo S; Silva, Diego A S; Silverberg, Jonathan I; Singh, Jasvinder A; Stranges, Saverio; Swaminathan, Soumya; Tabarés-Seisdedos, Rafael; Tadese, Fentaw; Tedla, Bemnet A; Tegegne, Balewgizie S; Terkawi, Abdullah S; Thakur, J S; Tonelli, Marcello; Topor-Madry, Roman; Tyrovolas, Stefanos; Ukwaja, Kingsley N; Uthman, Olalekan A; Vaezghasemi, Masoud; Vasankari, Tommi; Vlassov, Vasiliy V; Vollset, Stein E; Weiderpass, Elisabete; Werdecker, Andrea; Wesana, Joshua; Westerman, Ronny; Yano, Yuichiro; Yonemoto, Naohiro; Yonga, Gerald; Zaidi, Zoubida; Zenebe, Zerihun M; Zipkin, Ben; Murray, Christopher J L

    2017-07-06

    Although the rising pandemic of obesity has received major attention in many countries, the effects of this attention on trends and the disease burden of obesity remain uncertain. We analyzed data from 68.5 million persons to assess the trends in the prevalence of overweight and obesity among children and adults between 1980 and 2015. Using the Global Burden of Disease study data and methods, we also quantified the burden of disease related to high body-mass index (BMI), according to age, sex, cause, and BMI in 195 countries between 1990 and 2015. In 2015, a total of 107.7 million children and 603.7 million adults were obese. Since 1980, the prevalence of obesity has doubled in more than 70 countries and has continuously increased in most other countries. Although the prevalence of obesity among children has been lower than that among adults, the rate of increase in childhood obesity in many countries has been greater than the rate of increase in adult obesity. High BMI accounted for 4.0 million deaths globally, nearly 40% of which occurred in persons who were not obese. More than two thirds of deaths related to high BMI were due to cardiovascular disease. The disease burden related to high BMI has increased since 1990; however, the rate of this increase has been attenuated owing to decreases in underlying rates of death from cardiovascular disease. The rapid increase in the prevalence and disease burden of elevated BMI highlights the need for continued focus on surveillance of BMI and identification, implementation, and evaluation of evidence-based interventions to address this problem. (Funded by the Bill and Melinda Gates Foundation.).

  1. Palaeomagnetic and synchrotron analysis of >1.95 Ma fossil-bearing palaeokarst at Haasgat, South Africa

    Directory of Open Access Journals (Sweden)

    Andy I.R. Herries

    2014-03-01

    Full Text Available Palaeomagnetic analysis indicates that Haasgat, a fossil-bearing palaeocave in the Gauteng Province of South Africa, is dominated by reversed magnetic polarity in its oldest, deepest layers and normal polarity in the younger layers. The presence of in-situ Equus specimens suggests an age of less than ~2.3 Ma, while morphological analysis of faunal specimens from the ex-situ assemblage suggests an age greater than 1.8 Ma. Given this faunal age constraint, the older reversed polarity sections most likely date to the beginning of the Matuyama Chron (2.58–1.95 Ma, while the younger normal polarity deposits likely date to the very beginning of the Olduvai Sub-Chron (1.95–1.78 Ma. The occurrence of a magnetic reversal from reversed to normal polarity recorded in the sequence indicates the deposits of the Bridge Section date to ~1.95 Ma. All the in-situ fossil deposits that have been noted are older than the 1.95 Ma reversal, but younger than 2.3 Ma. Haasgat therefore dates to an interesting time period in South African human evolution that saw the last occurrence of two australopith species at ~2.05–2.02 Ma (Sts5 Australopithecus africanus from Sterkfontein Member 4 to ~1.98 Ma (Australopithecus sediba from Malapa and the first occurrence of early Homo (Sk847, Paranthropus and the Oldowan within Swartkrans Member 1 between ~2.0 Ma and ~1.8 Ma.

  2. Equilibrium, kinetic and thermodynamic studies of the biosorption of textile dye (Reactive Red 195) onto Pinus sylvestris L

    Energy Technology Data Exchange (ETDEWEB)

    Aksakal, Ozkan [Department of Biology, Faculty of Science, Ataturk University, Erzurum 25240 (Turkey); Ucun, Handan, E-mail: hanucun@yahoo.com [Department of Environmental Engineering, Faculty of Engineering, Bartin University, Bartin 74100 (Turkey)

    2010-09-15

    This study investigated the biosorption of Reactive Red 195 (RR 195), an azo dye, from aqueous solution by using cone biomass of Pinus sylvestris Linneo. To this end, pH, initial dye concentration, biomass dosage and contact time were studied in a batch biosorption system. Maximum pH for efficient RR 195 biosorption was found to be 1.0 and the initial RR 195 concentration increased with decreasing percentage removal. Biosorption capacity increased from 6.69 mg/g at 20 deg. C to 7.38 mg/g at 50 deg. C for 200 mg/L dye concentration. Kinetics of the interactions was tested by pseudo-first-order and pseudo-second-order kinetics, the Elovich equation and intraparticle diffusion mechanism. Pseudo-second-order kinetic model provided a better correlation for the experimental data studied in comparison to the pseudo-first-order kinetic model and intraparticle diffusion mechanism. Moreover, the Elovich equation also showed a good fit to the experimental data. Freundlich and Langmuir adsorption isotherms were used for the mathematical description of the biosorption equilibrium data. The activation energy of biosorption (Ea) was found to be 8.904 kJ/mol by using the Arrhenius equation. Using the thermodynamic equilibrium coefficients obtained at different temperatures, the study also evaluated the thermodynamic constants of biosorption ({Delta}G{sup o}, {Delta}H{sup o} and {Delta}S). The results indicate that cone biomass can be used as an effective and low-cost biosorbent to remove reactive dyes from aqueous solution.

  3. Equilibrium, kinetic and thermodynamic studies of the biosorption of textile dye (Reactive Red 195) onto Pinus sylvestris L.

    Science.gov (United States)

    Aksakal, Ozkan; Ucun, Handan

    2010-09-15

    This study investigated the biosorption of Reactive Red 195 (RR 195), an azo dye, from aqueous solution by using cone biomass of Pinus sylvestris Linneo. To this end, pH, initial dye concentration, biomass dosage and contact time were studied in a batch biosorption system. Maximum pH for efficient RR 195 biosorption was found to be 1.0 and the initial RR 195 concentration increased with decreasing percentage removal. Biosorption capacity increased from 6.69 mg/g at 20 degrees C to 7.38 mg/g at 50 degrees C for 200mg/L dye concentration. Kinetics of the interactions was tested by pseudo-first-order and pseudo-second-order kinetics, the Elovich equation and intraparticle diffusion mechanism. Pseudo-second-order kinetic model provided a better correlation for the experimental data studied in comparison to the pseudo-first-order kinetic model and intraparticle diffusion mechanism. Moreover, the Elovich equation also showed a good fit to the experimental data. Freundlich and Langmuir adsorption isotherms were used for the mathematical description of the biosorption equilibrium data. The activation energy of biosorption (Ea) was found to be 8.904 kJ/mol by using the Arrhenius equation. Using the thermodynamic equilibrium coefficients obtained at different temperatures, the study also evaluated the thermodynamic constants of biosorption (DeltaG(o), DeltaH(o) and DeltaS). The results indicate that cone biomass can be used as an effective and low-cost biosorbent to remove reactive dyes from aqueous solution. Copyright 2010 Elsevier B.V. All rights reserved.

  4. Early hominin diet included diverse terrestrial and aquatic animals 1.95 Ma in East Turkana, Kenya

    OpenAIRE

    Braun, David R.; Harris, John W. K.; Levin, Naomi E.; McCoy, Jack T.; Herries, Andy I.R.; Bamford, Marion K.; Bishop, Laura C.; Richmond, Brian G.; Kibunjia, Mzalendo

    2010-01-01

    The manufacture of stone tools and their use to access animal tissues by Pliocene hominins marks the origin of a key adaptation in human evolutionary history. Here we report an in situ archaeological assemblage from the Koobi Fora Formation in northern Kenya that provides a unique combination of faunal remains, some with direct evidence of butchery, and Oldowan artifacts, which are well dated to 1.95 Ma. This site provides the oldest in situ evidence that hominins, predating Homo erectus, enj...

  5. Ge based filled skutterudites MPt{sub 4}Ge{sub 12}: a {sup 195}Pt NMR study.

    Energy Technology Data Exchange (ETDEWEB)

    Baenitz, M.; Sarkar, R.; Gumenik, R.; Leithe-Jasper, A.; Schnelle, W.; Rosner, H.; Burkhardt, U.; Schmidt, M.; Schwarz, U.; Grin, Yu.; Steglich, F. [Max-Planck Institute for Chemical Physics of Solids, Dresden (Germany)

    2009-07-01

    Filled skutterudites MT{sub 4}X{sub 12}(M: alkaline or rare earth metals, T: Fe,Ru,Os, X: P,As,Sb) show a wide variety of strongly correlated electron physics from heavy fermions to Kondo insulators to unconventional superconductors. The new type of skutterudites, the Ge based system MPt{sub 4}Ge{sub 12} form with M=Ba,Sr,La,Ce,Pr,Sm,Eu. They exhibit metallic behaviour and show, with the exception of the systems with Ce, Sm and Eu, superconductivity at low temperature (T{sub c}<10 K). Here we present a temperature dependent {sup 195}Pt NMR study on the whole series of MPt{sub 4}Ge{sub 12} compounds with special attention on the magnetic systems with Ce, Sm and Eu. Here shift {sup 195}K(T) and spin lattice relaxation rate are discussed in the context of a dense Kondo system with a mixed valence state of Ce as well as for Sm. Especially the pronounced maximum observed in {sup 195}K(T) provides very strong evidence for a mixed valence behavior for this new class of material.

  6. MicroRNA-195 inhibits the proliferation of human glioma cells by directly targeting cyclin D1 and cyclin E1.

    Directory of Open Access Journals (Sweden)

    Wang Hui

    Full Text Available Glioma proliferation is a multistep process during which a sequence of genetic and epigenetic alterations randomly occur to affect the genes controlling cell proliferation, cell death and genetic stability. microRNAs are emerging as important epigenetic modulators of multiple target genes, leading to abnormal cellular signaling involving cellular proliferation in cancers.In the present study, we found that expression of miR-195 was markedly downregulated in glioma cell lines and human primary glioma tissues, compared to normal human astrocytes and matched non-tumor associated tissues. Upregulation of miR-195 dramatically reduced the proliferation of glioma cells. Flow cytometry analysis showed that ectopic expression of miR-195 significantly decreased the percentage of S phase cells and increased the percentage of G1/G0 phase cells. Overexpression of miR-195 dramatically reduced the anchorage-independent growth ability of glioma cells. Furthermore, overexpression of miR-195 downregulated the levels of phosphorylated retinoblastoma (pRb and proliferating cell nuclear antigen (PCNA in glioma cells. Conversely, inhibition of miR-195 promoted cell proliferation, increased the percentage of S phase cells, reduced the percentage of G1/G0 phase cells, enhanced anchorage-independent growth ability, upregulated the phosphorylation of pRb and PCNA in glioma cells. Moreover, we show that miR-195 inhibited glioma cell proliferation by downregulating expression of cyclin D1 and cyclin E1, via directly targeting the 3'-untranslated regions (3'-UTR of cyclin D1 and cyclin E1 mRNA. Taken together, our results suggest that miR-195 plays an important role to inhibit the proliferation of glioma cells, and present a novel mechanism for direct miRNA-mediated suppression of cyclin D1 and cyclin E1 in glioma.

  7. 3D Structure of Brownmillerite Ba1.95In2O4.9F0.1

    Science.gov (United States)

    Tarasova, N.; Animitsa, I.; Galisheva, A.

    2017-09-01

    In this paper, the questions about location of fluorine atoms in the structure and the changes in the lengths of indium-oxygen bonds were resolved. The crystal structure of fluorine doped brownmillerite Ba1.95In2O4.9F0.1 was investigated. It was found that fluorine atoms are localized in tetrahedra [InO3F]. The change in the length of In-O bonds at fluorine substitution is determined. The change in the bonds lengths leads to a change in the mobility of the carrier, and, accordingly, to a change of the ionic conductivity.

  8. Absorption cross section measurements of oxygen in the wavelength region 195-241 nm of the Herzberg continuum

    Science.gov (United States)

    Cheung, A. S.-C.; Yoshino, K.; Parkinson, W. H.; Freeman, D. E.; Guberman, S. L.

    1986-01-01

    The continuous absorption cross section of oxygen in the region 205-241 nm is studied as a function of path length and oxygen pressure. The technique used to study the continuous absorption cross section is described. Cross section measurements of oxygen in the wavelength region 193-205 nm obtained by Cheung et al. (1984) are applied in this experiment. The measured cross section is analyzed in terms of a Herzberg continuum and a pressure-dependent continuum. The total measured continuum cross section, the cross section involving two molecules of O2, and the Herzberg continuum absorption cross section values are calculated. It is observed that the Herzberg continuum cross section of oxygen values measured at 1 nm intervals in the region 195-241 nm, increase from 6.3 x 10 to the -24th sq cm at 195 nm to a maximum of 6.6 x 10 to the -24th sq cm at 201 nm and then decrease to 0.85 x 10 to the -24th sq cm at 241 nm. The Herzberg values are compared with data from previous investigations and the values correlate well.

  9. Estoma & câncer retal: revisão de 195 estomas realizados em 380 pacientes portadores de câncer retal Stoma and rectal cancer: review of 195 stomas carried out in 380 patients with rectal cancer

    Directory of Open Access Journals (Sweden)

    Geraldo Magela Gomes da Cruz

    2008-06-01

    Full Text Available Em uma casuística de 24.000 pacientes 923 eram portadores de tumores de intestino grosso (3.8%, 870 dos quais eram tumores colorretais (94,2%, dos quais 490 eram câncer no cólon (53,1% e 380 no reto (41,2% e apenas 53 tumores anais (5,7%. O objetivo deste trabalho é estudar 380 pacientes portadores de câncer retal, analisando, especificamente, os 195 estomas criados nos mesmos, estratificando-os em temporários e definitivos, descrevendo suas modalidades e indicações bem como suas complicações e abordagem cirúrgicas das mesmas. De 380 pacientes portadores de câncer retal 373 foram operados (98,2% e 338 tiveram os tumores removidos (91,8%, tendo sido a retossigmoidectomia abdominal a técnica cirúrgica mais realizada (172 ou 45,3%, das quais, 133 com anastomose manual (35,0% e 39 com anastomose mecânica (10,3%, seguida pela amputação abdominoperineal (135 casos ou 35,5%. Dos 373 pacientes operados foram realizados estomas em 195 (52,3%, 174 dos quais definitivos (46,6% e 21 temporários (5,7%. Destarte, dos 195 estomas realizados, 174 foram definitivos (89,2% e 21 temporários (10,8%. As modalidades de estomas mais realizados foram colostomias terminais (146 casos, 39,1% e colostomias em alça (30 casos, 8,0%. Dos 21 estomas temporários nove foram colostomias em alça (5,2% e 12 foram ileostomias em alça (7,0%. Em 16 dos 21 casos o estoma foi feito como protetor de anastomose em 133 casos de ressecção com anastomose manual (oito colostomias em alça e oito ileostomias em alça; e cinco foram realizados em 39 casos de anastomoses mecânicas, sendo uma colostomia em alça e quatro ileostomias em alça. Os 174 estomas definitivos foram feitos em 135 casos de amputação abdominoperineal, 35 em tumores irressecáveis e quatro em proctocolectomia, tendo sido 146 colostomias terminais (83,9%, quatro ileostomias terminais (2,3%, 21 colostomias em alça (12,1% e três colostomias duplas (1,7%. Ocorreram 14 complicações (7,2% nos 195

  10. Short all Tm-doped germanate glass fiber MOPA single-frequency laser at 1.95 μm.

    Science.gov (United States)

    Yang, Changsheng; Chen, Dan; Xu, Shanhui; Deng, Huaqiu; Lin, Wei; Zhao, Qilai; Zhang, Yuanfei; Zhou, Kaijun; Feng, Zhouming; Qian, Qi; Yang, Zhongmin

    2016-05-16

    Based on heavily Tm-doped germanate glass fibers (TGFs), a short all-TGF MOPA laser system with uniform core parameters in each stage was demonstrated. An 11.7 W stable single-frequency laser at 1.95 μm with an optical-to-optical conversion efficiency of 20.4% is obtained from a homemade 31-cm-long double-cladding single-mode TGF. The estimated stimulated Brillouin scattering (SBS) threshold of 980 W and the measured relative intensity noise of < -130 dB/Hz for frequencies above 2 MHz are achieved in this MOPA system. Furthermore, the prospect for further power-scaling of such short MOPA laser is considered.

  11. Identification of a Novel β-Globin Mutation (HBB: C.189_195delTCATGGC) in a Chinese Family.

    Science.gov (United States)

    He, Sheng; Lin, Li; Wei, Yuan; Chen, Biyan; Yi, Shang; Chen, Qiuli; Qiu, XiaoXia; Wei, Hongwei; Li, Guojian; Zheng, Chenguang

    2016-08-01

    β-Thalassemia (β-thal) is one of the most common genetic disorders worldwide. Molecular characterization of β-thal is essential for prevention and understanding the biology of the disease. More and more rare and novel mutations are being reported. Here, we report a novel 7 bp deletion at codons 63-65 (HBB: c.189_195delTCATGGC) in exon 2 of the β-globin gene in a family from Guangxi Province, China. This novel mutation causes a shift in the normal reading frame of the β-globin coding sequence and created a stop codon at codon 87 in exon 2, which leads to a β(0)-thal phenotype.

  12. Double-neutron capture reaction and natural abundance of 183W, 195Pt and 199Hg isotopes

    Science.gov (United States)

    Karamian, S. A.; Aksenov, N. V.; Bozhikov, G. A.

    2016-06-01

    There are much data on neutron cross sections over the chart of nuclides for stable isotopes and not as much for the radioactive ones. Double neutron capture experiments could be fruitful to provide more data. Time-integrated mean flux of slow neutrons reaches the value of 2.3-1012 n/cm2 s at the irradiation port near the active zone of the IBR-2 pulsed reactor of JINR. This is enough to detect the double neutron capture products by the activation method. A high capture cross section is obtained in the present experiment for intermediate radioactive 182Ta and 194Ir target nuclides. Together with the known data for 198Au, these values may prove an essential role of double neutron capture process for nucleosynthesis of 183W, 195Pt and 199Hg isotopes at stellar conditions.

  13. Low toxicity binder systems for tape cast Ce0.9Gd0.1O1.95 laminates

    DEFF Research Database (Denmark)

    Klemensø, Trine; Menon, Mohan; Ramousse, Severine

    2010-01-01

    Conventional binder systems for tape casting contain toxic phthalate plasticizers and butanone (MEK) as part of the solvent. The effects of exchanging the phthalate with a non-toxic alternative, and butanone with ethanol, were studied on laminates of high-green density CGO (Ce0.9Gd0.1O1.95) tapes....... Samples were prepared with a binder system containing DBP (dibutyl phthalate) plasticizer and MEK solvent, and with a binder system based on a non-toxic non-phthalate plasticizer and ethanol. In both systems, the weight ratio of plasticizer to the PVB (polyvinyl butyral) binder was varied between 0.......4 and 0.7. Substitution to the less toxic binder system had no adverse impacts on the microstructure. In fact, denser packing and improved homogeneity were observed with the non-phthalate-based system at ratio 0.5 indicating improved dispersion in this system. The denser packing also coincided...

  14. Conversion electron measurements of 195Au using ICEBall for Nuclear Structure and Astrophysics at the University of Notre Dame

    Science.gov (United States)

    Battaglia, Anthony; Tan, Wanpeng; Aprahamian, Ani; Bauder, William; Casarella, Clark; Gurdal, Gulhan; Long, Alexander; Nystrom, Andrew; Siegl, Kevin; Smith, Karl; Smith, Mallory

    2013-10-01

    The Internal Conversion Electron Ball Array (ICEBall) consists of six Si(Li) detectors and it was recently re-comissioned at the University of Notre Dame Nuclear Science Laboratory for spectroscopic studies of heavy nuclei. For the commissioning experiment, a 16 MeV bunched proton beam was used from the FN Tandem for a (p,2n) reaction to populate low spin states of 195Au. Both conversion electrons and gamma-rays were detected in coincidence between ICEBall and a single high-purity germanium detector. A total of 14 conversion coeffcients were measured. The results will be presented and compared to previous results. This work was supported by the National Science Foundation under contract number NSF PHY-1068192. M.P. Metlay, J.X. Saladin, I.Y. Lee, and O. Dietzsch, Nucl. Instrum. Meth. A, 336, 162 (1993).

  15. Effects on rat testis of 1.95-GHz W-CDMA for IMT-2000 cellular phones.

    Science.gov (United States)

    Imai, Norio; Kawabe, Mayumi; Hikage, Takashi; Nojima, Toshio; Takahashi, Satoru; Shirai, Tomoyuki

    2011-08-01

    In recent years concern has arisen whether carrying a cellular phone near the reproductive organs such as the testes may cause dysfunction and particularly decrease in sperm development and production, and thus fertility in men. The present study was performed to investigate the effects of a 1.95 GHz electromagnetic field on testicular function in male Sprague-Dawley rats. Five week old animals were divided into 3 groups of 24 each and a 1.95-GHz wide-band code division multiple access (W-CDMA) signal, which is used for the freedom of mobile multimedia access (FOMA), was employed for whole body exposure for 5 hours per day, 7 days a week for 5 weeks (the period from the age of 5 to 10 weeks, corresponding to reproductive maturation in the rat). Whole-body average specific absorption rates (SAR) for individuals were designed to be 0.4 and 0.08 W/kg respectively. The control group received sham exposure. There were no differences in body weight gain or weights of the testis, epididymis, seminal vesicles, and prostate among the groups. The number of sperm in the testis and epididymis were not decreased in the electromagnetic field (EMF) exposed groups, and, in fact, the testicular sperm count was significantly increased with the 0.4 SAR. Abnormalities of sperm motility or morphology and the histological appearance of seminiferous tubules, including the stage of the spermatogenic cycle, were not observed. Thus, under the present exposure conditions, no testicular toxicity was evident.

  16. The R163K Mutant of Human Thymidylate Synthase Is Stabilized in an Active Conformation: Structural Asymmetry and Reactivity of Cysteine 195

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, Lydia M.; Lovelace, Leslie L.; Lebioda, Lukasz (SC)

    2008-06-16

    Loop 181-197 of human thymidylate synthase (hTS) populates two conformational states. In the first state, Cys195, a residue crucial for catalytic activity, is in the active site (active conformer); in the other conformation, it is about 10 {angstrom} away, outside the active site (inactive conformer). We have designed and expressed an hTS variant, R163K, in which the inactive conformation is destabilized. The activity of this mutant is 33% higher than that of wt hTS, suggesting that at least one-third of hTS populates the inactive conformer. Crystal structures of R163K in two different crystal forms, with six and two subunits per asymmetric part of the unit cells, have been determined. All subunits of this mutant are in the active conformation while wt hTS crystallizes as the inactive conformer in similar mother liquors. The structures show differences in the environment of catalytic Cys195, which correlate with Cys195 thiol reactivity, as judged by its oxidation state. Calculations show that the molecular electrostatic potential at Cys195 differs between the subunits of the dimer. One of the dimers is asymmetric with a phosphate ion bound in only one of the subunits. In the absence of the phosphate ion, that is in the inhibitor-free enzyme, the tip of loop 47-53 is about 11 {angstrom} away from the active site.

  17. Imported leishmaniasis in the Netherlands from 2005 to 2012: epidemiology, diagnostic techniques and sequence-based species typing from 195 patients

    NARCIS (Netherlands)

    Bart, A.; van Thiel, P. P. A. M.; de Vries, H. J. C.; Hodiamont, C. J.; van Gool, T.

    2013-01-01

    Leishmaniasis is an imported disease in the Netherlands. We report data for the period between 2005 and 2012, on clinical presentation, country where leishmaniasis was acquired, and causative species, for 195 civilian and military patients who had travelled abroad. Most patients were affected by

  18. Influence of pore former on porosity and mechanical properties of Ce0.9Gd0.1O1.95 electrolytes for flue gas purification

    DEFF Research Database (Denmark)

    Charlas, Benoit; Schmidt, Cristine Grings; Frandsen, Henrik Lund

    2016-01-01

    Single layered porous Ce0.9Gd0.1O1.95 electrolytes were fabricated by tape casting using different types, shapes and sizes of pore formers and their respective strength and stiffness were compared. The sintered bodies were characterized by scanning electron microscopy, mercury porosimetry, impuls...

  19. Importance of a Lys113-Glu195 intermonomer ionic bond in F-actin stabilization and regulation by yeast formins Bni1p and Bnr1p.

    Science.gov (United States)

    Wen, Kuo-Kuang; McKane, Melissa; Rubenstein, Peter A

    2013-06-28

    Proper actin cytoskeletal function requires actin's ability to generate a stable filament and requires that this reaction be regulated by actin-binding proteins via allosteric effects on the actin. A proposed ionic interaction in the actin filament interior between Lys(113) of one monomer and Glu(195) of a monomer in the apposing strand potentially fosters cross-strand stabilization and allosteric communication between the filament interior and exterior. We interrupted the potential interaction by creating either K113E or E195K actin. By combining the two, we also reversed the interaction with a K113E/E195K (E/K) mutant. In all cases, we isolated viable cells expressing only the mutant actin. Either single mutant cell displays significantly decreased growth in YPD medium. This deficit is rescued in the double mutant. All three mutants display abnormal phalloidin cytoskeletal staining. K113E actin exhibits a critical concentration of polymerization 4 times higher than WT actin, nucleates more poorly, and forms shorter filaments. Restoration of the ionic bond, E/K, eliminates most of these problems. E195K actin behaves much more like WT actin, indicating accommodation of the neighboring lysines. Both Bni1 and Bnr1 formin FH1-FH2 fragment accelerate polymerization of WT, E/K, and to a lesser extent E195K actin. Bni1p FH1-FH2 dramatically inhibits K113E actin polymerization, consistent with barbed end capping. However, Bnr1p FH1-FH2 restores K113E actin polymerization, forming single filaments. In summary, the proposed ionic interaction plays an important role in filament stabilization and in the propagation of allosteric changes affecting formin regulation in an isoform-specific fashion.

  20. Production of the therapeutic radionuclides 193mPt and 195mPt with high specific activity via alpha-particle-induced reactions on 192Os.

    Science.gov (United States)

    Hilgers, K; Coenen, H H; Qaim, S M

    2008-04-01

    For the production of therapy-relevant radionuclides (193m)Pt (T(1/2)=4.33 d) and (195m)Pt (T(1/2)=4.03 d) with a high specific activity, the (192)Os(alpha,n)(195m)Pt and (192)Os(alpha,3n)(193m)Pt nuclear reactions were investigated for the first time from their respective thresholds up to 28 MeV. Thin samples of enriched (192)Os were prepared by electrodeposition on Ni, and the conventional stacked-foil technique was used for cross-section measurements. The calculated thick target yields were found to be 0.013 MBq/microA h for the (192)Os(alpha,n)(195m)Pt reaction in the energy range of E(alpha)=24-->18 MeV, and 0.25 MBq/microA h for the (192)Os(alpha,3n)(193m)Pt reaction in the energy range of E(alpha)=28-->24 MeV. The two radionuclides could not be detected in the interactions of (3)He particles with (192)Os. A production method involving high-current alpha-particle irradiation of enriched (192)Os and efficient chemical separation of radioplatinum was developed. Batch yields of about 1 MBq (195m)Pt and 8.7 MBq (193m)Pt were achieved. Compared to the reactor production these batch yields are very low, but the (192)Os(alpha,n)(195m)Pt and (192)Os(alpha,3n)(193m)Pt reactions are superior with respect to the specific activity of the products which is higher by two orders of magnitude.

  1. Development of a diagnostic schedule for a defective LC-195V5 CNC milling machine using PERT

    Directory of Open Access Journals (Sweden)

    Oluwole Olayinka AGBOOLA

    2016-07-01

    Full Text Available Computer Numerical Control CNC machine tools usage are more and more extensive, its fault diagnosis research is becoming more essential. Failure forms accorded these machines are diversified, and fault reasons are very complicated. It should not be left unattended to, because this could lead to further deterioration. One of the parameters used in determining the efficiency of a technician (who repairs machine tools is the time saved in locating faults, hence the development of a diagnostic schedule which shows the sequential means of troubleshooting within a possible shortest time. In this research two approaches were used to diagnose a defective LC-195V5 CNC milling machine. Forward Pass (FP, which involves the diagnosis from electrical parts through Computer (CNC to mechanical component and Backward Pass (BP which involves the diagnosis from computer component through electrical parts to mechanical parts. Three different trials were conducted for each of the mode of diagnosis and the time to diagnose each component part was recorded. Based on the interrelationship of the component parts, two separate PERT (Project Evaluation & Review Techniques network diagrams were drawn and their Critical Paths were determined. The study reveals that Foward Pass method was able to save more time.

  2. Purification and characterization of a highly efficient calcium-independent α-amylase from Talaromyces pinophilus 1-95.

    Science.gov (United States)

    Xian, Liang; Wang, Fei; Luo, Xiang; Feng, Yu-Liang; Feng, Jia-Xun

    2015-01-01

    Alpha-amylase is a very important enzyme in the starch conversion process. Most of the α-amylases are calcium-dependent and exhibit poor performance in the simultaneous saccharification and fermentation process of industrial bioethanol production that uses starch as feedstock. In this study, an extracellular amylolytic enzyme was purified from the culture broth of newly isolated Talaromyces pinophilus strain 1-95. The purified amylolytic enzyme, with an apparent molecular weight of 58 kDa on SDS-PAGE, hydrolyzed maltopentaose, maltohexaose, and maltoheptaose into mainly maltose and maltotriose and minor amount of glucose, confirming the endo-acting mode of the enzyme, and hence, was named Talaromyces pinophilus α-amylase (TpAA). TpAA was most active at pH 4.0-5.0 (with the temperature held at 37°C) and 55°C (at pH 5.0), and stable within the pH range of 5.0-9.5 (at 4°C) and below 45°C (at pH 5.0). Interestingly, the Ca2+ did not improve its enzymatic activity, optimal temperature, or thermostability of the enzyme, indicating that the TpAA was Ca2+-independent. TpAA displayed higher enzyme activity toward malto-oligosaccharides and dextrin than other previously reported α-amylases. This highly active Ca2+-independent α-amylase may have potential applications in starch-to-ethanol conversion process.

  3. Real world heart failure epidemiology and outcome: A population-based analysis of 88,195 patients.

    Directory of Open Access Journals (Sweden)

    Núria Farré

    Full Text Available Heart failure (HF is frequent and its prevalence is increasing. We aimed to evaluate the epidemiologic features of HF patients, the 1-year follow-up outcomes and the independent predictors of those outcomes at a population level.Population-based longitudinal study including all prevalent HF cases in Catalonia (Spain on December 31st, 2012. Patients were divided in 3 groups: patients without a previous HF hospitalization, patients with a remote (>1 year HF hospitalization and patients with a recent (<1 year HF admission. We analyzed 1year all-cause and HF hospitalizations, and all-cause mortality. Logistic regression was used to identify the independent predictors of each of those outcomes. A total of 88,195 patients were included. Mean age was 77 years, 55% were women. Comorbidities were frequent. Fourteen percent of patients had never been hospitalized, 71% had a remote HF hospitalization and 15% a recent hospitalization. At 1-year follow-up, all-cause and HF hospitalization were 53% and 8.8%, respectively. One-year all-cause mortality rate was 14%, and was higher in patients with a recent HF hospitalization (24%. The presence of diabetes mellitus, atrial fibrillation or chronic kidney disease was independently associated with all-cause and HF hospitalization and all-cause mortality. Hospital admissions and emergency department visits the previous year were also found to be independently associated with the three study outcomes.Outcomes are different depending on the HF population studied. Some comorbidity, an all-cause hospitalization or emergency department visit the previous year were associated with a worse outcome.

  4. Real world heart failure epidemiology and outcome: A population-based analysis of 88,195 patients

    Science.gov (United States)

    Vela, Emili; Clèries, Montse; Bustins, Montse; Cainzos-Achirica, Miguel; Enjuanes, Cristina; Moliner, Pedro; Ruiz, Sonia; Verdú-Rotellar, José María; Comín-Colet, Josep

    2017-01-01

    Background Heart failure (HF) is frequent and its prevalence is increasing. We aimed to evaluate the epidemiologic features of HF patients, the 1-year follow-up outcomes and the independent predictors of those outcomes at a population level. Methods and results Population-based longitudinal study including all prevalent HF cases in Catalonia (Spain) on December 31st, 2012. Patients were divided in 3 groups: patients without a previous HF hospitalization, patients with a remote (>1 year) HF hospitalization and patients with a recent (<1 year) HF admission. We analyzed 1year all-cause and HF hospitalizations, and all-cause mortality. Logistic regression was used to identify the independent predictors of each of those outcomes. A total of 88,195 patients were included. Mean age was 77 years, 55% were women. Comorbidities were frequent. Fourteen percent of patients had never been hospitalized, 71% had a remote HF hospitalization and 15% a recent hospitalization. At 1-year follow-up, all-cause and HF hospitalization were 53% and 8.8%, respectively. One-year all-cause mortality rate was 14%, and was higher in patients with a recent HF hospitalization (24%). The presence of diabetes mellitus, atrial fibrillation or chronic kidney disease was independently associated with all-cause and HF hospitalization and all-cause mortality. Hospital admissions and emergency department visits the previous year were also found to be independently associated with the three study outcomes. Conclusions Outcomes are different depending on the HF population studied. Some comorbidity, an all-cause hospitalization or emergency department visit the previous year were associated with a worse outcome. PMID:28235067

  5. Core Description and a Preliminarily Sedimentology Study of Site 1202D, Leg 195, in the Southern Okinawa Trough

    Directory of Open Access Journals (Sweden)

    Chi-Yue Huang

    2005-01-01

    Full Text Available ODP Site 1202 of Leg 195 was designed primarily for a high-resolution study of the paleoceanography of the Kuroshio Current in the southern Okinawa Trough off NE Taiwan. Four holes were drilled in which Hole 1202D is described in detail in this study for an assessment of core quality for paleoceanography study and understanding of sedimentological features, especially turbidite sedimentation and the sediment provenances during the Late Quaternary in the southern Okinawa Trough. Pelagic mud with insignificant silt or sand layers is observed from the core top down to 133 m (mbsf; Marine Isotope Stages 1-3, but the silt-sand layer ratio (SLR: total thickness of silt and sand layers / 1.5 m of core increases gradually from a value of 50 % between 223 and 279 m, followed by decreases to values 250 _ Slate fragments are commonly found in fine-grained turbidite dominant intervals (160 - 280 m, while mica flakes can be observed in the muds throughout the core. The major detrital components were derived primarily from the Miocene slate belt of the pre-collision accretionary prism of the Central Range in northern Taiwan. The occurrence of volcanics could represent submarine volcanic activity in the active-opening Okinawa Trough back-arc basin off NE Taiwan. Shallow-marine fossils including benthic foraminifers, echinoids, bryozoans and mollusks are also found in the fine-grained turbidite dominant intervals. These fossil assemblages could have been deposited in the shallow shelf and then transported to the depositional site along with voluminous terrigenous materials derived from Taiwan, via submarine channels or by slope failures due to frequent earthquakes induced by plate convergence/collision and extension in the southwestern Okinawa Trough off NE Taiwan. It is concluded that the top 133 m of the core is better suited for paleoceanographic reconstruction.

  6. Kinetic characterization, thermo-stability and Reactive Red 195A dye detoxifying properties of manganese peroxidase-coupled gelatin hydrogel.

    Science.gov (United States)

    Bilal, Muhammad; Asgher, Muhammad; Hu, Hongbo; Zhang, Xuehong

    2016-10-01

    An indigenous and industrially important manganese peroxidase (MnP) was isolated from solid-state bio-processing of wheat bran by white-rot fungal strain Ganoderma lucidum IBL-05 under pre-optimized growth conditions. Crude MnP extract was partially purified (2.34-fold) to apparent homogeneity by ammonium sulphate precipitation and dialysis. The homogeneous enzyme preparation was encapsulated on gelatin matrix using glutaraldehyde as a cross-linking agent. Optimal conditions for highest immobilization (82.5%) were: gelatin 20% (w/v), glutaraldehyde 0.25% (v/v) and 2 h activation time using 0.6 mg/mL of protein concentration. Gelatin-encapsulated MnP presented its maximum activity at pH 6.0 and 60 °C. Thermo-stability was considerably improved after immobilization. The optimally active MnP fraction was tested against MnSO4 as a substrate to calculate kinetic parameters. More than 90% decolorization of Sandal-fix Red C4BLN (Reactive Red 195A) dye was achieved with immobilized MnP in 5 h. It also preserved more than 50% of its original activity after the sixth reusability cycle. The water quality parameters (pH, chemical oxygen demand, total organic carbon) and cytotoxicity (brine shrimp and Daphnia magna) studies revealed the non-toxic nature of the bio-treated dye sample. A lower Km, higher Vmax, greater acidic and thermal-resistant up to 60 °C were the improved catalytic features of immobilized MnP suggesting its suitability for a variety of biotechnological applications.

  7. arXiv Study of the long-lived excited state in the neutron deficient nuclides $^{195,197,199}$Po by precision mass measurement

    CERN Document Server

    Althubiti, N.A.; Blaum, K.; Cocolios, T.E.; Day Goodacre, T.; Farooq-Smith, G.J.; Fedorov, D.V.; Fedosseev, V.N.; George, S.; Herfurth, F.; Heyde, K.; Kreim, S.; Lunney, D.; Lynch, K.M.; Manea, V.; Marsh, B.A.; Neidherr, D.; Rosenbusch, M.; Rossel, R.E.; Rothe, S.; Schweikhard, L.; Seliverstov, M.D.; Welker, A.; Wienholtz, F.; Wolf, R.N.; Zuber, K.

    2017-10-27

    Direct mass measurements of the low-spin 3/2− and high-spin 13/2+ states in the neutron-deficient isotopes Po195 and Po197 were performed with the Penning-trap mass spectrometer ISOLTRAP at ISOLDE-CERN. These measurements allow the determination of the excitation energy of the isomeric state arising from the νi13/2 orbital in Po195,197. Additionally, the excitation energy of isomeric states of lead, radon, and radium isotopes in this region were obtained from α-decay chains. These excitation energies complete the knowledge of the energy systematics in the region and confirm that the 13/2+ states remain isomeric, independent of the number of valence neutrons.

  8. Oxygen permeation in thin, dense Ce0.9Gd0.1O 1.95- membranes II. experimental determination

    DEFF Research Database (Denmark)

    Chatzichristodoulou, Christodoulos; Søgaard, Martin; Glasscock, Julie

    2011-01-01

    Thin (∼30 m), dense Ce0.9Gd0.1O1.95- (CGO10) membranes (5 5 cm2+) supported on a porous NiO/YSZ substrate were fabricated by tape casting, wet powder spraying and lamination. A La 0.58Sr0.4Co0.2Fe0.8O 3-δ/Ce0.9Gd0.1O1.95- (LSCF/CGO10) composite cathode was applied by screen printing. Oxygen...... permeation measurements and electrochemical characterisation of the cells were performed as a function of temperature with air and varying hydrogen/steam mixtures flowing in the feed and permeate compartments, respectively. The oxygen flux was found to reach 10 N mL min-1 cm-2 at ∼1100 K and to exceed 16 N m...

  9. Site-directed mutagenesis from Arg195 to His of a microalgal chloroplastidial glycerol-3-phosphate acyltransferase causes an increase in phospholipid levels in yeast

    Directory of Open Access Journals (Sweden)

    Long-Ling eOuyang

    2016-03-01

    Full Text Available To analyze the contribution of glycerol-3-phosphate acyltransferase (GPAT to the first acylation of glycerol-3-phosphate (G-3-P, the present study focused on a functional analysis of the GPAT gene from Lobosphaera incisa (designated as LiGPAT and the subcellular localization of the encoded protein LiGPAT. A full-length cDNA of LiGPAT consisting of a 1,305-bp ORF, a 1,652-bp 5′-UTR, and a 354-bp 3′-UTR, was cloned. The ORF encoded a 434-amino acid peptide, of which 63 residues at the N-terminus defined a chloroplast transit peptide. LiGPAT was exclusively localized to chloroplasts, which was shown by co-expression of LiGPAT with eGFP in Chlamydomonas reinhardtii and by immunogold labeling in L. incisa. Considering the conservation of His among the G-3-P binding sites from chloroplastidial GPATs and the substitution of His by Arg at position 195 in the LiGPAT mature protein (designated mLiGPAT, we established the heterologous expression of either mLiGPAT or its mutant (Arg195His (sdmLiGPAT in the GPAT-deficient yeast mutant gat1Δ. Lipid profile analyses of these transgenic yeasts not only validated the acylation function of LiGPAT but also indicated that the site-directed mutagenesis from Arg195 to His led to an increase in the phospholipid level in yeast. Semi-quantitative analysis of mLiGPAT and sdmLiGPAT, together with the structural superimposition of their G-3-P binding sites, indicated that the increased enzymatic activity was caused by the enlarged accessible surface of the phosphate group binding pocket when Arg195 was mutated to His. Thus, the potential of genetic manipulation of GPAT to increase the glycerolipid level in L. incisa and other microalgae would be of great interest.

  10. Study of the long-lived excited state in the neutron deficient nuclides $^{195,197,199}$Po by precision mass measurement

    OpenAIRE

    Althubiti, N. A.; Atanasov, D; Blaum, K.; Cocolios, T. E.; Goodacre, T Day; Farooq-Smith, G. J.; Fedorov, D.V.; Fedosseev, V. N.; George, S.; Herfurth, F.; Heyde, K; Kreim, S; Lunney, D.; Lynch, K.M.; Manea, V.

    2017-01-01

    Direct mass measurements of the low-spin $3/2^{(-)}$ and high-spin $13/2^{(+)}$ states in the neutron-deficient isotopes $^{195}$Po, $^{197}$Po, and high-spin $13/2^{(+)}$ state in $^{199}$Po were performed with the Penning-trap mass spectrometer ISOLTRAP at ISOLDE-CERN. These measurements allow the determination of the excitation energy of the isomeric state arising from the $\

  11. Comparative Genomics of Two ST 195 Carbapenem-Resistant Acinetobacter baumannii with Different Susceptibility to Polymyxin Revealed Underlying Resistance Mechanism

    Science.gov (United States)

    Lean, Soo-Sum; Yeo, Chew Chieng; Suhaili, Zarizal; Thong, Kwai-Lin

    2016-01-01

    Acinetobacter baumannii is a Gram-negative nosocomial pathogen of importance due to its uncanny ability to acquire resistance to most antimicrobials. These include carbapenems, which are the drugs of choice for treating A. baumannii infections, and polymyxins, the drugs of last resort. Whole genome sequencing was performed on two clinical carbapenem-resistant A. baumannii AC29 and AC30 strains which had an indistinguishable ApaI pulsotype but different susceptibilities to polymyxin. Both genomes consisted of an approximately 3.8 Mbp circular chromosome each and several plasmids. AC29 (susceptible to polymyxin) and AC30 (resistant to polymyxin) belonged to the ST195 lineage and are phylogenetically clustered under the International Clone II (IC-II) group. An AbaR4-type resistance island (RI) interrupted the comM gene in the chromosomes of both strains and contained the blaOXA−23 carbapenemase gene and determinants for tetracycline and streptomycin resistance. AC29 harbored another copy of blaOXA−23 in a large (~74 kb) conjugative plasmid, pAC29b, but this gene was absent in a similar plasmid (pAC30c) found in AC30. A 7 kb Tn1548::armA RI which encodes determinants for aminoglycoside and macrolide resistance, is chromosomally-located in AC29 but found in a 16 kb plasmid in AC30, pAC30b. Analysis of known determinants for polymyxin resistance in AC30 showed mutations in the pmrA gene encoding the response regulator of the two-component pmrAB signal transduction system as well as in the lpxD, lpxC, and lpsB genes that encode enzymes involved in the biosynthesis of lipopolysaccharide (LPS). Experimental evidence indicated that impairment of LPS along with overexpression of pmrAB may have contributed to the development of polymyxin resistance in AC30. Cloning of a novel variant of the blaAmpC gene from AC29 and AC30, and its subsequent expression in E. coli also indicated its likely function as an extended-spectrum cephalosporinase. PMID:26779129

  12. Polyphase serpentinization history of Mariana forearc mantle: observations on the microfabric of ultramafic clasts from ODP Leg 195, Site 1200

    Science.gov (United States)

    Kahl, Wolf-Achim; Jöns, Niels; Bach, Wolfgang; Klein, Frieder

    2013-04-01

    In the forearc of the Mariana subduction zone system, a number of seamounts form from extrusion of blueschist and serpentine mud. Ocean Drilling Program Leg 195 drilled the South Chamorro seamount, where ultramafic clasts occur within the mud matrix. These clasts show a complex serpentinization history, which bears the potential for tracking the alteration history during uplift and cooling of mantle wedge rocks to the seafloor. Moreover, the microfabrics of the highly serpentinized harzburgite and dunite clasts exhibit evidence for multiple fracturing events in the forearc mantle. These, in turn, lead to fluid influx and varied styles of serpentinization of harzburgite and dunite. The serpentinized ultramafic clasts exhibit a variety of microfabrics that range from virtually undeformed to strongly deformed samples. Pervasively serpentinized harzburgites feature either an equigranular fabric of serpentinized olivine and orthopyroxene crystals, or different vein generations related to multiple stages of serpentinization. Several types of fluid pathways in harzburgites are present: (i) veins containing brucite and iron oxides, developed linearly without marked conformance with the rock fabric. In places, these veins developed mm-cm wide halos with finger-shaped serpentinization fronts. Veins of type (i) are either developed as syntaxial veins from a single crack-seal event with large magnetite crystals growing from one wall to the other (as confirmed with high-resolution X-ray microtomography), or formed by multiple fluid events. (ii) serpentine veins that encompass regions of marginally serpentinized, microgranular olivine and large orthopyroxene crystals. (iii) extensional serpentine veins (known as "Frankenstein" type). In the clasts studied, their occurrence is restricted to the halo region of type (i) veins. (iv) as a late-stage feature, extensional veins documenting multiple crack-seal events can be present in the serpentinites (either in undeformed regions with

  13. Light Element Systematics of Metamorphic Clasts from Odp Legs 125 and 195, South Chamorro and Conical Seamounts, Mariana Forearc.

    Science.gov (United States)

    Guggino, S.; Savov, I. P.; Ryan, J. G.

    2002-05-01

    ODP Legs 125 and 195 drilled the summits and flanks of two actively fluid-venting mud volcanoes in the Mariana Forearc: the Conical and the S.Chamorro Seamounts. The recovered lithologies include serpentinized harzburgites and dunites as well as metamorphic clasts, both enclosed in a serpentine mud matrix. The metamafic clasts are schists with highly variable diagnostic mineral assemblages - chlorite, serpentine, talc; tremolite, actinolite and glaucophane; albite, quartz, prhenite, epidote and zeolites. While the major and trace element geochemistries of the metamorphic clasts are highly variable, two protolith groups can be identified. The first group includes serpentinites/mantle-derived source rocks with high LOI, high Ni (avg. 2280 ppm), high Cr (1040-3950 ppm), and low TiO2 (0.04wt%- 0.4 wt%) abundances. The second group includes metamorphosed MORB/sedimentary materials with low LOI, high TiO2 (0.97- 3.58 wt%), low Ni (avg. 470 ppm) and Cr (14- 340 ppm). Samples in this group have MORB-like REE patterns ([Sm/Yb]N ~ 1; [La/Sm]N ~ 0.6-1), as well as non-serpentinite Y abundances (avg: 30 ppm) and Si/Mg ratios ranging from 2.1 to 8.9. Light element/immobile element ratios of the clasts show extreme enrichments of fluid mobile elements (FME). Clasts from both seamounts have very high B/Be (8.2-2715; avg: 358) and B/Li (avg: 2.9). As noted by Bebout et al.(1993, 1999), metamorphism at the slab-mantle interface may prevent the deep subduction of highly volatile components such as H2O, B, As, Cs and Sb. Although only 5-10% of the recovered clasts are slab-derived metamorphic rocks, major and trace element signatures of the serpentinite muds suggest the admixture of a slab crustal component. The extreme FME enrichments preserved in these crustal rocks may thus indicate a large shallow FME outflux.

  14. Comparative genomics of two ST 195 carbapenem-resistant Acinetobacter baumannii with different susceptibility to polymyxin revealed underlying resistance mechanism

    Directory of Open Access Journals (Sweden)

    Soo Sum eLean

    2016-01-01

    Full Text Available Acinetobacter baumannii is a Gram-negative nosocomial pathogen of importance due to its uncanny ability to acquire resistance to most antimicrobials. These include carbapenems, which are the drugs of choice for treating A. baumannii infections, and polymyxins, the drugs of last resort. Whole genome sequencing was performed on two clinical carbapenem-resistant A. baumannii AC29 and AC30 strains which had an indistinguishable ApaI pulsotype but different susceptibilities to polymyxin. Both genomes consisted of an approximately 3.8 Mbp circular chromosome each and several plasmids. AC29 (susceptible to polymyxin and AC30 (resistant to polymyxin belonged to the ST195 lineage and are phylogenetically clustered under the International Clone III (IC-III group. An AbaR4-type resistance island (RI interrupted the comM gene in the chromosomes of both strains and contained the blaOXA-23 carbapenemase gene and determinants for tetracycline and streptomycin resistance. AC29 harboured another copy of blaOXA-23 in a large (~74 kb conjugative plasmid, pAC29b, but this gene was absent in a similar plasmid (pAC30c found in AC30. A 7 kb Tn1548::armA RI which encodes determinants for aminoglycoside and macrolide resistance, is chromosomally-located in AC29 but found in a 16 kb plasmid in AC30, pAC30b. Analysis of known determinants for polymyxin resistance in AC30 showed mutations in the pmrA gene encoding the response regulator of the two-component pmrAB signal transduction system as well as in the lpxD, lpxC and lpsB genes that encode enzymes involved in the biosynthesis of lipopolysaccharide (LPS. Experimental evidence indicated that impairment of LPS along with overexpression of pmrAB may have contributed to the development of polymyxin resistance in AC30. Cloning of a novel variant of the blaAmpC gene from AC29 and AC30, and its subsequent expression in E. coli also indicated its likely function as an extended-spectrum cephalosporinase

  15. Chemonuclear studies for identification for new production routes for the therapeutically useful radionuclides {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt, und {sup 195m}Pt; Kernchemische Studien zur Entwicklung neuerer Produktionsverfahren fuer die therapierelevanten Radionuklide {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt, und {sup 195m}Pt

    Energy Technology Data Exchange (ETDEWEB)

    Hilgers, K.

    2005-12-15

    New production routes for the therapeutically useful radionuclides {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt and {sup 195m}Pt were investigated. Cross section data were measured using the stacked-foil technique and compared with theoretical calculations. A production method for the platinum nuclides was developed. The {sup 141}Pr(p, 2n){sup 140}Nd and {sup nat}Ce({sup 3}He, xn){sup 140}Nd reactions were investigated for production of {sup 140}Nd. Cross section data of nuclear reactions leading to the side products {sup 141}Nd, {sup 139}Nd and {sup 139}Ce could also be achieved. The experimental data were compared with theoretical calculations using the code ALICE-IPPE. A comparison of the calculated thick target yields showed that the {sup 141}Pr(p, 2n){sup 140}Nd reaction gives a higher yield. The {sup 192}Os(p, n){sup 192}Ir reaction was examined in the context of the production of {sup 192}Ir. Cross section data were determined and compared with theoretical calculations using the codes ALICE-IPPE and EMPIRE II. The yield of this reaction was compared with the yield of the reactor production of this nuclide. The reactor production seems to be more suitable because of a higher purity and yield. Cross section data were measured for the {sup 192}Os({alpha}, n){sup 195m}Pt, {sup 192}Os({alpha}, 3n){sup 193m}Pt and {sup 192}Os({sup 3}He, 4n){sup 191}Pt reactions. The activity of {sup 193m}Pt and {sup 195m}Pt was determined by X-ray spectroscopy after a chemical separation procedure. The ALICE-IPPE code was found to be inappropriate to reproduce the experimental values. The calculated yields were compared with the yields of other reactions, especially the reactor production of {sup 195m}Pt. The yield of the {sup 192}Os({alpha}, n){sup 195m}Pt reaction is lower compared to the yield of the reactor production, but offers lower target costs and higher specific activity. A production method for {sup 193m}Pt and {sup 195m}Pt was developed. Batch yields of 0.9 MBq

  16. Physical and underway data collected aboard the KNORR during cruise KN195-12 in the North Pacific Ocean from 2009-07-27 to 2009-08-09 (NODC Accession 0104278)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104278 includes physical and underway data collected aboard the KNORR during cruise KN195-12 in the North Pacific Ocean from 2009-07-27 to...

  17. Physical and underway data collected aboard the KNORR during cruise KN195-03 in the North Pacific Ocean and South Pacific Ocean from 2009-01-12 to 2009-02-23 (NODC Accession 0104265)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104265 includes physical and underway data collected aboard the KNORR during cruise KN195-03 in the North Pacific Ocean and South Pacific Ocean from...

  18. Physical and underway data collected aboard the KNORR during cruise KN195-08 in the North Pacific Ocean from 2009-05-04 to 2009-05-29 (NODC Accession 0104274)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104274 includes physical and underway data collected aboard the KNORR during cruise KN195-08 in the North Pacific Ocean from 2009-05-04 to...

  19. Physical and underway data collected aboard the KNORR during cruise KN195-06 in the North Pacific Ocean from 2009-04-07 to 2009-04-23 (NODC Accession 0104272)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104272 includes physical and underway data collected aboard the KNORR during cruise KN195-06 in the North Pacific Ocean from 2009-04-07 to...

  20. Latest Miocene-Pliocene Tiliviche Paleolake, Atacama Desert, Northern Chile 19.5°S: Paleoclimatic and Paleohydrologic Implications

    Science.gov (United States)

    Kirk-Lawlor, N. E.; Jordan, T. E.; Rech, J.; Lehmann, S.

    2010-12-01

    Endorheic paleolake deposits of diatomite, mudstone, sandstone, and evaporites are exposed in the Atacama Desert of northern Chile. This study focuses on a major latest Miocene-Pliocene paleolake system centered at 19.5°S, near Tiliviche. A diatiomite unit, up to 35m thick, composed of 0.2-1.5m thick beds of massive, white diatiomite, free of plant matter and root traces, is interpreted have formed from lacustrine diatom blooms. At its maximum extent, the lake would have had a surface area of roughly 200 km2, based on the extent of the diatomite unit, and might have been 50-100 m deep, as inferred by the relationship between the diatomite unit and modern topography. The Tiliviche paleolake initially formed before 6.4 Ma, and much of its sedimentary record formed under a wetter climatic and hydrologic regime than the present. Prior to 3.5 Ma, the lake had evolved into a groundwater-fed saltpan. Polygonally fractured efflorescent halite evaporite and bedded gypsum and gypsarenite evaporite deposits that overlie the diatomite unit are evidence of this saltpan environment. The modern Atacama Desert is hyperarid, with an average precipitation of 2 mm/yr in the driest areas. The paleosol record demonstrates that hyperarid conditions dominated this region since the middle Miocene, albeit with multiple fluctuations to less arid conditions of short to moderately long duration. This hyperaridity is due to the desert’s latitude, ocean currents and the rainshadow created by the Andes. There is no evidence that the rainshadow effect has diminished since the late Miocene, hence global climate changes affecting ocean temperatures and atmospheric patterns likely caused the wetter periods in the Atacama. In particular, prior workers noted wetter conditions in the region ~6-5 Ma, followed by a return to hyper-arid conditions. The regional Pliocene return to hyperaridity coincided with the desiccation of the Tiliviche endorheic lake system. During the late Miocene (~6-5 Ma) wetter

  1. Theoretical analysis of the time-resolved binary (e, 2e) binding energy spectra on three-body photodissociation of acetone at 195 nm

    Science.gov (United States)

    Yamazaki, M.; Nakayama, S.; Zhu, C. Y.; Takahashi, M.

    2017-11-01

    We report on theoretical progress in time-resolved (e, 2e) electron momentum spectroscopy of photodissociation dynamics of the deuterated acetone molecule at 195 nm. We have examined the predicted minimum energy reaction path to investigate whether associated (e, 2e) calculations meet the experimental results. A noticeable difference between the experiment and calculations has been found at around binding energy of 10 eV, suggesting that the observed difference may originate, at least partly, in ever-unconsidered non-minimum energy paths.

  2. Orbitally-driven evolution of Lake Turkana (Turkana Depression, Kenya, EARS) between 1.95 and 1.72 Ma: A sequence stratigraphy perspective

    Science.gov (United States)

    Nutz, Alexis; Schuster, Mathieu; Boës, Xavier; Rubino, Jean-Loup

    2017-01-01

    Lakes act as major archives for continental paleoenvironments, particularly when the evolution of lake levels over time serves as a guide for understanding regional paleohydrology and paleoclimate. In this paper, two sections from the Nachukui Formation (Turkana Depression, East African Rift System) provide a complete record of lake level variability and then paleohydrology for Lake Turkana between 1.95 and 1.72 Ma. This period corresponds to a key time during which important human evolutionary and technological innovations have occurred in East Africa and in the Turkana area. Based on sedimentary facies and sequence analyses on coastal deposits, one long-term regressive-transgressive cycle is identified between 1.95 and 1.72 Ma. Superimposed on this trend, five higher-frequency cycles of lake level change are identified between 1.87 and 1.76 Ma. Origins of these periodicities are attributed to orbital forcings. The extents of bathymetry change and shoreline migration during these periods are explored, suggesting that the period between 1.87 and 1.76 Ma was relatively dry and that climate experienced a relatively low variability. This finding differs strongly from most of the previous paleoenvironmental investigations in the region that argue high climate variability during a relatively wet period. This work emphasizes the importance of using sequence stratigraphy for analyzing lacustrine deposits.

  3. IRE1α-TRAF2-ASK1 complex-mediated endoplasmic reticulum stress and mitochondrial dysfunction contribute to CXC195-induced apoptosis in human bladder carcinoma T24 cells.

    Science.gov (United States)

    Zeng, Tao; Peng, Lifen; Chao, Haichao; Xi, Haibo; Fu, Bin; Wang, Yibing; Zhu, Zunwei; Wang, Gongxian

    2015-05-08

    Bladder urothelial carcinoma (UC) accounts for approximately 5% of all cancer deaths in humans. Current treatments extend the recurrence interval but do not significantly alter patient survival. The objective of the present study was to investigate the anti-cancer effect and the underlying mechanisms of CXC195 against human UC cell line T24 cells. CXC195 inhibited the cells growth and induced caspase- and mitochondrial-dependent apoptosis in T24 cells. In addition, CXC195 triggered activation of proteins involved in ER stress signaling including GRP78, CHOP, IRE1α, TRAF2, p-ASK1 and p-JNK in T24 cells. Co-immunoprecipitation experiments showed that activation of JNK was induced by the activation of IRE1α through formation of an IRE1α-TRAF2-ASK1 complex. Knockdown of IRE1α by siRNA dramatically abrogated CXC195-induced activation of TRAF2, ASK and JNK, formation of an IRE1α-TRAF2-ASK1 complex and caspase- and mitochondrial-dependent apoptosis in T24 cells. These findings provided new insights to understand the mode of action of CXC195 in treatment of human UC. Copyright © 2015 Elsevier Inc. All rights reserved.

  4. Production of high specific activity (195m) Pt-cisplatinum at South African Nuclear Energy Corporation for Phase 0 clinical trials in healthy individual subjects.

    Science.gov (United States)

    Zeevaart, Jan Rijn; Wagener, Judith; Marjanovic-Painter, Biljana; Sathekge, Mike; Soni, Nischal; Zinn, Christa; Perkins, Gary; Smith, Suzanne V

    2013-01-01

    Platinum agents continue to be the main chemotherapeutic agents used in the first-line and second-line treatments of cancer patients. It is important to fully understand the biological profile of these compounds in order to optimize the dose given to each patient. In a joint project with the Australian Nuclear Science and Technology Organisation and the Nuclear Medicine Department at Steve Biko Academic Hospital, South African Nuclear Energy Corporation synthesized and supplied (195m) Pt-cisplatinum (commonly referred to as cisplatin) for a clinical pilot study on healthy volunteers. Enriched (194) PtCl2 was prepared by digestion of enriched (194) Pt metal (>95%) followed by thermal decomposition over a 3 h period. The (194) PtCl2 was then placed in a quartz ampoule, was irradiated in SAFARI-1 up to 200 h, then decay cooled for a minimum of 34 h prior to synthesis of final product. (195m) Pt(NH3 )2 I2 , formed with the addition of KI and NH4 OH, was converted to the diaqua species [(195m) Pt(NH3 )2 (H2 O)2 ](2+) by reaction with AgNO3 . The conversion to (195m) Pt-cisplatinum was completed by the addition of concentrated HCl. The final product yield was 51.7% ± 5.2% (n = 5). The chemical and radionuclidic purity in each case was >95%. The use of a high flux reactor position affords a higher specific activity product (15.9 ± 2.5 MBq/mg at end of synthesis) than previously found (5 MBq/mg). Volunteers received between 108 and 126 MBq of radioactivity, which is equivalent to 6.8-10.0 mg of carrier cisplatinum. Such high specific activities afforded a significant reduction (~50%) in the chemical dose of a carrier cisplatinum, which represents less than 10% of a typical chemotherapeutic dose given to patients. A good manufacturing practice GMP compliant product was produced and was administered to 10 healthy volunteers as part of an ethically approved Phase 0 clinical trial. The majority of the injected activity 27.5% ± 5.8% was excreted

  5. Further search for the decay K+→π+νν¯ in the momentum region P<195 MeV/c

    Science.gov (United States)

    Adler, S.; Aoki, M.; Ardebili, M.; Atiya, M. S.; Bazarko, A. O.; Bergbusch, P. C.; Bhuyan, B.; Blackmore, E. W.; Bryman, D. A.; Chiang, I.-H.; Convery, M. R.; Diwan, M. V.; Frank, J. S.; Haggerty, J. S.; Inagaki, T.; Ito, M. M.; Jain, V.; Jaffe, D. E.; Kabe, S.; Kazumori, M.; Kettell, S. H.; Kitching, P.; Kobayashi, M.; Komatsubara, T. K.; Konaka, A.; Kuno, Y.; Kuriki, M.; Kycia, T. F.; Li, K. K.; Littenberg, L. S.; MacDonald, J. A.; McPherson, R. A.; Meyers, P. D.; Mildenberger, J.; Muramatsu, N.; Nakano, T.; Ng, C.; Ng, S.; Numao, T.; Otomo, A.; Poutissou, J.-M.; Poutissou, R.; Redlinger, G.; Sasaki, T.; Sato, T.; Shinkawa, T.; Shoemaker, F. C.; Smith, A. J. S.; Soluk, R.; Stone, J. R.; Strand, R. C.; Sugimoto, S.; Witzig, C.; Yoshimura, Y.

    2004-08-01

    We report the results of a search for the decay K+→π+νν¯ in the kinematic region with π+ momentum 140195 MeV/c using the data collected by the E787 experiment at BNL. No events were observed. When combined with our previous search in this region, one candidate event with an expected background of 1.22±0.24 events results in a 90% C.L. upper limit of 2.2×10-9 on the branching ratio of K+→π+νν¯. We also report improved limits on the rates of K+→π+X0 and K+→π+X1X2 where X0,X1,X2 are hypothetical, massless, long-lived neutral particles.

  6. Separation of {sup 195(m,g),197m}Hg from bulk gold target by liquid-liquid extraction using hydrophobic ionic liquids

    Energy Technology Data Exchange (ETDEWEB)

    Ghosh, Kaustab; Lahiri, Susanta [Saha Institute of Nuclear Physics, Kolkata (India). Chemical Sciences Div.; Maiti, Moumita [Indian Institute of Technology Roorkee, Roorkee (India). Dept. of Physics

    2017-07-01

    The {sup 195(m,g),197m}Hg radionuclides were produced in accelerator when natural Au foil was irradiated with 23 MeV protons. The no-carrier-added (NCA) Hg radioisotopes were separated from the bulk Au target by liquid-liquid extraction (LLX) employing hydrophobic RTILs 1-butyl-3-methylimidazolium hexafluorophosphate([C{sub 4}mim][PF{sub 6}]) and 1-butyl-3-methylimidazolium bis(trifluoromethylsulfonyl)imide([bmim][Tf{sub 2}N]) as extractant with HNO{sub 3} and HCl. In each case, bulk Au was extracted into the RTIL phase leaving NCA Hg-radionuclides in the aqueous phase. The RTILs were recovered by washing with 1 M K{sub 2}S{sub 2}O{sub 5} and freshly prepared 1 M FeSO{sub 4}. The reported separation methods follow green chemistry approach as it does not involve any volatile reagents.

  7. Characterization of Ni19.5Ti50.5Pd25Pt5 High-Temperature Shape Memory Alloy Springs and their Potential Application in Aeronautics

    Science.gov (United States)

    Stebner, Aaron; Padula, Santo A.; Noebe, Ronald D.

    2008-01-01

    Shape memory alloys (SMAs) have been used as actuators in many different industries since the discovery of the shape memory effect, but the use of SMAs as actuation devices in aeronautics has been limited due to the temperature constraints of commercially available materials. Consequently, work is being done at NASA's Glenn Research Center to develop new SMAs capable of being used in high temperature environments. One of the more promising high-temperature shape memory alloys (HTSMAs) is Ni19.5Ti50.5Pd25Pt5. Recent work has shown that this material is capable of being used in operating environments of up to 250 C. This material has been shown to have very useful actuation capabilities, demonstrating repeatable strain recoveries up to 2.5% in the presence of an externally applied load. Based on these findings, further work has been initiated to explore potential applications and alternative forms of this alloy, such as springs. Thus, characterization of Ni19.5Ti50.5Pd25Pt5 springs, including their mechanical response and how variations in this response correlate to changes in geometric parameters, are discussed. The effects of loading history, or training, on spring behavior were also investigated. A comparison of the springs with wire actuators is made and the benefits of using one actuator form as opposed to the other discussed. These findings are used to discuss design considerations for a surge-control mechanism that could be used in the centrifugal compressor of a T-700 helicopter engine.

  8. Physical studies on the binding of cis-dichlorodiamine platinum(II) to DNA and homopolynucleotides. [UV radiation, /sup 195/Pt tracer techniques

    Energy Technology Data Exchange (ETDEWEB)

    Munchausen, L.L.; Rahn, R.O.

    1975-01-01

    The amount of cis-dichlorodiamine platinum(II) bound to DNAs of varying (dA + dT) content was assayed by both ultraviolet absorbance spectrophotometry and the use of the radioisotope /sup 195/Pt. Radioisotope labeling indicates twice as much bound platinum as do optical measurements. The molar ratio of bound platinum r at saturation is approximately half the sum of the nearest-neighbor frequencies of all base-pairs that do not contain thymine. We therefore conclude that platinum does not bind to thymine in DNA. Chomatographic studies with (/sup 14/C) purine-labeled DNA indicate preferential binding of platinum to guanine, followed by binding to adenine. The luminescence properties of DNA and of homopolynucleotides are strongly affected by bound platinum as a result of a heavy-atom effect. A plot of the fluorescence-to-phosphorescence ratio as a function of r gives a saturation bind curve similar to that obtained using /sup 195/Pt. Ultraviolet irradiation of DNA treated with the platinum compound results in a 30 percent increase in the rate of formation of thymine homocyclobutadipyrimidine. When acetophenone sensitization is employed, platinum binding enhances cytosine homocyclobutadipyrimidine formation 10-fold, presumably because the triplet level of cytosine complexed with platinum is lowered below that of acetophenone. The viscosity of DNA decreases sharply upon binding platinum, with half the change occurring when less than 6 percent of the bases are complexed. From the rate of reaction with formaldehyde, we conclude that binding of the platinum compound to DNA induced small denatured regions that unwind in the presence of formaldehyde with a rate about 40 times slower than that of a single-strand chain break.

  9. Penyusunan Skedul Suhu dan Kelembaban Awal untuk Pengeringan di Dalam Tanur Pengering Konvensional bagi Kayu Durian Bersortimen 55 X 195 mm

    Directory of Open Access Journals (Sweden)

    Yustinus Suranto

    2009-07-01

    Full Text Available Schedule Development of Initial Temperature and Relative Humidity for Conventional Drying of Durian Wood in Dimension of 55 mm thick and 195 mm wide Decreasing supply of most commercial depterocarp wood as raw material inspirates wood working industry producing building construction component to look for uncommercial wood to be utilized. Proper utilization of these woods must be based on wood properties consisting of wood basic and processing properties. Drying property is one of the most important wood processing property. Proper drying process will be the main key to utilize effectively and ensure to get high quality wood product. Durian (Durio spp is one of uncommercial wood grown naturally in Sulawesi island forest. This wood is used by wood industr to produce building component to be exported. There is no yet drying schedule formulation of this wood lumber in dimension of 55mm thick and 195 mm wide. The objective of this research was to develop drying schedule for durian wood in that dimension. Drying schedule was developed by the result of quick drying test. The formulation of drying schedule was elaborated based on Terazawa method. The research result showed that initial moisture content and specific gravity of this wood was 103.4% and 0.4 respectively. Theoretically, the first drying schedule was 54oC as an initial remperature and 80oC as a final temperature. Web bulb depression for the initial step of drying was 4oC and for the end step was 30oC. The range of relative himidity were 80% to 17%. These drying schedule was coded by T5F6.

  10. High performance and highly durable infiltrated cathodes using Pr-modified Ce0.9Gd0.1O1.95 backbone

    DEFF Research Database (Denmark)

    Samson, Alfred Junio; Søgaard, Martin; Bonanos, Nikolaos

    2014-01-01

    Infiltration of electrocatalysts into ionic conducting backbones (e.g. Sr – doped LaCoO3 (LSC) into Ce0.9Gd0.1O1.95 (CGO)) is becoming a widely popular means of preparing composite cathodes for SOFCs. The high surface area nanoparticle grains of the electrocatalyst obtained using the method...

  11. Physical and underway data collected aboard the KNORR during cruise KN195-10 in the Bering Sea from 2009-06-14 to 2009-07-13 (NODC Accession 0104276)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104276 includes physical and underway data collected aboard the KNORR during cruise KN195-10 in the Bering Sea from 2009-06-14 to 2009-07-13. These...

  12. Electrochemical performance and stability of nano-particulate and bi-continuous La1-XSrXCoO3 and Ce0.9Gd0.1O1.95 composite electrodes

    DEFF Research Database (Denmark)

    Hjalmarsson, Per; Hallinder, Jonathan; Mogensen, Mogens Bjerg

    2012-01-01

    A bi-continuous porous cathode consisting of nano-particles of strontium substituted lanthanum cobaltite (LSC) covering the surface of a Ce0.9Gd0.1O1.95 (CGO10) backbone has been produced. The polarization resistance (R (P)) of this cathode was measured to similar to 35 m Omega cm(2) at 650 A deg...

  13. CANCER-ASSOCIATED ANTIGEN CA-195 IN PATIENTS WITH MUCINOUS OVARIAN-TUMORS - A COMPARATIVE-ANALYSIS WITH CEA, TATI AND CA-125 IN SERUM SPECIMENS AND CYST FLUIDS

    NARCIS (Netherlands)

    DEBRUIJN, HWA; TENHOOR, KA; MARRINK, J; KRANS, M; AALDERS, JG; Boonstra, J.

    1993-01-01

    The CA 195 levels in ovarian cyst fluids from malignant mucinous tumours (median 2,300,000 U/ml) were significantly higher than the levels in benign mucinous tumours and malignant non-mucinous tumours (medians of 26,800 and 1,700 U/ml, respectively, p = 0.039 and 0.011). Also, the carcinoembryonic

  14. RILEM technical committee 195-DTD recommendation for test methods for AD and TD of early age concrete Round Robin documentation report : program, test results and statistical evaluation

    CERN Document Server

    Bjøntegaard, Øyvind; Krauss, Matias; Budelmann, Harald

    2015-01-01

    This report presents the Round-Robin (RR) program and test results including a statistical evaluation of the RILEM TC195-DTD committee named “Recommendation for test methods for autogenous deformation (AD) and thermal dilation (TD) of early age concrete”. The task of the committee was to investigate the linear test set-up for AD and TD measurements (Dilation Rigs) in the period from setting to the end of the hardening phase some weeks after. These are the stress-inducing deformations in a hardening concrete structure subjected to restraint conditions. The main task was to carry out an RR program on testing of AD of one concrete at 20 °C isothermal conditions in Dilation Rigs. The concrete part materials were distributed to 10 laboratories (Canada, Denmark, France, Germany, Japan, The Netherlands, Norway, Sweden and USA), and in total 30 tests on AD were carried out. Some supporting tests were also performed, as well as a smaller RR on cement paste. The committee has worked out a test procedure recommenda...

  15. A Retrospective Analysis of 5,195 Patient Treatment Sessions in an Integrative Veterinary Medicine Service: Patient Characteristics, Presenting Complaints, and Therapeutic Interventions

    Directory of Open Access Journals (Sweden)

    Justin Shmalberg

    2015-01-01

    Full Text Available Integrative veterinary medicine, the combination of complementary and alternative therapies with conventional care, is increasingly prevalent in veterinary practice and a focus of clinical instruction in many academic teaching institutions. However, the presenting complaints, therapeutic modalities, and patient population in an integrative medicine service have not been described. A retrospective analysis of 5,195 integrative patient treatment sessions in a veterinary academic teaching hospital demonstrated that patients most commonly received a combination of therapeutic modalities (39% of all treatment sessions. The 274 patients receiving multiple modalities were most frequently treated for neurologic and orthopedic disease (50.7% versus 49.6% of all presenting complaints, resp.. Older neutered or spayed dogs (mean age = 9.0 years and Dachshunds were treated more often than expected based on general population statistics. Acupuncture, laser therapy, electroacupuncture, and hydrotherapy were frequently administered (>50% patients. Neurologic patients were more likely to receive acupuncture, electroacupuncture, and therapeutic exercises but less likely than orthopedic patients to receive laser, hydrotherapy, or therapeutic ultrasound treatments (P<0.05. The results suggest that the application of these specific modalities to orthopedic and neurologic diseases should be subjected to increased evidence-based investigations. A review of current knowledge in core areas is presented.

  16. Imported leishmaniasis in the Netherlands from 2005 to 2012: epidemiology, diagnostic techniques and sequence-based species typing from 195 patients.

    Science.gov (United States)

    Bart, A; van Thiel, P P A M; de Vries, H J C; Hodiamont, C J; Van Gool, T

    2013-07-25

    Leishmaniasis is an imported disease in the Netherlands. We report data for the period between 2005 and 2012, on clinical presentation, country where leishmaniasis was acquired, and causative species, for 195 civilian and military patients who had travelled abroad. Most patients were affected by cutaneous leishmaniasis (CL) (n=185 patients), while visceral leishmaniasis (VL) (n=8 patients) and mucocutaneous leishmaniasis (n=2 patients) were less frequently observed. All VL patients had been infected in Europe. CL was mainly acquired in Afghanistan, Surinam, Morocco and Spain. The majority of CL patients consisted of military personnel (55%, 102/185), 78 of whom had been infected during an outbreak in Afghanistan. Parasitological diagnosis was made by a combination of polymerase chain reaction (PCR), microscopy and culture. Compared to a standard of parasitological proof by any method other than the one under consideration, sensitivities of the individual methods ranged from 73% to 98%. Microscopy was least sensitive, but is fast and cheap. Mini-exon repeat PCR combines high sensitivity and specificity, and allows differentiation between species by sequencing of the PCR product. Eight different species or species complexes were identified, allowing species-specific therapy. Four patients proved infected with Leishmania naiffi, a hitherto rarely described cause of leishmaniasis. In comparison to previous decennia, an increase in cutaneous leishmaniasis was observed in our hospital, both in civilian and military patients who had travelled abroad. This calls for increased awareness among clinicians, availability of diagnostic tests and species-specific treatment guidelines in non-endemic countries.

  17. Treatment of simulated wastewater containing Reactive Red 195 by zero-valent iron/activated carbon combined with microwave discharge electrodeless lamp/sodium hypochlorite.

    Science.gov (United States)

    Fu, Jie; Xu, Zhen; Li, Qing-Shan; Chen, Song; An, Shu-Qing; Zeng, Qing-Fu; Zhu, Hai-Liang

    2010-01-01

    A comparative study of treatment of simulated wastewater containing Reactive Red 195 using zero-valent iron/activated carbon (ZVI/AC), microwave discharge electrodeless lamp/sodium hypochlorite (MDEL/NaClO) and the combination of ZVI/AC-MDEL/NaClO was conducted. The preliminary results showed the two steps method of ZVI/AC-MDEL/NaClO had much higher degradation efficiency than both single steps. The final color removal percentage was nearly up to 100% and the chemical oxygen demand reduction percentage was up to approximately 82%. The effects of operational parameters, including initial pH value of simulated wastewater, ZVI/AC ratio and particle size of ZVI were also investigated. In addition, from the discussion of synergistic effect between ZVI/AC and MEDL/NaClO, we found that in the ZVI/AC-MEDL/NaClO process, ZVI/AC could break the azo bond firstly and then MEDL/NaClO degraded the aromatic amine products effectively. Reversing the order would reduce the degradation efficiency.

  18. A Retrospective Analysis of 5,195 Patient Treatment Sessions in an Integrative Veterinary Medicine Service: Patient Characteristics, Presenting Complaints, and Therapeutic Interventions

    Science.gov (United States)

    Memon, Mushtaq A.

    2015-01-01

    Integrative veterinary medicine, the combination of complementary and alternative therapies with conventional care, is increasingly prevalent in veterinary practice and a focus of clinical instruction in many academic teaching institutions. However, the presenting complaints, therapeutic modalities, and patient population in an integrative medicine service have not been described. A retrospective analysis of 5,195 integrative patient treatment sessions in a veterinary academic teaching hospital demonstrated that patients most commonly received a combination of therapeutic modalities (39% of all treatment sessions). The 274 patients receiving multiple modalities were most frequently treated for neurologic and orthopedic disease (50.7% versus 49.6% of all presenting complaints, resp.). Older neutered or spayed dogs (mean age = 9.0 years) and Dachshunds were treated more often than expected based on general population statistics. Acupuncture, laser therapy, electroacupuncture, and hydrotherapy were frequently administered (>50% patients). Neurologic patients were more likely to receive acupuncture, electroacupuncture, and therapeutic exercises but less likely than orthopedic patients to receive laser, hydrotherapy, or therapeutic ultrasound treatments (P < 0.05). The results suggest that the application of these specific modalities to orthopedic and neurologic diseases should be subjected to increased evidence-based investigations. A review of current knowledge in core areas is presented. PMID:26798552

  19. Gasura 195-205.pmd

    African Journals Online (AJOL)

    Prof. Adipala Ekwamu

    Sweet potato virus disease (SPVD) is the most important disease of sweetpotato in the tropics. It causes yield losses of up to 98% and extinction of elite cultivars. Although there are no reports of immune cultivars, disease recovery phenomenon (a manifestation of some form of resistance) was reported in many vegetatively ...

  20. Classification of neck/shoulder pain in epidemiological research: a comparison of personal and occupational characteristics, disability, and prognosis among 12,195 workers from 18 countries.

    Science.gov (United States)

    Sarquis, Leila M M; Coggon, David; Ntani, Georgia; Walker-Bone, Karen; Palmer, Keith T; Felli, Vanda E; Harari, Raul; Barrero, Lope H; Felknor, Sarah A; Gimeno, David; Cattrell, Anna; Vargas-Prada, Sergio; Bonzini, Matteo; Solidaki, Eleni; Merisalu, Eda; Habib, Rima R; Sadeghian, Farideh; Kadir, M Masood; Warnakulasuriya, Sudath S P; Matsudaira, Ko; Nyantumbu, Busisiwe; Sim, Malcolm R; Harcombe, Helen; Cox, Ken; Marziale, Maria H; Harari, Florencia; Freire, Rocio; Harari, Natalia; Monroy, Magda V; Quintana, Leonardo A; Rojas, Marianela; Harris, E Clare; Serra, Consol; Martinez, J Miguel; Delclos, George; Benavides, Fernando G; Carugno, Michele; Ferrario, Marco M; Pesatori, Angela C; Chatzi, Leda; Bitsios, Panos; Kogevinas, Manolis; Oha, Kristel; Freimann, Tiina; Sadeghian, Ali; Peiris-John, Roshini J; Sathiakumar, Nalini; Wickremasinghe, A Rajitha; Yoshimura, Noriko; Kelsall, Helen L; Hoe, Victor C W; Urquhart, Donna M; Derrett, Sarah; McBride, David; Herbison, Peter; Gray, Andrew; Salazar Vega, Eduardo J

    2016-05-01

    To inform case definition for neck/shoulder pain in epidemiological research, we compared levels of disability, patterns of association, and prognosis for pain that was limited to the neck or shoulders (LNSP) and more generalised musculoskeletal pain that involved the neck or shoulder(s) (GPNS). Baseline data on musculoskeletal pain, disability, and potential correlates were collected by questionnaire from 12,195 workers in 47 occupational groups (mostly office workers, nurses, and manual workers) in 18 countries (response rate = 70%). Continuing pain after a mean interval of 14 months was ascertained through a follow-up questionnaire in 9150 workers from 45 occupational groups. Associations with personal and occupational factors were assessed by Poisson regression and summarised by prevalence rate ratios (PRRs). The 1-month prevalence of GPNS at baseline was much greater than that of LNSP (35.1% vs 5.6%), and it tended to be more troublesome and disabling. Unlike LNSP, the prevalence of GPNS increased with age. Moreover, it showed significantly stronger associations with somatising tendency (PRR 1.6 vs 1.3) and poor mental health (PRR 1.3 vs 1.1); greater variation between the occupational groups studied (prevalence ranging from 0% to 67.6%) that correlated poorly with the variation in LNSP; and was more persistent at follow-up (72.1% vs 61.7%). Our findings highlight important epidemiological distinctions between subcategories of neck/shoulder pain. In future epidemiological research that bases case definitions on symptoms, it would be useful to distinguish pain that is localised to the neck or shoulder from more generalised pain that happens to involve the neck/shoulder region.

  1. Effects of gestational exposure to 1.95-GHz W-CDMA signals for IMT-2000 cellular phones: Lack of embryotoxicity and teratogenicity in rats.

    Science.gov (United States)

    Ogawa, Kumiko; Nabae, Kyoko; Wang, Jianqing; Wake, Kanako; Watanabe, So-ichi; Kawabe, Mayumi; Fujiwara, Osamu; Takahashi, Satoru; Ichihara, Toshio; Tamano, Seiko; Shirai, Tomoyuki

    2009-04-01

    The present study was designed to evaluate whether gestational exposure to an EMF targeting the head region, similar to that from cellular phones, might affect embryogenesis in rats. A 1.95-GHz wide-band code division multiple access (W-CDMA) signal, which is one applied for the International Mobile Telecommunication 2000 (IMT-2000) system and used for the freedom of mobile multimedia access (FOMA), was employed for exposure to the heads of four groups of pregnant CD(SD) IGS rats (20 per group) for gestational days 7-17. The exposure was performed for 90 min/day in the morning. The spatial average specific absorption rate (SAR) for individual brains was designed to be 0.67 and 2.0 W/kg with peak brain SARs of 3.1 and 7.0 W/kg for low (group 3) and high (group 4) exposures, respectively, and a whole-body average SAR less than 0.4 W/kg so as not to cause thermal effects due to temperature elevation. Control and sham exposure groups were also included. At gestational day 20, all dams were killed and fetuses were taken out by cesarean section. There were no differences in maternal body weight gain. No adverse effects of EMF exposure were observed on any reproductive and embryotoxic parameters such as number of live (243-271 fetuses), dead or resorbed embryos, placental weights, sex ratios, weights or external, visceral or skeletal abnormalities of live fetuses. (c) 2008 Wiley-Liss, Inc.

  2. Insights into the fine-grained fraction of serpentine mud from the Southern Chamorro seamount (ODP Leg 195): A combined XRD, RFA and TEM-EDS study

    Science.gov (United States)

    Lischka, M.; Meschede, M.; Warr, L. N.

    2009-12-01

    Serpentine mud volcanoes in the outer forearc of the Izu-Bonin-Mariana subduction system occur in a restricted zone, 50km - 120 km away from the trench axis [Fryer et al., 1985]. The morphotectonic elements of the forearc are dominated by horst and graben structures, caused by extensional movements and normal fault systems related to seamount subduction [Fryer et al., 2000; Stern and Smooth, 1998]. These faults may provide conduits for the diapiric uprising of low density serpentine, extruding at the seafloor in stratovolcanic like structures. Released fluids from the subducted slab at estimated depths of approximately 30km are considered to hydrate the forearc mantle wedge along those fractures [Benton et al., 2001; Mottl et al., 2003; Rübke et al., 2004]. During the formation of the fault gouge, serpentine-bodies entrained xenoliths and xenocrysts from the surrounding rocks and are exhumed towards the surface [Fryer et al., 1990]. In our investigation we focus on the silty to clay-sized particle fraction of the serpentine mud matrix, drilled during ODP Leg 195 at site 1200E. We analysed the bulk mineral composition with X-ray diffraction methods on random powder samples, supplemented by X-ray fluorescence measurements on 25 samples. To obtain more insights into the mineralogy fabric and microstructure of the samples, electron microscopy and electron dispersive spectroscopy were used to determine the crystal-chemistry and alteration textures. Particular emphasis was given on determining serpentine polymorphs and the nature of other phyllosilicates and their geochemical composition and constraints. Geochemical observation of the secondary mineral phases should allow us to reconstruct the processes linked with the migration of fluids and volatile components during subduction related metamorphism affecting the mantle wedge. Based on the new data we characterize the conditions of alteration products within a subduction factory, related to the diapiric deposition of

  3. The Mantle Wedge of the Mariana Subduction Factory: Investigation on Peridotite Clasts Cored at South Chamorro Seamount, Site 1200, ODP Leg 195

    Science.gov (United States)

    D'Antonio, M.; Spadea, P.; Savov, I.

    2002-12-01

    The South Chamorro Seamount is a serpentine mud volcano located in the Mariana forearc region. It has been cored during Ocean Drilling Program Leg 195 (March-May 2001; Site 1200). It is made up of serpentine mud coming from the downgoing Pacific plate, which is about 30 km deep beneath the seamount. The mud encloses clasts of ultramafic rocks from the overriding plate. The clasts are mostly harzburgite, with minor dunite and lherzolite, strongly serpentinized and tectonized. The primary mineralogy includes olivine, orthopyroxene, clinopyroxene and chromium-spinel. The samples show typical mesh and hourglass serpentine textures, and contain veins of serpentine, brucite and chlorite. Whole-rock chemistry shows Mg# = 91-93, and high Ni and Cr contents. Low CaO and Al2O3 contents, and very low REE contents with U-shaped, strongly LREE-enriched and HREE-depleted, patterns confirm that most of the analyzed samples are highly residual peridotites which suffered extensive partial melting (20-25%), and contain an enriched component. The only lherzolite sample shows a significantly lower degree of depletion, slightly higher than 15%. In the analyzed sample set, olivine has Fo = 91.5-92.5, with Ni content in the 2200-4200 ppm range, enstatite has Al2O3 = 0.8-2.6 wt.% and CaO = 0.2-2.1 wt.%. Also diopside is chemically variable, with Mg# = 93-99, and low to very low Cr, Na and Al contents. Diopside from the lherzolite sample has higher Al and significantly lower Na than in most harzburgites. Chemical variations and textural differences of pyroxenes suggest that the peridotites underwent recrystallization and metasomatism after melt extraction.

  4. Clinical classifications of atrial fibrillation poorly reflect its temporal persistence: insights from 1,195 patients continuously monitored with implantable devices.

    Science.gov (United States)

    Charitos, Efstratios I; Pürerfellner, Helmut; Glotzer, Taya V; Ziegler, Paul D

    2014-07-01

    This study aimed to identify how accurately the current clinical atrial fibrillation (AF) classifications reflect its temporal persistence. Clinical classification of AF is employed to communicate its persistence, to select appropriate therapies, and as inclusion criterion for clinical trials. Cardiac rhythm histories of 1,195 patients (age 73.0 ± 10.1 years, follow-up: 349 ± 40 days) with implantable devices were reconstructed and analyzed. Patients were classified as having paroxysmal or persistent AF by physicians at baseline in accordance with current guidelines. AF burden, measured as the proportion of time spent in AF, was obtained from the device. Additionally we evaluated the agreement between clinical and device-derived AF classifications. Patients within the same clinical class were highly heterogeneous with regards to AF temporal persistence. Agreement between the clinical AF classification and the objective device-derived assessments of AF temporal persistence was poor (Cohen's kappa: 0.12 [95% CI: 0.05 to 0.18]). Patient characteristics influenced the clinical decision to classify AF as paroxysmal or persistent. Higher ejection fraction (odds ratio: 0.97/per unit [95% CI: 0.95 to 0.98/per unit]; p classifications poorly reflect AF temporal persistence. Patient characteristics significantly influence the physician's classification of AF. Patients classified in identical clinical categories may be inherently heterogeneous with regard to AF temporal persistence. Further study is required to determine if patient selection on the basis of objective criteria derived from rigorous AF monitoring can improve reported outcomes and better identify responders and non-responders to treatments. (OMNI Study-Assessing Therapies in Medtronic Pacemaker, Defibrillator, and Cardiac Resynchronization Therapy Devices; NCT00277524; TRENDS: A Prospective Study of the Clinical Significance of Atrial Arrhythmias Detected by Implanted Device Diagnostics; NCT00279981

  5. Pumping Iron in Australia: Prevalence, Trends and Sociodemographic Correlates of Muscle Strengthening Activity Participation from a National Sample of 195,926 Adults.

    Science.gov (United States)

    Bennie, Jason A; Pedisic, Zeljko; van Uffelen, Jannique G Z; Charity, Melanie J; Harvey, Jack T; Banting, Lauren K; Vergeer, Ineke; Biddle, Stuart J H; Eime, Rochelle M

    2016-01-01

    The current Australian Physical Activity Guidelines recommend that adults engage in regular muscle-strengthening activity (e.g. strength or resistance training). However, public health surveillance studies describing the patterns and trends of population-level muscle-strengthening activity participation are sparse. The aim of this study is to examine the prevalence, trends and sociodemographic correlates of muscle-strengthening activity participation in a national-representative sample of Australians aged 15 years and over. Between 2001 and 2010, quarterly cross-sectional national telephone surveys were conducted as part of the Australian Sports Commission's 'Exercise, Recreation and Sport Survey'. Pooled population-weighted proportions were calculated for reporting: [i] no muscle-strengthening activity; [ii] insufficient muscle-strengthening activity, and [iii] sufficient muscle-strengthening activity. Associations with sociodemographic variables were assessed using multiple logistic regression analyses. Out of 195,926 participants, aged 15-98 years, only 10.4% (95% CI: 10.1-10.7) and 9.3% (95% CI: 9.1-9.5) met the muscle-strengthening activity recommendations in the past two weeks and in the past year, respectively. Older adults (50+ years), and those living in socioeconomically disadvantaged, outer regional/remote areas and with lower education were less likely to report sufficient muscle-strengthening activity (p<0.001). Over the 10-year monitoring period, there was a significant increase in the prevalence of sufficient muscle-strengthening activity (6.4% to 12.0%, p-value for linear trend <0.001). A vast majority of Australian adults did not engage in sufficient muscle-strengthening activity. There is a need for public health strategies to support participation in muscle-strengthening activity in this population. Such strategies should target older and lower educated adults, and those living in socioeconomically disadvantaged, outer regional/remote and areas.

  6. Parameters detected by geriatric and quality of life assessment in 195 older patients with myelodysplastic syndromes and acute myeloid leukemia are highly predictive for outcome.

    Science.gov (United States)

    Deschler, Barbara; Ihorst, Gabriele; Platzbecker, Uwe; Germing, Ulrich; März, Eva; de Figuerido, Marcelo; Fritzsche, Kurt; Haas, Peter; Salih, Helmut R; Giagounidis, Aristoteles; Selleslag, Dominik; Labar, Boris; de Witte, Theo; Wijermans, Pierre; Lübbert, Michael

    2013-02-01

    Myelodysplastic syndromes and acute myeloid leukemia exemplify the complexity of treatment allocation in older patients as options range from best supportive care, non-intensive treatment (e.g. hypomethylating agents) to intensive chemotherapy/hematopoietic cell transplantation. Novel metrics for non-disease variables are urgently needed to help define the best treatment for each older patient. We investigated the feasibility and prognostic value of geriatric/quality of life assessments aside from established disease-specific variables in 195 patients aged 60 years or over with myelodysplastic syndromes/acute myeloid leukemia. These patients were grouped according to treatment intensity and assessed. Assessment consisted of eight instruments evaluating activities of daily living, depression, mental functioning, mobility, comorbidities, Karnofsky Index and quality of life. Patients with a median age of 71 years (range 60-87 years) with myelodysplastic syndromes (n=63) or acute myeloid leukemia (n=132) were treated either with best supportive care (n=47), hypomethylating agents (n=73) or intensive chemotherapy/hematopoietic cell transplantation (n=75). After selection of variables, pathological activities of daily living and quality of life/fatigue remained highly predictive for overall survival in the entire patient group beyond disease-related risk factors adverse cytogenetics and blast count of 20% or over. In 107 patients treated non-intensively activities of daily living of less than 100 (hazard ratio, HR 2.94), Karnofsky Index below 80 (HR 2.34) and quality of life/'fatigue' of 50 or over (HR 1.77) were significant prognosticators. Summation of adverse features revealed a high risk of death (HR 9.36). In-depth evaluation of older patients prior to individual treatment allocation is feasible and provides additional information to standard assessment. Patients aged 60 years or over with newly diagnosed myelodysplastic syndromes/acute myeloid leukemia and

  7. Pumping Iron in Australia: Prevalence, Trends and Sociodemographic Correlates of Muscle Strengthening Activity Participation from a National Sample of 195,926 Adults.

    Directory of Open Access Journals (Sweden)

    Jason A Bennie

    Full Text Available The current Australian Physical Activity Guidelines recommend that adults engage in regular muscle-strengthening activity (e.g. strength or resistance training. However, public health surveillance studies describing the patterns and trends of population-level muscle-strengthening activity participation are sparse. The aim of this study is to examine the prevalence, trends and sociodemographic correlates of muscle-strengthening activity participation in a national-representative sample of Australians aged 15 years and over.Between 2001 and 2010, quarterly cross-sectional national telephone surveys were conducted as part of the Australian Sports Commission's 'Exercise, Recreation and Sport Survey'. Pooled population-weighted proportions were calculated for reporting: [i] no muscle-strengthening activity; [ii] insufficient muscle-strengthening activity, and [iii] sufficient muscle-strengthening activity. Associations with sociodemographic variables were assessed using multiple logistic regression analyses.Out of 195,926 participants, aged 15-98 years, only 10.4% (95% CI: 10.1-10.7 and 9.3% (95% CI: 9.1-9.5 met the muscle-strengthening activity recommendations in the past two weeks and in the past year, respectively. Older adults (50+ years, and those living in socioeconomically disadvantaged, outer regional/remote areas and with lower education were less likely to report sufficient muscle-strengthening activity (p<0.001. Over the 10-year monitoring period, there was a significant increase in the prevalence of sufficient muscle-strengthening activity (6.4% to 12.0%, p-value for linear trend <0.001.A vast majority of Australian adults did not engage in sufficient muscle-strengthening activity. There is a need for public health strategies to support participation in muscle-strengthening activity in this population. Such strategies should target older and lower educated adults, and those living in socioeconomically disadvantaged, outer regional

  8. Sacro-spinous ligament fixation peri-operative complications in 195 cases: visual approach versus digital approach of the sacro-spinous ligament.

    Science.gov (United States)

    David-Montefiore, Emmanuel; Garbin, Olivier; Hummel, Michel; Nisand, Israel

    2004-09-10

    To evaluate sacro-spinous ligament fixation (SLF) peri-operative complications. Monocentric, retrospective study. Department of Gynecology, SIHCUS-CMCO, University Hospital, Strasbourg, France. Between January 1990 and December 2000, 195 women, mean age 63.2 years old (40-90), underwent a vaginal SLF. Ninety point eight percent of women were post-menopaused and 27.9% of these had a hormonal substitution. About 24% of patients had prior hysterectomy, 20% vaginal prolapse repair and 22% urinary stress incontinence repair. SLF was performed in 1.5% of cases without any other procedures and it was combined with the following: rectocele and elytrocele repair in 89.2%, hysterectomy in 72.3%, cystocele repair in 52.8% and stress incontinence repair in 15.3% of cases. In 107 cases, the SLF attachment was placed under digital control and in 88 cases under visual control. The mean hospitalisation stay was of 8.5 +/- 2.6 days (4-26). About 41% of women presented a complication. Major complications were represented by 3.6% of bladder injury, 0.5% of uretero-vaginal fistula, 0.5% of vascular injuries, 0.5% of thromboembolic events. In 38% of cases patients had minor complications: urinary tract infections (29%), temporary urinary retention (5.6%), local complications (4.5%), and other complications (3%). The only specific SLF complication in this data was a vascular injury and in this case the SLF was performed under digital control. The global peri-operative complication frequency of SLF is high. It is mainly represented by non-specific complications, secondary to the combined procedures and not to the SLF itself. The specific complications due to SLF, all of which are major ones, can be avoided or diagnosed earlier, by using the visual approach technique.

  9. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  10. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  11. Global, regional, and national incidence, prevalence, and years lived with disability for 328 diseases and injuries for 195 countries, 1990-2016:a systematic analysis for the Global Burden of Disease Study 2016

    OpenAIRE

    Abajobir, Amanuel Alemu; Abate, Kalkidan Hassen; Abbafati, Cristiana; Abbas, Kaja M; Abd-Allah, Foad; Abdulkader, Rizwan Suliankatchi; Abdulle, Abdishakur M.; Abebo, Teshome Abuka; Abera, Semaw Ferede; Aboyans, Victor; Abu-Raddad, Laith J.; Ackerman, Ilana N.; Adamu, Abdu Abdullahi; Adetokunboh, Olatunji; Afarideh, Mohsen

    2017-01-01

    Background: \\ud \\ud As mortality rates decline, life expectancy increases, and populations age, non-fatal outcomes of diseases and injuries are becoming a larger component of the global burden of disease. The Global Burden of Diseases, Injuries, and Risk Factors Study 2016 (GBD 2016) provides a comprehensive assessment of prevalence, incidence, and years lived with disability (YLDs) for 328 causes in 195 countries and territories from 1990 to 2016.\\ud \\ud Methods: \\ud \\ud We estimated prevale...

  12. Resolving the Differences Between the 1.9 Å and 1.95 Å Crystal Structures of Photosystem II: A Single Proton Relocation Defines Two Tautomeric Forms of the Water-Oxidizing Complex.

    Science.gov (United States)

    Petrie, Simon; Pace, Ron J; Stranger, Rob

    2015-06-08

    Great progress has been made in characterizing the water-oxidizing complex (WOC) in photosystem II (PSII) with the publication of a 1.9 Å resolution X-ray diffraction (XRD) and recently a 1.95 Å X-ray free-electron laser (XFEL) structure. However, these achievements are under threat because of perceived conflicts with other experimental data. For the earlier 1.9 Å structure, lack of agreement with extended X-ray absorption fine structure (EXAFS) data led to the notion that the WOC suffered from X-ray photoreduction. In the recent 1.95 Å structure, Mn photoreduction is not an issue, but poor agreement with computational models which adopt the 'high' oxidation state paradigm, has again resulted in criticism of the structure on the basis of contamination with lower S states of the WOC. Here we use DFT modeling to show that the distinct WOC geometries in the 1.9 and 1.95 Å structures can be straightforwardly accounted for when the Mn oxidation states are consistent with the 'low' oxidation state paradigm. Remarkably, our calculations show that the two structures are tautomers, related by a single proton relocation. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. Temperature dependent kinetics (195-798 K) and H atom yields (298-498 K) from reactions of (1)CH(2) with acetylene, ethene, and propene.

    Science.gov (United States)

    Gannon, K L; Blitz, M A; Liang, C H; Pilling, M J; Seakins, P W; Glowacki, D R

    2010-09-09

    The rate coefficients for the removal of the excited state of methylene, (1)CH(2) (a(1)A(1)), by acetylene, ethene, and propene have been studied over the temperature range 195-798 K by laser flash photolysis, with (1)CH(2) being monitored by laser-induced fluorescence. The rate coefficients of all three reactions exhibit a negative temperature dependence that can be parametrized as k((1)CH(2)+C(2)H(2)) = (3.06 +/- 0.11) x 10(-10) T ((-0.39+/-0.07)) cm(3) molecule(-1) s(-1), k((1)CH(2)+C(2)H(4)) = (2.10 +/- 0.18) x 10(-10) T ((-0.84+/-0.18)) cm(3) molecule(-1) s(-1), k((1)CH(2)+C(3)H(6)) = (3.21 +/- 0.02) x 10(-10) T ((-0.13+/-0.01)) cm(3) molecule(-1) s(-1), where the errors are statistical at the 2sigma level. Removal of (1)CH(2) occurs by chemical reaction and electronic relaxation to ground state triplet methylene. The H atom yields from the reactions of (1)CH(2) with acetylene, ethene, and propene have been determined by laser-induced fluorescence over the temperature range 298-498 K. For the reaction with propene, H atom yields are close to the detection limit, but for acetylene and ethene, the fraction of H atom production is approximately 0.88 and 0.71, respectively, at 298 K, rising to unity by 398 K, with the balance of the reaction with acetylene presumed to be electronic relaxation. Experimental constraints limit studies to a maximum of 1 Torr of bath gas; master equation calculations using an approach that allows treatment of intermediates with deep energy wells have been carried out to explore the role of collisional stabilization for the reaction of (1)CH(2) with acetylene. Stabilization is calculated to be insignificant under the experimental conditions, but does become significant at higher pressures. Between pressures of 100 and 1000 Torr, propyne and allene are formed in similar amounts with a slight preference for propyne. At higher pressures propyne formation becomes about a factor two greater than that of allene, and above 10(5) Torr (300 < T

  14. Hydrogen absorption in Mg1.95Ti0.05Ni0.95Cu0.05 alloy prepared with mechanical alloying and thermal treatment; Absorcion de hidrogeno en la aleacion Mg1.95Ti0.05Ni0.95Cu0.05 preparada por aleado mecanico y tratamiento termico

    Energy Technology Data Exchange (ETDEWEB)

    Martinez, Juan Bonifacio; Urena Nunez, Fernando [Instituto Nacional de Investigaciones Nucleares, Ocoyoacac, Estado de Mexico (Mexico)]. E-mail: juan.bonifacio@inin.gob.mx

    2009-09-15

    This work presents hydrogen absorption in quaternary alloy Mg1.95Ti0.05Ni0.95Cu0.05 obtained by the mechanical alloying method, followed by thermal treatment in ultra-high pure argon atmosphere. The composition of the phases, microstructure and morphology of ground powders and with thermal treatment were characterized by DRX, SEM/EDS and TEM. After 20 hours of mechanical grinding and recooked at 300 degrees Celsius/1h in argon atmosphere, the quaternary alloy has a Mg{sub 2}Ni crystalline hexagonal structure with a crystallite size under 10 nm. The absorption measurements were performed under a pressure of 0.2 to 1.2 MPa at a temperature of 200 degrees Celsius in a micro-reactor. The quantification of absorption-desorption of hydrogen in the intermetallic was conducted in a TGA-DSC simultaneous calorimeter. Metallic hydride-dehydride powder was characterized with SEM and XRD. [Spanish] En este trabajo se presenta la absorcion de hidrogeno en la aleacion cuaternaria Mg1.95Ti0.05Ni0.95Cu0.05 obtenida por el metodo de aleado mecanico, seguida de tratamiento termico en atmosfera de argon de ultra alta pureza. La composicion de las fases, microestructura y morfologia de los polvos molidos y con tratamiento termico fue caracterizada por DRX, SEM/EDS y TEM. Despues de 20 h de molienda mecanica con recocido a 300 grados Celsios/1h en atmosfera de argon, la aleacion cuaternaria tiene una estructura cristalina hexagonal Mg{sub 2}Ni con tamano de cristalito menor a 10 nm. Las mediciones de absorcion fueron realizadas bajo una presion de 0.2 a 1.2 MPa a una temperatura de 200 grados Celsios en un micro-reactor. La cuantificacion de absorcion-desorcion de hidrogeno en el intermetalico se realizo en un calorimetro simultaneo TGA-DSC. Se determino que la cantidad maxima absorbida de hidrogeno en la aleacion cuaternaria fue de 3.24% en peso cuando la presion fue de 0.8 MPa a dicha temperatura. Polvos metalicos hidrurados-deshidrurados se caracterizaron por SEM y XRD.

  15. Lack of promoting effects of chronic exposure to 1.95-GHz W-CDMA signals for IMT-2000 cellular system on development of N-ethylnitrosourea-induced central nervous system tumors in F344 rats.

    Science.gov (United States)

    Shirai, Tomoyuki; Ichihara, Toshio; Wake, Kanako; Watanabe, So-ichi; Yamanaka, Yukio; Kawabe, Mayumi; Taki, Masao; Fujiwara, Osamu; Wang, Jianqing; Takahashi, Satoru; Tamano, Seiko

    2007-10-01

    The present study was performed to evaluate effects of a 2-year exposure to an electromagnetic near-field (EMF) equivalent to that generated by cellular phones on tumor development in the central nervous system (CNS) of rats. For this purpose, pregnant F344 rats were given a single administration of N-ethylnitrosourea (ENU) on gestational day 18. A total of 500 pups were divided into five groups, each composed of 50 males and 50 females: Group 1, untreated controls; Group 2, ENU alone; Groups 3 to 5, ENU + EMF (sham exposure and two exposure levels). A 1.95-GHz wide-band code division multiple access (W-CDMA) signal, which is a feature of the International Mobile Telecommunication 2000 (IMT-2000) cellular system was employed for exposure of the rat head starting from 5 weeks of age, 90 min a day, 5 days a week, for 104 weeks. Brain average specific absorption rates (SARs) were designed to be .67 and 2.0 W/kg for low and high exposures, respectively. The incidence and numbers of brain tumors in female rats exposed to 1.95-GHz W-CDMA signals showed tendencies to increase but without statistical significance. Overall, no significant increase in incidences or numbers, either in the males or females, was detected in the EMF-exposed groups. In addition, no clear changes in tumor types in the brain were evident. Thus, under the present experimental conditions, exposure of heads of rats to 1.95-GHz W-CDMA signals for IMT-2000 for a 2-year period was not demonstrated to accelerate or otherwise affect ENU-initiated brain tumorigenesis. (c) 2007 Wiley-Liss, Inc.

  16. Densification and grain growth during sintering of porous Ce0.9Gd0.1O1.95tape cast layers: A comprehensive study on heuristic methods

    DEFF Research Database (Denmark)

    Ni, De Wei; Schmidt, Cristine Grings; Teocoli, Francesca

    2013-01-01

    the dominant sintering mechanisms and kinetics, both in isothermal and at constant heating rate (iso-rate) conditions. Densification of porous CGO10 tape is thermally activated with typical activation energy which was estimated around 440–470 kJ mol−1. Grain growth showed similar thermal activation energy......The sintering behavior of porous Ce0.9Gd0.1O1.95(CGO10) tape cast layers was systematically investigated to establish fundamental kinetic parameters associated to densification and grain growth. Densification and grain growth were characterized by a set of different methods to determine...

  17. Epidemiological analysis of orthognathic surgery in a hospital in Curitiba, Brazil: Review of 195 cases Análisis epidemiológico de la cirugía ortognática en un hospital de Curitiba, Brasil: Revisión de 195 casos

    Directory of Open Access Journals (Sweden)

    Rafaela Scariot

    2010-12-01

    Full Text Available Objective: The present retrospective study explored the spectrum and characteristics of patients treated with orthognathic surgery at the Universidade Federal do Paraná, Brazil. Materials and method: Over a six-year period from July 2002 to July 2008, the records of 195 patients with dentofacial deformities who underwent orthognathic surgical procedures were followed up. Results: Mean patient age was 25.87 years (range 14 to 65 years and the female to male ratio was 1.5:1. The predominant racial group was "white". Most patients belonged to the economically productive population. Sixty-two patients had complete dentition. Only 3.59% patients had local anesthesia (rapid palatal expansion. Transverse maxillary deficiency was the most common deformity, followed by maxillary anteroposterior deficiency associated with mandibular anteroposterior excess. Mandibular set-back was the intervention most frequently performed. The surgical procedures took an average of 3 hours 51 minutes and orthodontic treatments took an average of 44.48 months. Complications occurred in 22.57% of patients, the most common of which were permanent paresthesia of the lower lip (7.17% and inadequate fracture reduction (5.12%. Conclusions: The findings included concepts that were useful for characterizing the profile of patients who undergo orthognathic surgery in southern Brazil. The results also may help to correctly develop protocols for patient care designed to improve the overall results of the procedures.Objetivo: Este estudio retrospectivo explora el espectro y las características de los pacientes tratados con cirugía ortognática en la Universidade Federal do Paraná. Material y método: A lo largo de 6 años, a partir de julio de 2002 hasta julio de 2008, se efectuó el seguimiento de 195 pacientes con deformidades dentofaciales que se sometieron a procedimientos de cirugía ortognática. Resultados: La edad media de los pacientes fue de 25,87 años (de 14 a 65 y la

  18. Centile charts of motor development in girls aged between 7.5–19.5 from the Kujawsko-Pomorskie district Centilové stupnice motorického vývoje u dívek ve věku 7,5–19,5 roku z kujavsko-pomořského kraje

    Directory of Open Access Journals (Sweden)

    Marek Napierała

    2006-02-01

    Full Text Available The aim of the research was to present motor development with the help of centile charts, where the centile curves determine particular parts of the population: 3, 10, 25, 50, 75, 90 and 97 percentile. The research was conducted in the spring of 2001. A survey of 11 803 girls aged between 7.5 and 19.5 years old, from various types of rural and urban schools of the Kujawsko-Pomorskie district, was conducted. Centile charts make it possible to observe the process of the development of the examined characteristic, to answer the question as to whether an individual is at the level which is characteristic of a certain age, and, in case of aberrations, to come to a conclusion that the process of growth is disturbed. While determining the centile position one can become familiar with the level of development of an individual against calendar individuals of the same age. The value of C50 determines the calendar age of an individual. The results of the empiric research shows that the curve of the individual development of a child "wanders" within some channels, which is quite normal and does not mean a distortion of development. Cílem výzkumů bylo představit motorický vývoj pomocí centilových stupnic, kdy centilové křivky určují jisté části populace: 3, 10, 25, 50, 75, 90 a 97 percentil. Výzkumy byly prováděny na jaře roku 2001. Týkaly se 11 803 dívek ve věku mezi 7,5 a 19,5 lety z různých typů venkovských a městských škol kujavsko-pomořského kraje. Centilové stupnice umožňují sledovat proces vývoje zkoumaných charakteristik, zodpovědět na otázku, zda se jednotlivec nachází na úrovni charakteristické pro určitý věk a – v případě odchylek – dospět k závěru, že proces růstu je narušený. Při stanovování centilové pozice je možno poznat úroveň vývoje jednotlivce ve srovnání s jednotlivci téhož kalendářního věku. Kalendářní věk jednotlivce určuje hodnota C50. Výsledky empirick

  19. Ionic/Electronic Conductivity, Thermal/Chemical Expansion and Oxygen Permeation in Pr and Gd Co-Doped Ceria PrxGd0.1Ce0.9-xO1.95

    DEFF Research Database (Denmark)

    Cheng, Shiyang; Chatzichristodoulou, Christodoulos; Søgaard, Martin

    2017-01-01

    The oxygen permeation flux of Ce0.9Gd0.1O1.95-δ (CGO)-based oxygen transport membranes under oxidizing conditions is limited by the electronic conductivity of the material. This work aims to enhance the bulk ambipolar conductivity of CGO by partial substitution of Ce with the redox active element...... Pr. A series of compositions of PrxGd0.1Ce0.9-xO1.95-δ (x = 0, 0.02, 0.05, 0.08, 0.15, 0.25, 0.3 and 0.4) was prepared by solid state reaction. X-ray powder diffraction (XPD) indicates that Pr is completely dissolved in the fluorite structure up to 40 at.%. Pronounced nonlinear thermal expansion...... behavior was observed as a function of temperature, due to the simultaneous contributions of both thermal and chemical expansion. The electronic and ionic conductivities were measured as a function of temperature and oxygen partial pressure. Within the range from 10 to 15 at.% Pr, a drastic drop...

  20. Decreased affinity of recombinant human tumor necrosis factor-related apoptosis-inducing ligand (rhTRAIL) D269H/E195R to osteoprotegerin (OPG) overcomes TRAIL resistance mediated by the bone microenvironment.

    Science.gov (United States)

    Bosman, Matthieu C J; Reis, Carlos R; Schuringa, Jan J; Vellenga, Edo; Quax, Wim J

    2014-01-10

    The bone marrow microenvironment provides important signals for the survival and proliferation of hematopoietic and malignant cells. In multiple myeloma, plasma cells are surrounded by stromal cells including osteoblasts. These stromal cells protect multiple myeloma cells from apoptosis induced by chemotherapeutic agents. Osteoprotegerin (OPG), a soluble receptor of the cytokine TNF-related apoptosis-inducing ligand (TRAIL), is secreted by osteoblasts and has been implicated in the prevention of cell death induced by TRAIL in malignant cells. Previously, we have designed death receptor-specific TRAIL variants that induce apoptosis exclusively via one of its death receptors. Here, we have studied in detail the interaction between recombinant human (rhTRAIL) variants and OPG. We show that a DR5-specific variant (rhTRAIL D269H/E195R) displays a significantly decreased affinity to OPG. Furthermore, this rhTRAIL variant shows a much higher activity when compared with rhTRAIL WT and retains its effectiveness in inducing cell death in multiple myeloma cell lines, in the presence of OPG secreted by stromal cells. We also demonstrate that stromal cells are largely insensitive to high concentrations of this rhTRAIL variant. In conclusion, rhTRAIL D269H/E195R is a potential therapy for multiple myeloma due to its high effectiveness and diminished binding to OPG.

  1. La reforma realizada en el año 2002 al artículo 195 de la constitución política: La posibilidad de someter a referéndum una reforma constitucional

    Directory of Open Access Journals (Sweden)

    Esteban Alfaro Calderón

    2008-01-01

    Full Text Available Análisis de la reforma realizada al inciso 8 del artículo 195 de la Constitución Política en el año 2002; sobre la posibilidad de someter a referéndum las reformas constitucionales después de ser aprobadas en una legislatura y antes de la siguiente, esto si dos terceras partes de los miembros de la Asamblea así lo acuerdan. Hace un estudio desde la perspectiva de quienes la apoyan, así como de sus detractores. Adicionalmente realiza una investigación de doctrina y jurisprudencia de la Sala Constitucional y del Tribunal Supremo de Elecciones, en lo que al referéndum y al principio de participación se refiere.

  2. Sintering and grain growth kinetics in La0.85Sr0.15MnO3–Ce0.9Gd0.1O1.95 (LSM–CGO) porous composite

    DEFF Research Database (Denmark)

    Ni, De Wei; Andersen, Kjeld Bøhm; Esposito, Vincenzo

    2014-01-01

    The sintering kinetics in La0.85Sr0.15MnO3–Ce0.9Gd0.1O1.95 (LSM–CGO) porous composite was studied by applying a two-stage master sintering curve (MSC) approach and comparing with LSM and CGO single-phase materials. In the two-stage MSC, sintering mechanisms occurring at different stages were...... separated with respect of density, giving a typical apparent activation energy values for each sintering stage of the LSM–CGO system. Compared with the single-phase materials, retardant effect of the different phases on mass diffusion leads to much higher apparent activation energy for densification...

  3. Small-angle neutron scattering study of the flux-line lattice in a single crystal of Bi2.15Sr1.95CaCu2O8+x

    DEFF Research Database (Denmark)

    Yethiraj, M.; Mook, H.A.; Forgan, E.M.

    1994-01-01

    as the temperature is increased above a field‐dependent melting temperature. Diffracted intensity due to the vortex lattice also falls off as the applied field is increased. It is believed that this is a manifestation of the transition of the three‐dimensional flux lines into two‐dimensional pancake vortices......A flux‐line lattice (FLL) was observed in a single crystal of Bi2.15Sr1.95CaCu2O8+x (BSCCO) using small‐angle neutron scattering methods. The sample has a superconducting transition at 85 K. The flux‐line lattice is observed to melt, evidenced by the rapid disappearance of diffracted intensity...

  4. Isotope effects in (195)Pt NMR spectroscopy: unique (35/37)Cl- and (16/18)O-resolved "fingerprints" for all [PtCl6-n(OH)n](2-) (n = 1-5) anions in an alkaline solution and the implications of the trans influence.

    Science.gov (United States)

    Engelbrecht, Leon; Murray, Pieter; Koch, Klaus R

    2015-03-16

    A detailed analysis of the intrinsic (1)Δ(195)Pt((37/35)Cl) and (1)Δ(195)Pt((18/16)O) isotope 128.8 MHz (195)Pt NMR profiles of the series of kinetically inert [PtCl6-n(OH)n](2-) (n = 1-5) anions generated in strongly alkaline aqueous solutions shows that each (195)Pt NMR resonance of the [Pt(35/37)Cl6-n((16/18)OH)n](2-) (n = 1-5) anions is resolved only into [(6 - n) + 1 for n = 1-5] (35/37)Cl isotopologues at 293 K. Evidently, the greater trans influence of the hydroxido ligand in the order OH(-) > Cl(-) > H2O in [PtCl6-n(OH)n](2-) (n = 1-5) complexes results in somewhat longer Pt-Cl bond displacements trans to the hydroxido ligands, resulting in the absence of isotopomer effects in the [PtCl6-n(OH)n](2-) (n = 1-5) anions in contrast to that observed in the corresponding [PtCl6-n(H2O)n]((2-n)-) (n = 1-5) complexes. In suitably (18)O-enriched sodium hydroxide solutions, additional intrinsic (1)Δ(195)Pt((18/16)O) isotope effects are remarkably well-resolved into unique isotopologue- and isotopomer-based (195)Pt NMR profiles, ascribable to the higher trans influence of the OH(-) ligand. The consequent significantly shorter Pt-OH bonds in these anions emphasize (16/18)O isotopomer effects in the (195)Pt NMR peaks of [Pt(35/37)Cl6-n((16/18)OH)n](2-) (n = 1-5) for magnetically nonequivalent (16/18)OH isotopomers statistically possible in some isotopologues. These (195)Pt NMR profiles constitute unique NMR "fingerprints", useful for the unambiguous assignment of the series of [PtCl6-n(OH)n](2-) anions including their possible cis/trans/fac/mer stereoisomers in such solutions, without a need for accurate chemical shift measurements.

  5. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  6. Characterization of Ni{sub 5}3.5-Fe{sub 1}9.5-Ga{sub 2}7 Ni{sub 5}3.5 ferromagnetic shape memory alloy produced by powder metallurgy; Caracterizacion de la aleacion Ni{sub 5}3.5-Fe{sub 1}9.5-Ga{sub 2}7 con memoria de forma ferromagnetica producida por metalurgia de polvos

    Energy Technology Data Exchange (ETDEWEB)

    Olmos, L.; Alvarado-Hernandez, F.; Omar Jimenez, H.; Vergara-Hernandez, J.; Arroyo Albiter, M.; Ochoa-Gamboa, R. A.

    2015-07-01

    The main drawback of ferromagnetic shape memory alloys fabricated through casting methods are its brittleness. In order to overcome this disadvantage, powder metallurgy is an ideal technique for the consolidation of many engineering parts. This paper is focused on the study of the milling and sintering effects of metallic powders over the evolution of the crystalline phases responsibly for the shape memory effect of these materials. To achieve this objective, ferromagnetic shape memory alloy powders (Ni{sub 5}3.5-Fe{sub 1}9.5-Ga{sub 2}7) were prepared from a cast ingot by mechanical milling at two different times of 30 and 60 minutes. The evolution of the phases was investigated through high temperature X-ray diffraction (HTXRD), whereas sintering was analyzed with dilatometry tests. X-ray studies showed that four different phases can be present depending on the particle size and temperature at which the heat treatment was performed. Coarser powders showed a B2 structure along with a γ phase while the finer showed a L21 structure when treated below 1173 K. Furthermore, finer powders had a modulated M14 martensitic structure after sintering at temperatures above 1273 K. The sintering of powders was slow and a mass diffusion mechanism was not clearly observed. (Author)

  7. 49 CFR 195.2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... pipeline system or (b) receive and store hazardous liquid transported by a pipeline for reinjection and.... Unusually Sensitive Area (USA) means a drinking water or ecological resource area that is unusually... and controls the safety-related operations of a pipeline facility via a SCADA system from a control...

  8. 21 CFR 558.195 - Decoquinate.

    Science.gov (United States)

    2010-04-01

    ... for use Limitations Sponsor (i) 27.2 Broiler chickens: For prevention of coccidiosis caused by Eimeria... coccidiosis caused by Eimeria bovis and E. zuernii Feed Type C feed or milk replacer to provide 22.7... of exposure to coccidiosis or when it is likely to be a hazard. Do not feed to cows producing milk...

  9. 49 CFR 195.410 - Line markers.

    Science.gov (United States)

    2010-10-01

    ...) The word “Warning,” “Caution,” or “Danger” followed by the words “Petroleum (or the name of the... buried pipelines located— (1) Offshore or at crossings of or under waterways and other bodies of water...

  10. 27 CFR 24.195 - General.

    Science.gov (United States)

    2010-04-01

    ... distinctive flavor. Caramel and sugar may be used in a special natural wine. However, the minimum 60 degrees Brix limitations prescribed in the definition of “Liquid pure sugar” and “Invert sugar syrup” in § 24...

  11. BDML Metadata: 195 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available 94-b85a-4272-87e4-e2204b65ef58 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data/...source/Ce_KK_P002/RNAi_T08A11.2_040907_02.zip http://ssbd.qbic.riken.jp/data/bdml.../Ce_KK_P002/RNAi_T08A11.2_040907_02.bdml0.18.xml http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK_P002.pdpml0.06.x...ml http://ssbd.qbic.riken.jp/search/e9861694-b85a-4272-87e4-e2204b65ef58/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-98 ...

  12. 49 CFR 195.306 - Test medium.

    Science.gov (United States)

    2010-10-01

    ... (5) The pipe involved is new pipe having a longitudinal joint factor of 1.00. (d) Air or inert gas... this section, water must be used as the test medium. (b) Except for offshore pipelines, liquid...

  13. 32 CFR 195.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... otherwise subjected to discrimination under any program to which this (part) applies. (b) Specific... individuals from, denying them the benefits of, or subjecting them to discrimination under any program to..., in determining the types of services, financial aid, or other benefits, or facilities which will be...

  14. 40 CFR 195.20 - Fee payments.

    Science.gov (United States)

    2010-07-01

    ... Sanford Cohen and Associates, Inc. (SC&A), 1418 I-85 Parkway, Montgomery, Alabama, 36106. EPA will review... fixed costs (e.g., updating examinations) and increases/decreases in variable costs due to inflation and...

  15. Publications | Page 195 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Findings revealed that farmer learning groups led to rapid uptake of successful... Final report : OASIS II Project Utilization-Focused Evaluation (open access). This evaluation in terms of the Open Architectures, Standards and Information Systems for Healthcare in Africa (OASIS) OASIS II project attempted to address changes ...

  16. Publications | Page 195 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    A new initiative in Central America takes aim at Chagas disease, one of the most serious public health challenges in Latin America and the Caribbean. More than 10 million people in the region are infected with the disease, which is endemic... Averting disaster at the community level. An IDRC-supported local planning tool ...

  17. Publications | Page 195 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Enhancing the adaptive capacity of communities to climate change induced water challenges using ICT in Uganda : project design and anticipated policy ... the staggered rollout of Vietnam''s hospital autonomization policy to estimate its impacts on several key health sector outcomes including hospital efficiency, use of ...

  18. 21 CFR 137.195 - Crushed wheat.

    Science.gov (United States)

    2010-04-01

    ... the method prescribed in “Official Methods of Analysis of the Association of Official Analytical Chemists,” 13th Ed. (1980), section 7.002 under “Preparation of Sample—Official Final Action,” and section... crushing cleaned wheat other than durum wheat and red durum wheat that, when tested by the method...

  19. 7 CFR 800.195 - Delegations.

    Science.gov (United States)

    2010-01-01

    ... grain do not exceed, as determined by the Administrator, 5 per centum of the total amount of grain... than 90 calendar days before the desired effective date, and (ii) specify the change desired. (e... skills. The State shall keep the Service informed of the employment status of each of its licensees and...

  20. Caracterización de la aleación Ni53.5-Fe19.5-Ga27 con memoria de forma ferromagnética producida por metalurgia de polvos

    Directory of Open Access Journals (Sweden)

    Olmos, Luis

    2015-06-01

    Full Text Available The main drawback of ferromagnetic shape memory alloys fabricated through casting methods are its brittleness. In order to overcome this disadvantage, powder metallurgy is an ideal technique for the consolidation of many engineering parts. This paper is focused on the study of the milling and sintering effects of metallic powders over the evolution of the crystalline phases responsibly for the shape memory effect of these materials. To achieve this objective, ferromagnetic shape memory alloy powders (Ni53.5-Fe19.5-Ga27 were prepared from a cast ingot by mechanical milling at two different times of 30 and 60 minutes. The evolution of the phases was investigated through high temperature X-ray diffraction (HTXRD, whereas sintering was analyzed with dilatometry tests. X-ray studies showed that four different phases can be present depending on the particle size and temperature at which the heat treatment was performed. Coarser powders showed a B2 structure along with a γ phase while the finer showed a L21 structure when treated below 1173 K. Furthermore, finer powders had a modulated M14 martensitic structure after sintering at temperatures above 1273 K. The sintering of powders was slow and a mass diffusion mechanism was not clearly observed.La principal desventaja de las aleaciones con memoria de forma ferromagnéticas obtenidas por fundición es su fragilidad. Para superar esta desventaja la metalurgia de polvos es una técnica ideal para la consolidación de las piezas, por lo que este trabajo se orientó a estudiar el efecto generado por los procesos de molienda y sinterizado de polvos sobre la evolución de las fases cristalinas que le confieren la memoria de forma a estos materiales. Para ello se prepararon polvos de la aleación ferromagnética con memoria de forma Ni53.5-Fe19.5-Ga27 a partir de un lingote fundido mediante molienda mecánica, durante dos tiempos diferentes de molienda de 30 y 60 minutos. La evolución de las fases fue

  1. High-Performance Microchanneled Asymmetric Gd0.1Ce0.9O1.95-La0.6Sr0.4FeO3-δ-Based Membranes for Oxygen Separation

    DEFF Research Database (Denmark)

    Cheng, Shiyang; Huang, Hua; Ovtar, Simona

    2016-01-01

    A microchanneled asymmetric dual phase composite membrane of 70 vol % Gd0.1Ce0.9O1.95-delta-30 vol % La0.6Sr0.4FeO3-delta (CGO-LSF) was fabricated by a "one step" phase-inversion tape casting. The sample consists of a thin dense membrane (100 mu m) and a porous substrate including "finger-like" m...

  2. Impedance Spectroscopy and Catalytic Activity Characterization of a La0.85Sr0.15MnO3/Ce0.9Gd0.1O1.95 Electrochemical Reactor for the Oxidation of Propene

    DEFF Research Database (Denmark)

    Ippolito, Davide; Kammer Hansen, Kent

    2014-01-01

    This study aims to characterize the catalytic and electrochemical behavior of a La0.85Sr0.15MnO3/Ce0.9Gd0.1O1.95 porous reactor for the oxidation of propene in the presence of oxygen. The application of anodic polarization strongly increased the propene oxidation rate up to 71 %, although the cur...

  3. Statistical analysis of the mesospheric inversion layers over two symmetrical tropical sites: Réunion (20.8° S, 55.5° E) and Mauna Loa (19.5° N, 155.6° W)

    Science.gov (United States)

    Bègue, Nelson; Mbatha, Nkanyiso; Bencherif, Hassan; Tato Loua, René; Sivakumar, Venkataraman; Leblanc, Thierry

    2017-11-01

    In this investigation a statistical analysis of the characteristics of mesospheric inversion layers (MILs) over tropical regions is presented. This study involves the analysis of 16 years of lidar observations recorded at Réunion (20.8° S, 55.5° E) and 21 years of lidar observations recorded at Mauna Loa (19.5° N, 155.6° W) together with SABER observations at these two locations. MILs appear in 10 and 9.3 % of the observed temperature profiles recorded by Rayleigh lidar at Réunion and Mauna Loa, respectively. The parameters defining MILs show a semi-annual cycle over the two selected sites with maxima occurring near the equinoxes and minima occurring during the solstices. Over both sites, the maximum mean amplitude is observed in April and October, and this corresponds to a value greater than 35 K. According to lidar observations, the maximum and minimum mean of the base height ranged from 79 to 80.5 km and from 76 to 77.5 km, respectively. The MILs at Réunion appear on average ˜ 1 km thinner and ˜ 1 km lower, with an amplitude of ˜ 2 K higher than Mauna Loa. Generally, the statistical results for these two tropical locations as presented in this investigation are in fairly good agreement with previous studies. When compared to lidar measurements, on average SABER observations show MILs with greater amplitude, thickness and base altitudes of 4 K, 0.75 and 1.1 km, respectively. Taking into account the temperature error by SABER in the mesosphere, it can therefore be concluded that the measurements obtained from lidar and SABER observations are in significant agreement. The frequency spectrum analysis based on the lidar profiles and the 60-day averaged profile from SABER confirms the presence of the semi-annual oscillation where the magnitude maximum is found to coincide with the height range of the temperature inversion zone. This connection between increases in the semi-annual component close to the inversion zone is in agreement with most previously

  4. Healthcare Access and Quality Index based on mortality from causes amenable to personal health care in 195 countries and territories, 1990-2015: a novel analysis from the Global Burden of Disease Study 2015.

    Science.gov (United States)

    2017-07-15

    National levels of personal health-care access and quality can be approximated by measuring mortality rates from causes that should not be fatal in the presence of effective medical care (ie, amenable mortality). Previous analyses of mortality amenable to health care only focused on high-income countries and faced several methodological challenges. In the present analysis, we use the highly standardised cause of death and risk factor estimates generated through the Global Burden of Diseases, Injuries, and Risk Factors Study (GBD) to improve and expand the quantification of personal health-care access and quality for 195 countries and territories from 1990 to 2015. We mapped the most widely used list of causes amenable to personal health care developed by Nolte and McKee to 32 GBD causes. We accounted for variations in cause of death certification and misclassifications through the extensive data standardisation processes and redistribution algorithms developed for GBD. To isolate the effects of personal health-care access and quality, we risk-standardised cause-specific mortality rates for each geography-year by removing the joint effects of local environmental and behavioural risks, and adding back the global levels of risk exposure as estimated for GBD 2015. We employed principal component analysis to create a single, interpretable summary measure-the Healthcare Quality and Access (HAQ) Index-on a scale of 0 to 100. The HAQ Index showed strong convergence validity as compared with other health-system indicators, including health expenditure per capita (r=0·88), an index of 11 universal health coverage interventions (r=0·83), and human resources for health per 1000 (r=0·77). We used free disposal hull analysis with bootstrapping to produce a frontier based on the relationship between the HAQ Index and the Socio-demographic Index (SDI), a measure of overall development consisting of income per capita, average years of education, and total fertility rates. This

  5. Development of lead free magnetoelectric laminates of Na{sub 0.5}Bi{sub 0.5}TiO{sub 3}–Tb{sub 0.3}Dy{sub 0.7}Fe{sub 1.95} for power generation

    Energy Technology Data Exchange (ETDEWEB)

    Prabahar, K. [Advanced Magnetics Group, Defence Metallurgical Research Laboratory, Hyderabad (India); Mirunalini, Josephine [Department of Physics, Thiagaraja College of Engineering, Madurai, Tamil Nadu (India); Sowmya, N. Shara; Chelvane, J. Arout [Advanced Magnetics Group, Defence Metallurgical Research Laboratory, Hyderabad (India); Mahendiran, M. [Department of Physics, Thiagaraja College of Engineering, Madurai, Tamil Nadu (India); Kamat, S.V. [Advanced Magnetics Group, Defence Metallurgical Research Laboratory, Hyderabad (India); Srinivas, A., E-mail: adirajs@dmrl.drdo.in [Advanced Magnetics Group, Defence Metallurgical Research Laboratory, Hyderabad (India)

    2014-09-01

    Lead free magnetoelectric laminates has been prepared by sandwiching Sodium Bismuth Titanate (Na{sub 0.5}Bi{sub 0.5}TiO{sub 3}) between two Tb{sub 0.3}Dy{sub 0.7}Fe{sub 1.95} (TDF) by epoxy bonding. The piezoelectric material Sodium Bismuth Titanate (Na{sub 0.5}Bi{sub 0.5}TiO{sub 3}) has been prepared by conventional solid state double sintering method and the magnetostrictive material, Tb{sub 0.3}Dy{sub 0.7}Fe{sub 1.95} (TDF) by vacuum induction melting process. NBT showed a saturated ferroelectric hysteresis behavior with the values of P{sub s}=22.24 μC/cm{sup 2}, E{sub c}=41 kV/cm and P{sub r}=27 μC/cm{sup 2}. The piezoelectric charge coefficient (d{sub 33}) measured for NBT was 102 pC/N. Magnetization versus magnetic field measurements were performed in longitudinal (L) and transverse (T) modes of TDF specimen that showed ferromagnetic hysteresis behavior. The magnetostriction of 950 ppm at 4 kOe and static strain coefficient of 0.37×10{sup −6} kOe{sup −1} at 1 kOe magnetic field were recorded for Tb{sub 0.3}Dy{sub 0.7}Fe{sub 1.95}. The magnetoelectric output was measured in L and T modes for the different NBT thickness of 1.0, 1.5 and 2 mm with TDF thickness of 1.5 mm. The high magnetoelectric coefficient (α) was found to be 0.08 mV/cm Oe (L mode) and 0.13 mV/cm Oe (T mode) for the NBT/TDF laminates with 1.0 mm thick NBT.

  6. Phase-inversion tape-casting preparation and significant performance enhancement of Ce0.9Gd0.1O1.95- La0.6Sr0.4Co0.2Fe0.8O3-δ dual-phase asymmetric membrane for oxygen separation

    DEFF Research Database (Denmark)

    Huang, Hua; Cheng, Shiyang; Gao, Jianfeng

    2014-01-01

    The dual-phase Ce0.9Gd0.1O1.95–La0.6Sr0.4Co0.2Fe0.8O3−δ asymmetric membrane was prepared via a phase-inversion tape-casting method. The membrane consisted of a thicker porous support layer and a thinner dense layer. When the dense side of the membrane was coated with a La0.6Sr0.4CoO3−δ catalytic...

  7. Removal of NOx with Porous Cell Stacks with La0.85Sr0.15CoxMn1-xO3+δ-Ce0.9Gd0.1O1.95 Electrodes Infiltrated with BaO

    DEFF Research Database (Denmark)

    Werchmeister, Rebecka Maria Larsen; Bentzen, Janet Jonna; Andersen, Kjeld Bøhm

    2014-01-01

    Porous cell stacks with composite electrodes of La0.85Sr0.15CoxMn1-xO3-Ce0.9Gd0.1O1.95 were tested for activity toward selective electrochemical reduction of NOx to N2 in the presence of 10% O2. The cell stacks were produced by tape casting, laminating and sintering the backbone structure followe...

  8. Enhancement of NOx removal performance for (La0.85Sr0.15)0.99MnO3/Ce0.9Gd0.1O1.95 electrochemical cells by NOx storage/reduction adsorption layers

    DEFF Research Database (Denmark)

    Shao, Jing; Kammer Hansen, Kent

    2013-01-01

    This study investigated the effect of adding a NOx adsorption layer to the cathode of an electrochemical cell on the removal of NOx from gaseous mixtures. The cathode was a composite of (La0.85Sr0.15)0.99MnO3 (LSM15) and Ce0.9Gd0.1O1.95 (CGO10). Two different kinds of adsorption layers, K–Pt–Al2O...... reaction path for NOx reduction. A stronger capability for oxidizing NO and/or trapping NOx under the test conditions may have contributed to the superior performance of the K–Pt–Al2O3 adsorption layer relative to the Ba–Pt–Al2O3 layer. © 2012 Elsevier Ltd. All rights reserved....

  9. Ionic/Electronic Conductivity, Thermal/Chemical Expansion and Oxygen Permeation in Pr and Gd Co-Doped Ceria PrxGd0.1Ce0.9-xO1.95

    DEFF Research Database (Denmark)

    Cheng, Shiyang; Chatzichristodoulou, Christodoulos; Søgaard, Martin

    2017-01-01

    Pr. A series of compositions of PrxGd0.1Ce0.9-xO1.95-δ (x = 0, 0.02, 0.05, 0.08, 0.15, 0.25, 0.3 and 0.4) was prepared by solid state reaction. X-ray powder diffraction (XPD) indicates that Pr is completely dissolved in the fluorite structure up to 40 at.%. Pronounced nonlinear thermal expansion...... behavior was observed as a function of temperature, due to the simultaneous contributions of both thermal and chemical expansion. The electronic and ionic conductivities were measured as a function of temperature and oxygen partial pressure. Within the range from 10 to 15 at.% Pr, a drastic drop...

  10. Magnetoelectric properties of lead-free Ni{sub 0.93}Co{sub 0.02}Mn{sub 0.05}Fe{sub 1.95}O{sub 4}–Na{sub 0.5}Bi{sub 0.5}TiO{sub 3} multiferroic composites synthesized by spark plasma sintering

    Energy Technology Data Exchange (ETDEWEB)

    Ramana Mudinepalli, Venkata [Shenzhen Key Laboratory of Advanced Materials, Department of Materials Science and Engineering, Shenzhen Graduate School, Harbin Institute of Technology, Shenzhen 518055 (China); Song, S.-H., E-mail: shsong@hitsz.edu.cn [Shenzhen Key Laboratory of Advanced Materials, Department of Materials Science and Engineering, Shenzhen Graduate School, Harbin Institute of Technology, Shenzhen 518055 (China); Li, J.-Q. [College of Materials Science and Engineering, Shenzhen University, Shenzhen 518060 (China); Murty, B.S. [Department of Metallurgical and Materials Engineering, Indian Institute of Technology, Madras, Chennai 600036 (India)

    2015-07-15

    Lead-free multiferroic ceramic composites of x Ni{sub 0.93}Co{sub 0.02}Mn{sub 0.05}Fe{sub 1.95}O{sub 4}−(1–x) Na{sub 0.5}Bi{sub 0.5}TiO{sub 3} (x NCMF−(1–x) NBT, where x=0.1, 0.2, 0.3, 0.4 and 0.5 mol fraction) were synthesized by spark plasma sintering (SPS) in conjunction with high-energy ball milling. The phases, dielectric, piezoelectric, ferroelectric, magnetic and magnetoelectric properties of the composites were analyzed. The composites were composed of a mixture of spinel and perovskite phases. All the composite samples exhibited both apparent ferroelectric and ferromagnetic characteristics as well as considerable magnetoelectric (ME) effects. The maximum value of the ME voltage coefficient of the composites was quite high, being up to ~670 mV cm{sup −1} Oe{sup −1} for the 0.5 NCMF−0.5 NBT composite. Overall, the synthesized composites were promising in terms of electrical, magnetic and magnetoelectric properties, indicating that the SPS is a promising method of fabricating ME composite materials. - Highlights: • Ni{sub 0.93}Co{sub 0.02}Mn{sub 0.05}Fe{sub 1.95}O{sub 4}–Na{sub 0.5}Bi{sub 0.5}TiO{sub 3} composites are synthesized by SPS. • The composites exhibit apparent ferromagnetic and ferroelectric characteristics. • There is quite a high magnetoelectric coefficient for the 0.5 NCMF−0.5 NBT composite. • SPS is a promising method of synthesizing multiferroic ceramic composites.

  11. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  12. Magnetic and dielectric properties of rare earth substituted Ni{sub 0.5}Zn{sub 0.5}Fe{sub 1.95}R{sub 0.05}O{sub 4} (R = Pr, Sm and La) ferrite nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Rakesh Kumar, E-mail: rakeshsinghpu@gmail.com [Aryabhatta Centre for Nanoscience & Nanotechnology, Aryabhatta Knowledge University, Patna 800001 (India); Department of Physics, Patna Women' s College, Patna University, Patna 800001 (India); Shah, Jyoti; Kotnala, R.K. [Multiferroics and Magnetics, CSIR-National Physical Laboratory, New Delhi 110012 (India)

    2016-08-15

    Highlights: • Formation of pure phase rare earth substituted nanocrystalline Ni{sub 0.5}Zn{sub 0.5}R{sub 0.05}Fe{sub 1.95}O{sub 4} (R = La, Pr and Sm) using citrate precursor method and at low annealing temperature of 450 °C. • Systematic changes in the lattice parameters with particle size and significant changes in magnetic parameters in the rare-earth substituted nanoferrites. • Large ionic radii of rare earth ions triggering local distortion and inducing softening of super exchange interaction. Decreasing order of coercivity and magnetization due to less number of domain walls and its movement in the direction of the magnetic field. • Dielectric measurements at higher frequency range (100 Hz–1 MHz) shows that these substituted ferrites exhibit small dielectric loss, which is suitable for high frequency applications. - Abstract: Ni{sub 0.5}Zn{sub 0.5}Fe{sub 1.95}R{sub 0.05}O{sub 4} nanoparticles (R = Pr, Sm and La) have been synthesized by citrate precursor method and annealed at 450 °C. All the samples were found to be in single phase. The lattice constants and crystallite size decreases with rare earth substitution (25 nm, 23 nm, 11 nm and 9 nm) due to strain produced in spinel lattice. Saturation magnetization and coercivity of ferrite significantly decreases (50.69 emu/g, 32.17 emu/g. 30.21 emu/g and 34.65 emu/g respectively) with rare earth substitution. The substitution of large ionic radius rare earth ions in Ni{sub 0.5}Zn{sub 0.5}Fe{sub 2}O{sub 4} results in distortion and induces a softening of magnetic exchange interaction. The dielectric measurements at higher frequency range (100 Hz–1 MHz) shows that these substituted ferrites exhibits low dielectric loss, which is suitable for high frequency applications.

  13. Percolation effect on electrical, mechanical, and electrochemical properties of Sr{sub 0.8}La{sub 0.2}TiO{sub 3}–Ce{sub 0.9}Gd{sub 0.1}O{sub 1.95} composite anodes for solid oxide fuel cells

    Energy Technology Data Exchange (ETDEWEB)

    Koo, Ji-Hoon [Division of Advanced Materials Engineering, Chonbuk National University, Jeonbuk, 561-756 (Korea, Republic of); Lee, Ki-Tae, E-mail: ktlee71@jbnu.ac.kr [Division of Advanced Materials Engineering, Chonbuk National University, Jeonbuk, 561-756 (Korea, Republic of); Hydrogen and Fuel Cell Research Center, Chonbuk National University, Jeonbuk, 561-756 (Korea, Republic of)

    2016-05-15

    Both the electrical conductivity and mechanical strength of a Sr{sub 0.8}La{sub 0.2}TiO{sub 3}–Ce{sub 0.9}Gd{sub 0.1}O{sub 1.95} (SLT-GDC) composite decreased non-linearly as the GDC content increased. In the GDC percolation region, the electrical conductivity and the mechanical strength decreased significantly. Because the carbon deposition rate increased with increasing GDC content, the redox stability decreased. The area specific resistance (ASR) of the SLT-GDC composite anode at 800 °C in H{sub 2} decreased up to 15 vol.% GDC (SLT-GDC15) and then increased at the SLT-GDC20 and the SLT-GDC33 compositions, due to the high electro–catalytic activity and low electrical conductivity of GDC. Consequently, the SLT-GDC15 composition within the mixed region below SLT and GDC percolation limit exhibited the best electrochemical performance due to the optimized electronic and ionic conduction network. - Highlights: • SLT-GDC composite anodes can be designed by percolation theory. • Incorporation of GDC improves catalytic activity. • Composite within SLT percolation threshold exhibits high mechanical strength. • Composite within the mixed percolation region exhibits the best catalytic activity. • Redox stability of the SLT-GDC composite is correlated with GDC volume.

  14. Page 1 Laser beam propagation in atmospheric turbulence 195 ...

    Indian Academy of Sciences (India)

    Tatarski VI 1971 Wave propagation in turbulent medium (Springfield, Virginia: National Technical. Information Service) -. Valley S L 1965 Handbook of geophysics and space environment (New York: McGraw Hill). Weaver E A, Bilbro J W, Dunkin J A & Jeffries H B 1976 Conf. Proc. of NASA Aviation Safety and Operational ...

  15. 49 CFR 195.106 - Internal design pressure.

    Science.gov (United States)

    2010-10-01

    ... and is subsequently heated, other than by welding or stress relieving as a part of welding, to a... Seamless 1.00 ASTM A 333/A 333M Seamless 1.00 Welded 1.00 ASTM A381 Double submerged arc welded 1.00 ASTM... 1.00 API 5L Seamless 1.00 Electric resistance welded 1.00 Electric flash welded 1.00 Submerged arc...

  16. 1935 15' Quad #195 Aerial Photo Mosaic Index - NM

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  17. 49 CFR 195.6 - Unusually Sensitive Areas (USAs).

    Science.gov (United States)

    2010-10-01

    ... below their optimum sustainable populations (16 U.S.C. 1362). The term “marine mammal” means “any mammal... system serves a transient population found at rest stops, campgrounds, restaurants, and parks with their...

  18. 195 RELIGIOUS IDENTITY AND SOCIAL INSTABILITY IN NIGERIA ...

    African Journals Online (AJOL)

    NGOZI

    Pakistan, between Hindus and Buddhists in India; between. Buddhists and Chinese communists in Tibet; between .... Oil prices crisis (the most recent being the. January 2012 saga, believed to have resulted in one of the ... proliferated, and the economy was increasingly vulnerable to global oil price changes and domestic ...

  19. 1935 15' Quad #195 Aerial Photo Mosaic Index - AZ

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  20. Dicty_cDB: SHB195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |CV752175.1 SJL6-009_A06_SJL6-009A06-T3_039.ab1 SJL Schistosoma japonicum cDNA, mRNA sequence. 44 3.5 1 CV752026...|CV752026.1 SJL6-007_B08_SJL6-007B08-T3_063.ab1 SJL Schistosoma japonicum cDNA, mRNA sequence. 44 3.5 1 CV739281...CV739281 |CV739281.1 SJAL_019_73.T3 SJL Schistosoma japonicum cDNA, mRNA sequence. 44 3.5 1 CV682259 |CV682259...|CV682259.1 sjs6-009_H10_sjs6-009H10-T3 SJS Schistosoma japonicum cDNA, mRNA sequence. 44 3.5 1 CV739266...CV739266 |CV739266.1 SJAL_019_64.T3 SJL Schistosoma japonicum cDNA, mRNA sequence. 44 3.5 1 CV581768 |CV581768

  1. Dicty_cDB: SSG195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |AI067610.1 EST209292 Schistosoma mansoni, Phil LoVerde/Joe Merrick Schistosoma mansoni cDNA clone SMNCC16...|AI975022.1 EST269616 Schistosoma mansoni female, Phil LoVerde/Joe Merrick Schistosoma mansoni cDNA clone...|AI975620.1 EST270214 Schistosoma mansoni female, Phil LoVerde/Joe Merrick Schistosoma mansoni cDNA clone...|AI977044.1 EST271638 Schistosoma mansoni male, Phil LoVerde/Joe Merrick Schistosoma mansoni cDNA clone...|AI977557.1 EST272151 Schistosoma mansoni male, Phil LoVerde/Joe Merrick Schistosoma mansoni cDNA clone

  2. Dicty_cDB: CHS195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |CD169096.1 MM1-0024G-M078-E11-U.B MM1-0024 Schistosoma mansoni cDNA cloneMM1-0024G-M078-E11.B, mRNA...|CD169707.1 MM1-0024T-M086-B01-U.B MM1-0024 Schistosoma mansoni cDNA clone MM1-0024T-M086-B01.B, mRNA...|CD169077.1 MM1-0024G-M078-D02-U.B MM1-0024 Schistosoma mansoni cDNA clone MM1-0024G-M078-D02.B, mRNA...|CD169818.1 MM1-0024T-M087-D03-U.B MM1-0024 Schistosoma mansoni cDNA clone MM1-0024T-M087-D03.B, mRNA...|CD168683.1 MM1-0023U-M091-D09-U.B MM1-0023 Schistosoma mansoni cDNA clone MM1-0023U-M091-D09.B, mRNA

  3. 21 CFR 133.195 - Swiss and emmentaler cheese.

    Science.gov (United States)

    2010-04-01

    ..., calcium sulfate, and magnesium carbonate, singly or combined, is not more than six times the weight of the... ingredients. (i) Coloring. (ii) Calcium chloride in an amount not more than 0.02 percent (calculated as anhydrous calcium chloride) by weight of the dairy ingredients, used as a coagulation aid. (iii) Enzymes of...

  4. 49 CFR 195.248 - Cover over buried pipeline.

    Science.gov (United States)

    2010-10-01

    ... railroads 36 (914) 36 (914) Deepwater port safety zones 48 (1219) 24 (610) Gulf of Mexico and its inlets in... removal by equivalent means. (b) Except for the Gulf of Mexico and its inlets in waters less than 15 feet...

  5. 195-Year History of Mykolayiv Observatory: Events and People

    Directory of Open Access Journals (Sweden)

    Shulga, O.V.

    2017-01-01

    Full Text Available The basic stages of the history of the Mykolaiv Astronomical Observatory are shown. The main results of the Observatory activities are presented by the catalogs of star positions, major and minor planets in the Solar system, space objects in the Earth orbit. The information on the qualitative and quantitative structure of the Observatory, cooperation with the observatories of Ukraine and foreign countries as well as major projects carried out in the Observatory is provided.

  6. 195--10 Dec 2009 [ Final version].indd

    African Journals Online (AJOL)

    2009-12-10

    Dec 10, 2009 ... of Jesus Christ as expressed in the ancient creeds of the Church. Changed elements in the Contemporary situation. 5. In the course of four hundred years of history, the Churches of the Reformation have been led to new and similar ways of thinking and living; by theological wrestling with the questions of ...

  7. Dicty_cDB: SHH195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available spretus sex determining protei... 45 0.002 ( Q62563 ) RecName: Full=Sex-determining region Y protein;...U70651 |pid:none) Mus musculus musculus sex determining ... 44 0.006 AC117075_53( AC117075 |pid:none) Dictyostelium...U70652 |pid:none) Mus musculus musculus sex determining ... 42 0.025 AE014297_2522( AE014297 |pid:none)

  8. FCJ-195 Privacy, Responsibility, and Human Rights Activism

    Directory of Open Access Journals (Sweden)

    Becky Kazansky

    2015-06-01

    Full Text Available In this article, we argue that many difficulties associated with the protection of digital privacy are rooted in the framing of privacy as a predominantly individual responsibility. We examine how models of privacy protection, such as Notice and Choice, contribute to the ‘responsibilisation’ of human rights activists who rely on the use of technologies for their work. We also consider how a group of human rights activists countered technology-mediated threats that this ‘responsibilisation’ causes by developing a collective approach to address their digital privacy and security needs. We conclude this article by discussing how technological tools used to maintain or counter the loss of privacy can be improved in order to support the privacy and digital security of human rights activists.

  9. Dicty_cDB: VSG195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mn yexxnvesgqagksdaeykadianrekevtkalnagkpqdalnvaladppiytktgaikd xnativlnllgsfkdkd...EKKTV*aiinpnl*plknrxxxxxhiyxx*yxixmn yexxnvesgqagksdaeykadianrekevtkalnagkpqdalnvaladppiytktgaikd xnativlnll

  10. Dicty_cDB: SLK195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0.003 4 AF312772 |AF312772.1 Tetrahymena thermophila macronuclear immobilization antigen LC (SerLC) mRNA, pa...rtial cds. 30 0.044 3 AF312771 |AF312771.1 Tetrahymena thermophila macronuclear immobilization antigen LB (S...survey sequence. 44 1.2 1 AF312774 |AF312774.1 Tetrahymena thermophila macronuclear immobilization...hermophila macronuclear immobilization antigen LD (SerLD) mRNA, complete cds. 30 ...erLB) mRNA, complete cds. 30 0.060 3 AF312770 |AF312770.1 Tetrahymena thermophila macronuclear immobilizat

  11. 40 CFR 160.195 - Retention of records.

    Science.gov (United States)

    2010-07-01

    ... retained in the archive(s) for whichever of the following periods is longest: (1) In the case of any study... which the sponsor holds any research or marketing permit to which the study is pertinent. (2) A period... marketing permit), a period of at least 2 years following the date on which the study is completed...

  12. People’s Republic of China Scientific Abstracts, Number 195.

    Science.gov (United States)

    1978-08-01

    types of physical therapy: electrotherapy , light therapy and sound therapy. Electrotherapy types covered are: direct current therapy for...therapy for nerve problems, interference electric current therapy for internal disorders, and high frequency electrotherapy (long wave, medium wave

  13. Southern Forests: a Journal of Forest Science - Vol 195 (2002)

    African Journals Online (AJOL)

    Deployment strategies to maximise value recovery from tree improvement : the experience of two South African companies : operational deployment of technology · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Arlene D Bayley, Flic Blakeway, 11-22 ...

  14. 19 CFR 10.195 - Country of origin criteria.

    Science.gov (United States)

    2010-04-01

    ... Country of origin criteria. (a) Articles produced in a beneficiary country—(1) General. Except as provided herein, any article which is either wholly the growth, product, or manufacture of a beneficiary country... beneficiary country, may qualify for duty-free entry under the CBI. No article or material shall be considered...

  15. 49 CFR 195.55 - Reporting safety-related conditions.

    Science.gov (United States)

    2010-10-01

    ... might result. (2) Unintended movement or abnormal loading of a pipeline by environmental causes, such as an earthquake, landslide, or flood, that impairs its serviceability. (3) Any material defect or... causes the pressure of a pipeline to rise above 110 percent of its maximum operating pressure. (5) A leak...

  16. Dicty_cDB: VHE195 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IPADKRALVYYTTTQYSTGSLINYCNLASNAVLEWPNDGVVDNEHTPLEGG VYLNNFKDWCHSDGMHSPQQTTNTEYNKEMSSNSVW*ttlyyffflynn...YCNLASNAVLEWPNDGVVDNEHTPLEGG VYLNNFKDWCHSDGMHSPQQTTNTEYNKEMSSNSVW*ttlyyffflynncnkidly*i Homology vs CSM-cDNA

  17. All projects related to | Page 195 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2016-07-28

    Despite several decades of impressive economic growth, the South and Southeast Asia region continues to be marred by ethnic conflicts, sectarian violence, and the entrenched impunity of security forces for war crimes and sexual violence. End Date: July 28, 2016. Topic: SEXUAL ABUSE, SOCIAL CONFLICTS, CRIME, ...

  18. 195-year history of Mykolayiv Observatory: events and people

    Science.gov (United States)

    Shulga, O. V.; Yanishevska, L. M.

    2017-02-01

    The basic stages of the history of the Mykolaiv Astronomical Observatory are shown. The main results of the Observatory activities are presented by the catalogs of star positions, major and minor planets in the Solar system, space objects in the Earth orbit. The information on the qualitative and quantitative structure of the Observatory, cooperation with the observatories of Ukraine and foreign countries as well as major projects carried out in the Observatory is provided.

  19. 195-Year History of Mykolayiv Observatory: Events and People

    OpenAIRE

    Shulga, O.V.; Yanishevska, L.M.

    2017-01-01

    The basic stages of the history of the Mykolaiv Astronomical Observatory are shown. The main results of the Observatory activities are presented by the catalogs of star positions, major and minor planets in the Solar system, space objects in the Earth orbit. The information on the qualitative and quantitative structure of the Observatory, cooperation with the observatories of Ukraine and foreign countries as well as major projects carried out in the Observatory is provided.

  20. Publications | Page 195 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  1. 15 CFR 922.195 - Permit procedures and criteria.

    Science.gov (United States)

    2010-01-01

    ... used for excavation, recovery and the storage of artifacts and related materials on site, and describe... archaeology are a graduate degree in archaeology, anthropology, or closely related field plus: (i) At least...

  2. Statistical analysis of the mesospheric inversion layers over two symmetrical tropical sites: Réunion (20.8° S, 55.5° E and Mauna Loa (19.5° N, 155.6° W

    Directory of Open Access Journals (Sweden)

    N. Bègue

    2017-11-01

    Full Text Available In this investigation a statistical analysis of the characteristics of mesospheric inversion layers (MILs over tropical regions is presented. This study involves the analysis of 16 years of lidar observations recorded at Réunion (20.8° S, 55.5° E and 21 years of lidar observations recorded at Mauna Loa (19.5° N, 155.6° W together with SABER observations at these two locations. MILs appear in 10 and 9.3 % of the observed temperature profiles recorded by Rayleigh lidar at Réunion and Mauna Loa, respectively. The parameters defining MILs show a semi-annual cycle over the two selected sites with maxima occurring near the equinoxes and minima occurring during the solstices. Over both sites, the maximum mean amplitude is observed in April and October, and this corresponds to a value greater than 35 K. According to lidar observations, the maximum and minimum mean of the base height ranged from 79 to 80.5 km and from 76 to 77.5 km, respectively. The MILs at Réunion appear on average ∼ 1 km thinner and ∼ 1 km lower, with an amplitude of ∼ 2 K higher than Mauna Loa. Generally, the statistical results for these two tropical locations as presented in this investigation are in fairly good agreement with previous studies. When compared to lidar measurements, on average SABER observations show MILs with greater amplitude, thickness and base altitudes of 4 K, 0.75 and 1.1 km, respectively. Taking into account the temperature error by SABER in the mesosphere, it can therefore be concluded that the measurements obtained from lidar and SABER observations are in significant agreement. The frequency spectrum analysis based on the lidar profiles and the 60-day averaged profile from SABER confirms the presence of the semi-annual oscillation where the magnitude maximum is found to coincide with the height range of the temperature inversion zone. This connection between increases in the semi-annual component close to the

  3. KN195L12: WHOI cruise 195 leg 12 aboard the R/V Knorr from 2009-07-24 - 2009-08-09 (NODC Accession 0081792)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Post-cruise download of raw data from shipboard computer(s) as furnished by the Woods Hole Oceanographic Institution Shipboard Scientific Support Group and archived...

  4. KN195L03: WHOI cruise 195 leg 03 aboard the R/V Knorr from 2009-01-09 - 2009-02-23 (NODC Accession 0081511)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Post-cruise download of raw data from shipboard computer(s) as furnished by the Woods Hole Oceanographic Institution Shipboard Scientific Support Group and archived...

  5. KN195L10: WHOI cruise 195 leg 10 aboard the R/V Knorr from 2009-06-12 - 2009-07-13 (NODC Accession 0081732)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Post-cruise download of raw data from shipboard computer(s) as furnished by the Woods Hole Oceanographic Institution Shipboard Scientific Support Group and archived...

  6. KN195L04: WHOI cruise 195 leg 04 aboard the R/V Knorr from 2009-02-28 - 2009-03-22 (NODC Accession 0081552)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Post-cruise download of raw data from shipboard computer(s) as furnished by the Woods Hole Oceanographic Institution Shipboard Scientific Support Group and archived...

  7. KN195L08: WHOI cruise 195 leg 08 aboard the R/V Knorr from 2009-05-03 - 2009-05-29 (NODC Accession 0081595)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Post-cruise download of raw data from shipboard computer(s) as furnished by the Woods Hole Oceanographic Institution Shipboard Scientific Support Group and archived...

  8. KN195L11: WHOI cruise 195 leg 11 aboard the R/V Knorr from 2009-07-15 - 2009-07-23 (NODC Accession 0081771)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Post-cruise download of raw data from shipboard computer(s) as furnished by the Woods Hole Oceanographic Institution Shipboard Scientific Support Group and archived...

  9. KN195L01: WHOI cruise 195 leg 01 aboard the R/V Knorr from 2008-11-23 - 2008-12-06 (NODC Accession 0080961)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Post-cruise download of raw data from shipboard computer(s) as furnished by the Woods Hole Oceanographic Institution Shipboard Scientific Support Group and archived...

  10. 49 CFR Appendix C to Part 195 - Guidance for Implementation of an Integrity Management Program

    Science.gov (United States)

    2010-10-01

    ... if a pipeline segment falls into a high, medium or low risk category; (4) Types of internal...) Drainage systems such as small streams and other smaller waterways that could serve as a conduit to a high... suspension bridge. (18) Non-standard or other than recognized industry practice on pipeline installation (e.g...

  11. 49 CFR 195.230 - Welds: Repair or removal of defects.

    Science.gov (United States)

    2010-10-01

    ... offshore pipeline being installed from a pipelay vessel, a weld must be removed if it has a crack that is... must be inspected to ensure its acceptability. (c) Repair of a crack, or of any defect in a previously... welding procedure used to make the original weld are met upon completion of the final weld repair. [Amdt...

  12. Page 1 Concentration of Graphites from the Eastern Ghats 195 Froth ...

    Indian Academy of Sciences (India)

    the fact that the froth was fragile and the Suspension of graphite settled freely facilitating easy Separation. The addition of Sodium silicate as a depressant increased the pH value to 9 and gave good results, but in the separation of Suspended Solids from the froth or Gangue suspensions, much difficulty was experienced.

  13. Li et al., Afr J Tradit Complement Altern Med. (2013) 10(4):186-195 ...

    African Journals Online (AJOL)

    AJTCAM

    B: Bar graph showing the neuronal count of dead neurons. ... Nevertheless, there have been many lines of evidence that have shown that any .... subacute stroke rehabilitation: a Sham-controlled, subject- and assessor-blind, randomized trial.

  14. Page 1 Bull. Mater. Sci, Vol. 14, No. 2, April 1991, pp. 195-197. (C ...

    Indian Academy of Sciences (India)

    role in high temperature superconductivity (Siegrist et al 1987). The role of oxygen in determining the structural symmetry and its correlation with T. has been reported earlier (Jorgensen et al 1987) but the specific role and relative importance of the. Cul-O planes and the Cu-O chains are more controversial. The asymmetric ...

  15. 42 CFR 416.195 - Determination of membership in new classes of new technology IOLs.

    Science.gov (United States)

    2010-10-01

    ... Determination of membership in new classes of new technology IOLs. (a) Factors to be considered. CMS uses the...) Reduced risk of intraoperative or postoperative complication or trauma; (ii) Accelerated postoperative...

  16. 40 CFR 1065.195 - PM-stabilization environment for in-situ analyzers.

    Science.gov (United States)

    2010-07-01

    ...) Isolate the balance from any external noise and vibration that is within a frequency range that could affect the balance. (2) Follow the balance manufacturer's specifications. (f) If static electricity...

  17. 33 CFR 110.195 - Mississippi River below Baton Rouge, LA, including South and Southwest Passes.

    Science.gov (United States)

    2010-07-01

    ... descending bank of the river. Caution: A wreck is located within the boundaries of this anchorage. Mariners... the water's edge into the river as measured from the LWRP. Caution: A wreck is located within the... Head of Passes. The width of the anchorage is 800 feet. Caution: A wreck is located within the...

  18. "... moi korabl?"l K 195-letiju V.I. Dalja / Gennadi Kuznetsov

    Index Scriptorium Estoniae

    Kuznetsov, Gennadi

    1996-01-01

    Vene keeleteadlane Vladimir Dal ja tema suhted Eestiga. Ilmunud ka kogumikus: Kuznetsov, Gennadi. I tolko dushi ihh, kak svetshi : otsherki o russkoi Pribaltike. Tallinn : Tarbeinfo - Russkii Telegraf, 2003, lk. 86-101

  19. 49 CFR 195.553 - What special definitions apply to this subpart?

    Science.gov (United States)

    2010-10-01

    ... environment includes soil resistivity (high or low), soil moisture (wet or dry), soil contaminants that may.... Buried means covered or in contact with soil. Direct assessment means an integrity assessment method that... of closely spaced pipe-to-soil readings over a pipeline that are subsequently analyzed to identify...

  20. Yeast Interacting Proteins Database: YLR208W, YDL195W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available complex (Sar1p, Sec13p, Sec16p, Sec23p, Sec24p, Sec31p, Sfb2p, and Sfb3p) which is important for the format...clear pore sub-complex and of the COPII complex (Sar1p, Sec13p, Sec16p, Sec23p, Sec24p, Sec31p, Sfb2p, and Sfb3p) which is important

  1. 49 CFR 195.452 - Pipeline integrity management in high consequence areas.

    Science.gov (United States)

    2010-10-01

    ... failure would affect the high consequence area, such as location of the water intake. (h) What actions...). (B) A dent located on the bottom of the pipeline that has any indication of metal loss, cracking or a... than NPS 12). (C) A dent located on the bottom of the pipeline with a depth greater than 6% of the...

  2. 32 CFR Appendix A to Part 195 - Programs to Which This Part Applies

    Science.gov (United States)

    2010-07-01

    .... 2281(h)). 7. Office of Civil Defense program (with Public Health Service) for development of... Which This Part Applies 1. The Army and Air National Guard (Title 32, United States Code). 2. Various..., emergency operating center construction, and personnel and administrative expenses (50 United States Code...

  3. [Autopsy records in Vienna since Lorenz Biermayer--a complete documentation of 195 years].

    Science.gov (United States)

    Winter, Eduard; Höflmayer, Doris; Patzak, Beatrix; Feigl, Walter

    2013-07-01

    Vienna has a long tradition of clinical autopsies. In the period from 1817 to 2012 there are over 300,000 autopsies documented in the Vienna General Hospital. From five other community hospitals with departments for pathology and some closed hospitals, autopsy reports exist since 1865. Until the nineteenth century the reports are written in Kurrent, then Latin script and since the 1920s they are stored as machine written copies. This incredible high number of preserved reports was only possible because of the tradition started by Rokitansky and the possibility of storing this large amount of records in the Pathologic anatomical collection in the Narrenturm, the Vienna Municipal Archives and various hospitals. The aim of this study was to create a documentary of the repositories of the autopsy records, to make the records available and easier accessible for different kinds of research. The autopsy records should be easier to find and access, be it for the use in statistics or other scientific projects.

  4. Li et al., Afr J Tradit Complement Altern Med. (2013) 10(4):186-195 ...

    African Journals Online (AJOL)

    AJTCAM

    The objective of this study was to investigate the effectiveness and specific effects of acupuncture on ischemic-induced damage in rats after permanent middle cerebral artery occlusion. Cerebral ischemia was induced by middle cerebral artery occlusion in male Wistar rats. The rats were divided into the following 4 groups: ...

  5. Measurements of Discrete Symmetries in the Neutral Kaon System with the CPLEAR (PS195) Experiment

    CERN Document Server

    Ruf, Thomas

    2015-01-01

    The antiproton storage ring LEAR offered unique opportunities to study the symmetries which exist between matter and antimatter. At variance with other approaches at this facility, CPLEAR was an experiment devoted to the study of T, CPT and CP symmetries in the neutral kaon system. It measured with high precision the time evolution of initially strangeness-tagged $K^0$ and $\\bar{K}^0$ states to determine the size of violations with respect to these symmetries in the context of a systematic study. In parallel, limits concerning quantum-mechanical predictions (EPR paradox, coherence of the wave function) or the equivalence principle of general relativity have been obtained. This article will first discuss briefly the unique low energy antiproton storage ring LEAR followed by a description of the CPLEAR experiment, including the basic formalism necessary to understand the time evolution of a neutral kaon state and the main results related to measurements of discrete symmetries in the neutral kaon system. An exce...

  6. 14 CFR Sec. 19-5 - Air transport traffic and capacity elements.

    Science.gov (United States)

    2010-01-01

    ... represent the industry designators described in the Appendix to section 25 of this part. A common private industry source of these industry designator codes is the Official Airline Guides (OAG). OAI will assign... particular operations. The Office of Airline Information (OAI) will assign or confirm codes upon request; OAI...

  7. 195 Immigration Et Crise D'identite Dans L'Univers Romanesque De ...

    African Journals Online (AJOL)

    Tracie1

    plus dérangeants qui font de Sami Tchak un auteur à part dans la littérature africaine d'aujourd'hui. Les mots clés : Tentative de définir. Le terme « immigration » se définit par Le Petit Robert. 2013 comme « entrée dans un pays de personnes non autochtones qui viennent s'y établir, généralement pour y trouver un emploi.

  8. Health Effects of Overweight and Obesity in 195 Countries over 25 Years

    NARCIS (Netherlands)

    Afshin, Ashkan; Forouzanfar, Mohammad H.; Reitsma, Marissa B.; Sur, Patrick; Estep, Kara; Lee, Alex; Marczak, Laurie; Mokdad, Ali H.; Moradi-Lakeh, Maziar; Naghavi, Mohsen; Salama, Joseph S.; Vos, Theo; Abate, Kalkidan H.; Abbafati, Cristiana; Ahmed, Muktar B.; Al-Aly, Ziyad; Alkerwi, Ala'a; Al-Raddadi, Rajaa; Amare, Azmeraw T.; Amberbir, Alemayehu; Amegah, Adeladza K.; Amini, Erfan; Amrock, Stephen M.; Anjana, Ranjit M.; Arnlov, Johan; Asayesh, Hamid; Banerjee, Amitava; Barac, Aleksandra; Baye, Estifanos; Bennett, Derrick A.; Beyene, Addisu S.; Biadgilign, Sibhatu; Biryukov, Stan; Bjertness, Espen; Boneya, Dube J.; Campos-Nonato, Ismael; Carrero, Juan J.; Cecilio, Pedro; Cercy, Kelly; Ciobanu, Liliana G.; Cornaby, Leslie; Damtew, Solomon A.; Dandona, Lalit; Dandona, Rakhi; Dharmaratne, Samath D.; Duncan, Bruce B.; Eshrati, Babak; Esteghamati, Alireza; Feigin, Valery L.; Fernandes, Joao C.; Furst, Thomas; Gebrehiwot, Tsegaye T.; Gold, Audra; Gona, Philimon N.; Goto, Atsushi; Habtewold, Tesfa D.; Hadush, Kokeb T.; Hafezi-Nejad, Nima; Hay, Simon I.; Horino, Masako; Islami, Farhad; Kamal, Ritul; Kasaeian, Amir; Katikireddi, Srinivasa V.; Kengne, Andre P.; Kesavachandran, Chandrasekharan N.; Khader, Yousef S.; Khang, Young-Ho; Khubchandani, Jagdish; Kim, Daniel; Kim, Yun J.; Kinfu, Yohannes; Kosen, Soewarta; Ku, Tiffany; Defo, Barthelemy Kuate; Kumar, G. Anil; Larson, Heidi J.; Leinsalu, Mall; Liang, Xiaofeng; Lim, Stephen S.; Liu, Patrick; Lopez, Alan D.; Lozano, Rafael; Majeed, Azeem; Malekzadeh, Reza; Malta, Deborah C.; Mazidi, Mohsen; McAlinden, Colm; McGarvey, Stephen T.; Mengistu, Desalegn T.; Mensah, George A.; Mensink, Gert B. M.; Mezgebe, Haftay B.; Mirrakhimov, Erkin M.; Mueller, Ulrich O.; Noubiap, Jean J.; Obermeyer, Carla M.; Ogbo, Felix A.; Owolabi, Mayowa O.; Patton, George C.; Pourmalek, Farshad; Qorbani, Mostafa; Rafay, Anwar; Rai, Rajesh K.; Ranabhat, Chhabi L.; Reinig, Nikolas; Safiri, Saeid; Salomon, Joshua A.; Sanabria, Juan R.; Santos, Itamar S.; Sartorius, Benn; Sawhney, Monika; Schmidhuber, Josef; Schutte, Aletta E.; Schmidt, Maria I.; Sepanlou, Sadaf G.; Shamsizadeh, Moretza; Sheikhbahaei, Sara; Shin, Min-Jeong; Shiri, Rahman; Shiue, Ivy; Roba, Hirbo S.; Silva, Diego A. S.; Silverberg, Jonathan I.; Singh, Jasvinder A.; Stranges, Saverio; Swaminathan, Soumya; Tabares-Seisdedos, Rafael; Tadese, Fentaw; Tedla, Bemnet A.; Tegegne, Balewgizie S.; Terkawi, Abdullah S.; Thakur, J. S.; Tonelli, Marcello; Topor-Madry, Roman; Tyrovolas, Stefanos; Ukwaja, Kingsley N.; Uthman, Olalekan A.; Vaezghasemi, Masoud; Vasankari, Tommi; Vlassov, Vasiliy V.; Vollset, Stein E.; Weiderpass, Elisabete; Werdecker, Andrea; Wesana, Joshua; Westerman, Ronny; Yano, Yuichiro; Yonemoto, Naohiro; Yonga, Gerald; Zaidi, Zoubida; Zenebe, Zerihun M.; Zipkin, Ben; Murray, Christopher J. L.

    2017-01-01

    BACKGROUND Although the rising pandemic of obesity has received major attention in many countries, the effects of this attention on trends and the disease burden of obesity remain uncertain. METHODS We analyzed data from 68.5 million persons to assess the trends in the prevalence of overweight and

  9. Page 1 African Crop Science Journal, Vol. 14. No. 3, pp. 185-195 ...

    African Journals Online (AJOL)

    ABSTRACT. The effects of drought or moisture stress (MS- no stress; MS-stress at seedling stage and MS-stress at heading stage) was studied for different crop ratios of barley (Hordeum vulgare) and wheat (Triticum aestivum) mixtures sown in additive ... L'objectif était d'identifier le taux de culture à productivité plus élevée ...

  10. Ce que nous faisons | Page 195 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI finance des études de recherche dans les pays en voie de développement en vue de produire un changement durable à grande échelle. Pour que le savoir devienne un outil permettant de résoudre des problèmes urgents :

  11. Acoustic effects of the ATOC signal (75 Hz, 195 dB) on dolphins and whales

    Energy Technology Data Exchange (ETDEWEB)

    Au, W.W.; Nachtigall, P.E.; Pawloski, J.L. [Marine Mammal Research Program, Hawaii Institute of Marine Biology, University of Hawaii, P.O. Box 1106, Kailua, Hawaii 96734 (United States)

    1997-05-01

    The Acoustic Thermometry of Ocean Climate (ATOC) program of Scripps Institution of Oceanography and the Applied Physics Laboratory, University of Washington, will broadcast a low-frequency 75-Hz phase modulated acoustic signal over ocean basins in order to study ocean temperatures on a global scale and examine the effects of global warming. One of the major concerns is the possible effect of the ATOC signal on marine life, especially on dolphins and whales. In order to address this issue, the hearing sensitivity of a false killer whale ({ital Pseudorca crassidens}) and a Risso{close_quote}s dolphin ({ital Grampus griseus}) to the ATOC sound was measured behaviorally. A staircase procedure with the signal levels being changed in 1-dB steps was used to measure the animals{close_quote} threshold to the actual ATOC coded signal. The results indicate that small odontocetes such as the {ital Pseudorca} and {ital Grampus} swimming directly above the ATOC source will not hear the signal unless they dive to a depth of approximately 400 m. A sound propagation analysis suggests that the sound-pressure level at ranges greater than 0.5 km will be less than 130 dB for depths down to about 500 m. Several species of baleen whales produce sounds much greater than 170{endash}180 dB. With the ATOC source on the axis of the deep sound channel (greater than 800 m), the ATOC signal will probably have minimal physical and physiological effects on cetaceans. {copyright} {ital 1997 Acoustical Society of America.}

  12. 49 CFR 195.1 - Which pipelines are covered by this part?

    Science.gov (United States)

    2010-10-01

    ... following point: (i) The inlet of a compressor used in the injection of carbon dioxide for oil recovery... apply to pipeline systems and pipeline facilities. If a conflict exists between a requirement that...

  13. Role of microRNA-195 in cardiomyocyte apoptosis induced by ...

    Indian Academy of Sciences (India)

    VAV2, and CDC42. Hepatology 58, 642–653. Wu S. H., Hang L. W., Yang J. S., Chen H. Y., Lin H. Y., Chiang. J. H. et al. 2010 Curcumin induces apoptosis in human non-small cell lung cancer NCI-H460 cells through ER stress and caspase cascade- and mitochondria-dependent pathways. Anticancer Res. 30, 2125–2133.

  14. Role of microRNA-195 in cardiomyocyte apoptosis induced by ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 95; Issue 1 ... Department of Emergency, Longnan Hospital of Daqing, Daqing 163001, People's Republic of China; Department of Clinical Laboratory, Women and Children Hospital of Qingdao, Qingdao 266000, People's Republic of China; Department of Nephrology, the ...

  15. 195 Immigration Et Crise D'identite Dans L'Univers Romanesque De ...

    African Journals Online (AJOL)

    Tracie1

    Paris, Mercure de France, Filles de Mexico, 2008, Mercure de. France, Al Capone le Malien, 2011, Mercure de France et. Ethnologue et le sage, 2013, éditions, Libreville, ODEM. Il a publié quatre essais qui comprennent La Sexualité féminine en. Afrique, 1999, Paris, L'Harmattan, La Prostitution à Cuba,. 1999, Paris ...

  16. Page 1 512 Index Dutta S K see Saha H 195 Gadkari D B Growth of ...

    Indian Academy of Sciences (India)

    Lahiry A. K.. CCA leachability of slow dried three major bamboo species of Bangladesh 18. Lakshminarayana D see Patel S G 23 see Agarwal M K 291. Lal Arthur V see Mira Mohanty 439. Lal K B see Gadkari D B 127. Lalitha Sirdeshmukh. Dielectric properties and electrical conduction in yttrium iron garnet (YIG) 219. Li DJ.

  17. 46 CFR 195.11-10 - Design and construction of portable vans.

    Science.gov (United States)

    2010-10-01

    ... escape, arrangement, interior construction, and electrical installations. (d) Power vans are those outfitted with electrical power generating machinery or batteries providing electrical power for other vans... requirements of this subchapter for pressure piping, electrical, fire extinguishing and ventilation systems. (e...

  18. Monte Carlo reference data sets for imaging research: Executive summary of the report of AAPM Research Committee Task Group 195

    NARCIS (Netherlands)

    Sechopoulos, I.; Ali, E.S.; Badal, A.; Badano, A.; Boone, J.M.; Kyprianou, I.S.; Mainegra-Hing, E.; McMillan, K.L.; McNitt-Gray, M.F.; Rogers, D.W.; Samei, E.; Turner, A.C.

    2015-01-01

    The use of Monte Carlo simulations in diagnostic medical imaging research is widespread due to its flexibility and ability to estimate quantities that are challenging to measure empirically. However, any new Monte Carlo simulation code needs to be validated before it can be used reliably. The type

  19. 195 Evaluation de la charge polluante des rivières des eaux usées ...

    African Journals Online (AJOL)

    kapepula

    La présente étude porte sur l'évaluation de la charge polluante des rivières dans la ville de Bukavu. Les paramètres de pollution, mesurés dans cette étude sont la demande chimique en oxygène (DCO), l'azote total et le phosphore total, et la demande biochimique en oxygène (DBO5). Les valeurs de la DBO5 des.

  20. Mesoporous high surface area Ce0.9Gd0.1O1.95 synthesized by spray drying

    DEFF Research Database (Denmark)

    Lundberg, Mats; Wang, Hsiang-Jen; Blennow Tullmar, Peter

    2011-01-01

    Mesoporous gadolinium doped cerium dioxide with high surface area was produced by spray drying using Pluronic 123 as surfactant. The powder, when calcined at 400 °C, had a BET surface area of 136 m2 g−1 and was polycrystalline as confirmed by XRD and TEM. XEDS confirmed Ce, Gd and O, as the only ...

  1. SU-F-J-195: On the Performance of Four Dual Energy CT Formalisms for Extracting Proton Stopping Powers

    Energy Technology Data Exchange (ETDEWEB)

    Baer, E; Royle, G [University College London, London (United Kingdom); Lalonde, A; Bouchard, H [University of Montreal, Montreal, QC (Canada)

    2016-06-15

    Purpose: Dual energy CT can predict stopping power ratios (SPR) for ion therapy treatment planning. Several approaches have been proposed recently, however accuracy and practicability in a clinical workflow are unaddressed. The aim of this work is to provide a fair comparison of available approaches in a human-like phantom to find the optimal method for tissue characterization in a clinical situation. Methods: The SPR determination accuracy is investigated using simulated DECT images. A virtual human-like phantom is created containing 14 different standard human tissues. SECT (120 kV) and DECT images (100 kV and 140 kV Sn) are simulated using the software ImaSim. The single energy CT (SECT) stoichiometric calibration method and four recently published calibration-based DECT methods are implemented and used to predict the SPRs from simulated images. The difference between SPR predictions and theoretical SPR are compared pixelwize. Mean, standard deviation and skewness of the SPR difference distributions are used as measures for bias, dispersion and symmetry. Results: The average SPR differences and standard deviations are (0.22 ± 1.27)% for SECT, and A) (−0.26 ± 1.30)%, B) (0.08 ± 1.12)%, C) (0.06 ± 1.15)% and D) (−0.05 ± 1.05)% for the four DECT methods. While SPR prediction using SECT is showing a systematic error on SPR, the DECT methods B, C and D are unbiased. The skewness of the SECT distribution is 0.57%, and A) −0.19%, B) −0.56%, C) −0.29% and D) −0.07% for DECT methods respectively. Conclusion: The here presented DECT methods B, C and D outperform the commonly used SECT stoichiometric calibration. These methods predict SPR accurately without a bias and within ± 1.2% (68th percentile). This indicates that DECT potentially improves accuracy of range predictions in proton therapy. A validation of these findings using clinical CT images of real tissues is necessary.

  2. Incidence and characteristics of kitesurfer injuries. DOI: 10.5007/1980-0037.2011v13n3p195

    Directory of Open Access Journals (Sweden)

    Joscelito de Oliveira Berneira

    2011-04-01

    Full Text Available Kitesurfing is a new sport and consists of a combination of surf, windsurf and wakeboard. Its main characteristics are the relationship with wind speed and direction and the high rate of injuries. The aim of this study was to determine the type, body region, and etiological agent of injuries in kitesurfers from the towns of Pelotas and Rio Grande, RS. A sample of 50 kitesurfers (mean age: 30.7 ± 7.9 years, height: 175.9 ± 6.6 cm, body weight: 79.4 ± 11.5 kg, and practice time: 4.2 ± 2.7 years was studied. A questionnaire with open and closed questions was used for data collection. Seventy-three injuries were identified in all participants and most of them had more than one type of injury. Sprain was the most frequent type of injury (35.6% and the lower limbs were the most affected (50.7%. The maneuver was the etiological agent that caused most injuries (57.5%. This study suggests proprioceptive exercise to increase the power of muscle recruitment in extreme situations; stretch training especially of the trunk and lower limbs, the sites most affected by injuries, and global workout to increase muscle endurance.

  3. Palaeomagnetic and synchrotron analysis of >1.95 Ma fossil-bearing palaeokarst at Haasgat, South Africa

    OpenAIRE

    Andy I.R. Herries; Peter Kappen; Anthony D.T. Kegley; David Patterson; Daryl L. Howard; Martin D. de Jonge; Stephany Potze; Justin W. Adams

    2014-01-01

    Palaeomagnetic analysis indicates that Haasgat, a fossil-bearing palaeocave in the Gauteng Province of South Africa, is dominated by reversed magnetic polarity in its oldest, deepest layers and normal polarity in the younger layers. The presence of in-situ Equus specimens suggests an age of less than ~2.3 Ma, while morphological analysis of faunal specimens from the ex-situ assemblage suggests an age greater than 1.8 Ma. Given this faunal age constraint, the older reversed polarity sections m...

  4. AB195. Role of PI3K/AKT in the erectile dysfunction from metabolic syndrome rats

    OpenAIRE

    Li, Rui; Wang, Tao; YANG Jun; Zhang, Yan; Wang, Shaogang; Ye, Zhangqun; Rao, Ke; Liu, Jihong

    2015-01-01

    Objective The metabolic syndrome, a disease arising from the world-wide epidemic of obesity, is manifested as insulin resistance, hypertension, hyperlipidaemia, and diabetes. Metabolic syndrome is a risk factor for erectile dysfunction (ED), but the underlying mechanisms are unclear. The aims of this study were to determine the underlying mechanisms of the metabolic syndrome-related ED. Methods Sprague-Dawley rats rendered obese by feeding a very high fat diet for 6 months. Body weight, plasm...

  5. Estudio descriptivo de 195 casos de absceso hepático (AH en Medellín-Colombia

    Directory of Open Access Journals (Sweden)

    Enrique Jiménez

    2001-04-01

    Full Text Available Existen descripciones con base en series internacionales acerca del absceso hepático, no así en Colombia donde se ha hecho énfasis en el absceso hepático amebiano (AHA (1. Nuestro objetivo fue describir las características del AHA y no amebiano de nuestro medio y definir algún grado de asociación entre pronóstico y alguna de las
    variables analizadas.

  6. Estudio descriptivo de 195 casos de absceso hepático (AH) en Medellín-Colombia

    OpenAIRE

    Enrique Jiménez; Gonzálo Correa Arango; William Mejía; Rodrigo Patiño; Karina Negrete; Juan Carlos González; Jorge Balbín; Gerardo Arteaga; Juan Carlos Restrepo

    2001-01-01

    Existen descripciones con base en series internacionales acerca del absceso hepático, no así en Colombia donde se ha hecho énfasis en el absceso hepático amebiano (AHA) (1). Nuestro objetivo fue describir las características del AHA y no amebiano de nuestro medio y definir algún grado de asociación entre pronóstico y alguna de las
    variables analizadas.

  7. Real world heart failure epidemiology and outcome: A population-based analysis of 88,195 patients.

    Science.gov (United States)

    Farré, Núria; Vela, Emili; Clèries, Montse; Bustins, Montse; Cainzos-Achirica, Miguel; Enjuanes, Cristina; Moliner, Pedro; Ruiz, Sonia; Verdú-Rotellar, José María; Comín-Colet, Josep

    2017-01-01

    Heart failure (HF) is frequent and its prevalence is increasing. We aimed to evaluate the epidemiologic features of HF patients, the 1-year follow-up outcomes and the independent predictors of those outcomes at a population level. Population-based longitudinal study including all prevalent HF cases in Catalonia (Spain) on December 31st, 2012. Patients were divided in 3 groups: patients without a previous HF hospitalization, patients with a remote (>1 year) HF hospitalization and patients with a recent (population studied. Some comorbidity, an all-cause hospitalization or emergency department visit the previous year were associated with a worse outcome.

  8. Search for the decay K+-->π+νν¯ in the momentum region Pπ<195 MeV/c

    Science.gov (United States)

    E787 Collaboration; Adler, S.; Aoki, M.; Ardebili, M.; Atiya, M. S.; Bazarko, A. O.; Bergbusch, P. C.; Bhuyan, B.; Blackmore, E. W.; Bryman, D. A.; Chiang, I.-H.; Convery, M. R.; Diwan, M. V.; Frank, J. S.; Haggerty, J. S.; Inagaki, T.; Ito, M.; Jain, V.; Jaffe, D. E.; Kabe, S.; Kazumori, M.; Kettell, S. H.; Kitching, P.; Kobayashi, M.; Komatsubara, T. K.; Konaka, A.; Kuno, Y.; Kuriki, M.; Kycia, T. F.; Li, K. K.; Littenberg, L. S.; Marlow, D. R.; McPherson, R. A.; Macdonald, J. A.; Meyers, P. D.; Mildenberger, J.; Muramatsu, N.; Nakano, T.; Ng, C.; Ng, S.; Numao, T.; Poutissou, J.-M.; Poutissou, R.; Redlinger, G.; Sasaki, T.; Sato, T.; Shinkawa, T.; Shoemaker, F. C.; Smith, A. J. S.; Soluk, R.; Stone, J. R.; Strand, R. C.; Sugimoto, S.; Yoshimura, Y.; Witzig, C.

    2002-06-01

    We have searched for the decay K+-->π+νν¯ in the kinematic region with pion momentum below the K+-->π+π0 peak. One event was observed, consistent with the background estimate of /0.73+/-0.18. This implies an upper limit on B(K+-- >π+νν¯)π+π0 peak. The same data were used to search for K+-->π+X0, where X0 is a weakly interacting neutral particle or system of particles with 150

  9. An Evaluation of School-Based Support Groups for Children of Divorced or Separated Parents. No. 195.

    Science.gov (United States)

    Rosenstein-Manner, Merle

    In the 1989-90 school year, POINT (Parents and Organizations in North Toronto) and Social Work Services, Toronto (Ontario) Board of Education, conducted six peer-support groups for those elementary school children (grades 5-8) in North Toronto whose parents were divorced or separated. Topics covered in 10 weekly 1-hour sessions included parental…

  10. Propagation measurements and multipath channel modelling for line-of-sight links at 19.5 GHz

    CSIR Research Space (South Africa)

    Naicker, K

    2006-06-01

    Full Text Available The research aims to characterise the performance of the link by evaluating the effects of multipath propagation under various meteorological conditions. A LOS link was established between the Howard College and Westville campuses of UKZN and passes...

  11. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  12. δ37Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.

  13. δ³⁷Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine

  14. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  15. Comment on: Tarasov, A. & Titov, K., 2013, On the use of the Cole-Cole equations in spectral induced polarization, Geophys. J. Int., 195, 352-356

    Science.gov (United States)

    Macnae, James

    2015-07-01

    A recent paper by Tarasov and Titov suggested that the Cole-Cole conductivity models should be preferred to the Pelton resistivity model in fitting induced polarization responses. Each model has four parameters: resistivity ρ (or its inverse conductivity σ), chargeability m, time parameter τ and frequency dependence c. Tarasov and Titov showed that in fitting experimental data, 3 of the parameters directly correspond across the two formulations, but that there is a difference between the Pelton and Cole-Cole model in that parameter τ is only the same at low frequency, but is an entangled function with m and c at high frequencies in the Pelton formulation. This claim of inconsistent τ was based on using the Pelton complex resistivity formulation and the Cole-Cole complex conductivity equation to analyse complex conductivity data as a function of frequency. However, if Pelton and Cole-Cole models are used to fit complex resistivity, rather than fitting conductivity, then it is the Cole-Cole model that has an entangled parameter at high chargeability m values. Simple testing shows that a Pelton model used to fit resistivity has all four model parameters directly corresponding with conductivity data fitted with a Cole-Cole model. The conclusion is that Cole-Cole and Pelton models in fact require identical independent parameters that can fit experimental or synthetic data, provided the Pelton resistivity formulation is restricted to fitting to resistivity data, and the Cole-Cole conductivity formulation is restricted to fitting conductivity results.

  16. Insights Gained from the Dehalococcoides ethenogenes Strain 195’s Transcriptome Responding to a Wide Range of Respiration Rates and Substrate Types

    Science.gov (United States)

    2012-04-01

    column temperature of 160° C, and the FID detector temperature of 200° C on a Supelcowax 10 4 column (30 m × 0.53 mm with 1.00 μm film, Supelco). The...monochlorophenol ( MCP ) is the terminal product (21). Therefore, DET will receive 13 2 eeqs per mol DCP. The respiration rate equation for DCP, rDCP, in μeeq

  17. Multibeam collection for KN195-03: Multibeam data collected aboard Knorr from 2009-01-12 to 2009-02-23, Puntarenas, Costa Rica to Honolulu, HI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  18. Multibeam collection for KN195L03: Multibeam data collected aboard Knorr from 2009-01-12 to 2009-02-23, Puntarenas, Costa Rica to Honolulu, HI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  19. 28 W CW linearly polarized single mode all-fiber thulium-doped fiber laser operating at 1.95 μm

    Science.gov (United States)

    Wang, Jiachen; Yeom, Dong-il; Lee, Sang Bae; Lee, Kwanil

    2017-04-01

    An all-fiber type, CW, linearly polarized thulium-doped fiber laser is reported. Highly linear polarization was achieved by a special management of fiber Bragg gratings, which performs as the laser cavity reflectors. The laser generated 28 W signal output at 1949 nm with a slope efficiency of 47.3%. The polarization extinction ratio of the laser was measured to be around 20 dB. The beam quality of the laser was near diffraction-limited, with M2 of 1.1. The laser's output features make it to be a potential light source for some important applications such as for pumping holmium-doped solid state lasers.

  20. Healthcare Access and Quality Index based on mortality from causes amenable to personal health care in 195 countries and territories, 1990–2015

    DEFF Research Database (Denmark)

    2017-01-01

    , and adding back the global levels of risk exposure as estimated for GBD 2015. We employed principal component analysis to create a single, interpretable summary measure–the Healthcare Quality and Access (HAQ) Index–on a scale of 0 to 100. The HAQ Index showed strong convergence validity as compared...... and western sub-Saharan Africa, reached HAQ Index values similar to or beyond their development levels, whereas others, namely in southern sub-Saharan Africa, the Middle East, and south Asia, lagged behind what geographies of similar development attained between 1990 and 2015. Interpretation This novel...... that few places have consistently achieved optimal health-care access and quality across health-system functions and therapeutic areas. This is especially evident in middle-SDI countries, many of which have recently undergone or are currently experiencing epidemiological transitions. The HAQ Index...

  1. Isabella Löhr, Die Globalisierung geistiger Eigentumsrechte. Neue Strukturen internationaler Zusammenarbeit (1886-1952 (Kritische Studien zur Geschichtswissenschaft 195. Vandenhoeck & Ruprecht, Göttingen, 2010, 342 S.

    Directory of Open Access Journals (Sweden)

    Claudia Lydorf

    2013-03-01

    Full Text Available In ihrer Dissertation verfolgt Isabella Löhr die Frage, wie sich ausgehend von der nationalen Gesetzgebung des 19. Jh. hin zum Welturheberrechtsabkommen von 1952 der globale Urheberrechtschutz entwickelte. Aus einer globalen Perspektive analysiert die Autorin eine Vielzahl von Aspekten, zum Beispiel den Einfluss des Urheberrechts auf die Entwicklung der Buchproduktion und die herausragende Rolle der Organisationen, die den Urheberrechtsschutz institutionalisierten.

  2. Enhanced reducibility and electronic conductivity of Nb or W doped Ce0.9Gd0.1O1.95 - δ

    DEFF Research Database (Denmark)

    Chatzichristodoulou, Christodoulos; Ricote, Sandrine; Foghmoes, Søren Preben Vagn

    2015-01-01

    are decreased relative to that of CGO10. Charge compensation of the donor dopants takes place primarily by annihilation of oxide ion vacancies, and a sharp decrease in ionic mobility is observed upon Nb or W doping of CGO10. On the other hand, the n-type electronic conductivity, associated with the reduction...... of Ce4+, increases upon doping with Nb or W, due to enhanced reducibility of cerium. This is beneficial for applications where electronic conductivity is also required, like oxygen permeation membranes. Modeling shows that 4 at.% Nb or W doped CGO10 will deliver higher oxygen fluxes than CGO10, due...... to the enhanced electronic conductivity and despite the reduced ionic conductivity....

  3. Densification and Grain Growth during Early-stage Sintering of Ce0.9Gd0.1O1.95-δ in Reducing Atmosphere

    DEFF Research Database (Denmark)

    He, Zeming; Yuan, Hao; Glasscock, Julie

    2010-01-01

    results, the grain size-relative density trajectory, the densification rate, and the grain-growth rate were determined. The activation energies for densification and grain growth were evaluated, and the dominant densification mechanism was clarified. For comparison, the densification behavior of CGO10...

  4. New Schools, Overcrowding Relief, and Achievement Gains in Los Angeles--Strong Returns from a $19.5 Billion Investment. Policy Brief 12-2

    Science.gov (United States)

    Welsh, William; Coghlan, Erin; Fuller, Bruce; Dauter, Luke

    2012-01-01

    Aiming to relieve overcrowded schools operating on multiple tracks, the Los Angeles Unified School District (LAUSD) has invested more than $19 billion to build 130 new facilities over the past decade. District leaders asked researchers at Berkeley to estimate the achievement effects of this massive initiative--benefits that may stem from entering…

  5. DO PUBLIC POLICIES FOR ENTREPRENEURSHIP MAKE A DIFFERENCE? PROSPECTIVE SCENARIOS FOR CANADA, IRELAND, AND ITALY DOI:10.7444/fsrj.v4i1.95

    Directory of Open Access Journals (Sweden)

    Gilberto Sarfati

    2012-06-01

    Full Text Available Micro, small, and medium-sized enterprises (MSMEs constitute the majority of businesses and a significant part of developed and developing countries’ Gross Domestic Product (GDP. This article presents a series of prospective scenarios that investigate the effects of public policies on entrepreneurship in Canada, Ireland, and Italy. Public policies for this sector can be classified as regulatory policies (e.g., laws for the entrance and exit of businesses, labor and social laws, property laws, tax laws, intellectual property laws, bankruptcy laws, and laws that affect the liquidity and availability of capital and stimulus policies (e.g., promotion of cultural and educational programs to foster entrepreneurship and internationalization. Regulatory policies influence the business environment for MSMEs, and are generally designed to provide entrepreneurs with high growth potential (known as “gazelles”. Four scenarios involving the critical uncertainties surrounding political and economic integration and technological development are developed for each country. Each scenario is constructed based on public policies specific to each country. This article concludes that public policies are not a panacea capable of generating economic development, given that their effectiveness depends on other economic decisions and exogenous economic conditions. However, the absence of state intervention does not produce positive effects, even in the case of positive scenarios under exogenous conditions.

  6. 49 CFR Appendix B to Part 195 - Risk-Based Alternative to Pressure Testing Older Hazardous Liquid and Carbon Dioxide Pipelines

    Science.gov (United States)

    2010-10-01

    ..., product transported, and the release volume potential. Tables 2-6 give definitions of risk classification... flux leakage or ultrasonic internal inspection survey may be utilized as an alternative to pressure...

  7. Global, regional, and national incidence, prevalence, and years lived with disability for 328 diseases and injuries for 195 countries, 1990–2016

    DEFF Research Database (Denmark)

    Moesgaard Iburg, Kim

    2017-01-01

    .1, a Bayesian meta-regression tool, as the main method of estimation, ensuring consistency between incidence, prevalence, remission, and cause of death rates for each condition. For some causes, we used alternative modelling strategies if incidence or prevalence needed to be derived from other data. YLDs were......, major depressive disorder, anxiety, and all musculoskeletal disorders apart from gout were the main conditions contributing to higher YLD rates in women. Men had higher age-standardised rates of substance use disorders, diabetes, cardiovascular diseases, cancers, and all injuries apart from sexual......–11943) and highest rate (Yemen, 14 774 YLDs per 100 000, 11 018–19 228). Interpretation The decrease in death rates since 1990 for most causes has not been matched by a similar decline in age-standardised YLD rates. For many large causes, YLD rates have either been stagnant or have increased for some causes...

  8. Oxygen permeation in thin, dense Ce0.9Gd0.1O 1.95- membranes I. Model study

    DEFF Research Database (Denmark)

    Chatzichristodoulou, Christodoulos; Søgaard, Martin; Hendriksen, Peter Vang

    2011-01-01

    at the feed and permeate side of the membrane, related to the gaseous oxygen reduction and fuel oxidation, respectively, as well as the gas conversion and gas diffusion resistances in the porous support structure at the permeate side. The temperature and oxygen activity dependence of the oxide ionic...

  9. Parameters detected by geriatric and quality of life assessment in 195 older patients with myelodysplastic syndromes and acute myeloid leukemia are highly predictive for outcome

    NARCIS (Netherlands)

    Deschler, B.; Ihorst, G.; Platzbecker, U.; Germing, U.; Marz, E.; Figuerido, M. de; Fritzsche, K.; Haas, P. de; Salih, H.R.; Giagounidis, A.; Selleslag, D.; Labar, B.; Witte, T.J. de; Wijermans, P.; Lubbert, M.

    2013-01-01

    Myelodysplastic syndromes and acute myeloid leukemia exemplify the complexity of treatment allocation in older patients as options range from best supportive care, non-intensive treatment (e.g. hypomethylating agents) to intensive chemotherapy/hematopoietic cell transplantation. Novel metrics for

  10. Densification and grain growth kinetics of Ce0.9Gd0.1O1.95 in tape cast layers: The influence of porosity

    DEFF Research Database (Denmark)

    Ni, De Wei; Esposito, Vincenzo; Foghmoes, Søren Preben Vagn

    2014-01-01

    that increasing the initial porosity from 0.38 to 0.60, the densification at the late stage is thermally activated with typical activation energy values increasing from 367 to 578 kJ mol−1. Similar effect of the porosity is observed for the thermally activated phenomena leading to grain growth in the CGO tapes...

  11. 49 CFR 40.195 - What happens when an individual is unable to provide a sufficient amount of urine for a pre...

    Science.gov (United States)

    2010-10-01

    ... provide a sufficient amount of urine for a pre-employment follow-up or return-to-duty test because of a... providing a sufficient specimen for a pre-employment follow-up or return-to-duty test and the condition... physician conducting the evaluation may conduct an alternative test (e.g., blood) as part of the medically...

  12. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  13. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  14. Production cross section of At radionuclides from 7Li+natPb and 9Be+natTl reactions

    Science.gov (United States)

    Maiti, Moumita; Lahiri, Susanta

    2011-12-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from 6,7Li- and 9Be-induced reactions on natural lead and thallium targets, respectively. The production of astatine radionuclides were investigated experimentally with two heavy-ion-induced reactions: 9Be + natTl and 7Li + natPb. Formation cross sections of the evaporation residues, 207,208,209,210At, produced in the (HI,xn) channel, were measured by the stacked-foil technique followed by off-line γ spectrometry at low incident energies (<50 MeV). Measured excitation functions were interpreted in terms of a compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach models. Measured cross-section values are lower than the respective theoretical predictions.

  15. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Koziorowski, J

    1998-10-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on {sup 211}At and {sup 124}I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[{sup 211}At]astato-2`-deoxyuridine (AUdR) and N-succinimidyl-4-[{sup 211}At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [{sup 124}I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[{sup 124}I]iodo-2`-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for

  16. Multibeam collection for KN195-10: Multibeam data collected aboard Knorr from 2009-06-14 to 2009-07-13, departing from Dutch Harbor, AK and returning to Dutch Harbor, AK

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  17. American Recovery and Reinvestment Act (ARRA) FEMP Technical Assistance U.S. General Services Administration – Project 195 John Seiberling Federal Office Building and U.S. Courthouse, Akron, Ohio

    Energy Technology Data Exchange (ETDEWEB)

    Arends, J.; Sandusky, William F.

    2010-05-28

    This report documents the findings from an onsite audit of the John Seiberling Federal building located in Akron, Ohio. The Federal landlord for this building is the General Services Administration (GSA). The focus of the audit was to identify various no-cost or low-cost energy efficiency opportunities that, once implemented, would reduce in either electrical and gas consumption and increase the operational efficiency of the building. This audit also provided an opportunity to identify potential capital cost projects that should be considered in the to acquire additional energy (electric and gas) and water savings to further increase the operational efficiency of the building.

  18. Multibeam collection for KN195-05: Multibeam data collected aboard Knorr from 2009-03-24 to 2009-04-05, departing from Puerto Ayora, Ecuador and returning to Puerto Ayora, Ecuador

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  19. Influence of porosity on densification and grain growth kinetics of Ce0.9Gd0.1O1.95 tape

    DEFF Research Database (Denmark)

    Ni, De Wei; Esposito, Vincenzo; Foghmoes, Søren Preben Vagn

    Gadolinium doped-ceria (CGO) is an important material that offers high stability, tolerance against harsh environments and high ionic and electronic conductivity at high temperatures. For most of its applications, CGO is applied as a thin dense layer on a porous support structure. However, highly...... porous layer allowing gas flow is necessary in catalytic and in gas purification devices. During the sintering with shrinkage, the total solid volume is maintained to be a constant value but the shape and size of each particle change with the formation of grain boundaries. This change in solid particles....... The emphasis was put on the effect of porosity on densification and grain growth kinetics. Derived from the sintering constitutive laws, the densification and grain growth kinetics were experimentally characterized and analyzed. Furthermore, the activation energies for viscous flow were determined from master...

  20. Global, regional, and national disability-adjusted life-years (DALYs) for 333 diseases and injuries and healthy life expectancy (HALE) for 195 countries and territories, 1990–2016

    DEFF Research Database (Denmark)

    Moesgaard Iburg, Kim

    2017-01-01

    from expected trends when compared with the SDI: the geometric mean of income per person, educational attainment in the population older than age 15 years, and total fertility rate. Findings The highest globally observed HALE at birth for both women and men was in Singapore, at 75·2 years (95...... person, education, and family planning. The analysis of DALYs and HALE and their relationship to SDI represents a robust framework with which to benchmark location-specific health performance. Country-specific drivers of disease burden, particularly for causes with higher-than-expected DALYs, should...

  1. Air Pollution Prevention and Control: Bioreactors and Bioenergy. By Christian Kennes, Maria C. Veiga, Wiley-Blackwell, 2013; 570 Pages. Price US $195.00, ISBN 978-1-119-94331-0

    Directory of Open Access Journals (Sweden)

    Shu-Kun Lin

    2013-05-01

    Full Text Available In recent years, air pollution has become a major worldwide concern. Air pollutants can affect metabolic activity, impede healthy development, and exhibit carcinogenic and toxic properties in humans. Over the past two decades, the use of microbes to remove pollutants from contaminated air streams has become a widely accepted and efficient alternative to the classical physical and chemical treatment technologies. Air Pollution Prevention and Control: Bioreactors and Bioenergy focusses on these biotechnological alternatives looking at both the optimization of bioreactors and the development of cleaner biofuels.

  2. Participation trends in holistic movement practices: a 10-year comparison of yoga/Pilates and t'ai chi/qigong use among a national sample of 195,926 Australians.

    Science.gov (United States)

    Vergeer, Ineke; Bennie, Jason A; Charity, Melanie J; Harvey, Jack T; van Uffelen, Jannique G Z; Biddle, Stuart J H; Eime, Rochelle M

    2017-06-06

    In recent decades, the evidence supporting the physical and mental health benefits of holistic movement practices such as yoga and t'ai chi have become increasingly established. Consequently, investigating the participation prevalence and patterns of these practices is a relevant pursuit in the public health field. Few studies have provided population-level assessment of participation rates, however, and even fewer have focused on patterns over time. The purpose of this study was to examine participation prevalence and trends in yoga/Pilates and t'ai chi/qigong over a ten-year period in a nationally representative sample of Australians aged 15 years and over, with particular attention to sex and age. A secondary purpose was to juxtapose these findings with participation trends in traditional fitness activities over the same period. Data comprised modes and types of physical activity, age, and sex variables collected through the Exercise, Recreation and Sport Survey (ERASS), a series of independent cross-sectional Australia-wide surveys conducted yearly between 2001 and 2010. For each year, weighted population estimates were calculated for those participating in yoga/Pilates, t'ai chi/qigong, and fitness activities (e.g. aerobics, calisthenics). Linear regression and multiple logistic regression analyses were used to examine trends in prevalence rates over time and differences among sex and age (15-34; 35-54; 55+ years) groups, respectively. Average prevalence rates between 2001 and 2010 were 3.0% (95% CI 2.9-3.1) for yoga/Pilates, 0.6% (95% CI 0.5-0.6) for t'ai chi/qigong, and 19.2% (95% CI 18.9-19.4) for fitness activities. Across the decade, overall participation rates remained relatively stable for yoga/Pilates and t'ai chi/qigong, while increasing linearly for fitness activities. For both genders and in all three age groups, participation in fitness activities increased, whereas only in the 55+ age group was there a significant increase in yoga/Pilates participation; participation in t'ai chi/qigong declined significantly in the two younger age groups. Participation rates in yoga/Pilates and t'ai chi/qigong in Australia were low and relatively stable. As fitness activities increased in popularity across the decade, holistic movement practices did not. These findings point to the need to investigate activity-specific barriers and facilitators to participation, including intrapersonal, interpersonal, organisational, and environmental factors.

  3. Global, regional, and national incidence, prevalence, and years lived with disability for 328 diseases and injuries for 195 countries, 1990-2016 : a systematic analysis for the Global Burden of Disease Study 2016

    NARCIS (Netherlands)

    Vos, Theo; Abajobir, Amanuel Alemu; Abbafati, Cristiana; Abbas, Kaja M.; Abate, Kalkidan Hassen; Abd-Allah, Foad; Abdulle, Abdishakur M.; Abebo, Teshome Abuka; Abera, Semaw Ferede; Aboyans, Victor; Abu-Raddad, Laith J.; Ackerman, Ilana N.; Adamu, Abdu Abdullahi; Adetokunboh, Olatunji; Afarideh, Mohsen; Afshin, Ashkan; Agarwal, Sanjay Kumar; Aggarwal, Rakesh; Agrawal, Anurag; Agrawal, Sutapa; Kiadaliri, Aliasghar Ahmad; Ahmadieh, Hamid; Ahmed, Muktar Beshir; Aichour, Amani Nidhal; Aichour, Ibtihel; Aichour, Miloud Taki Eddine; Aiyar, Sneha; Akinyemi, Rufus Olusola; Akseer, Nadia; Al Lami, Faris Hasan; Alahdab, Fares; Al-Aly, Ziyad; Alam, Khurshid; Alam, Noore; Alam, Tahiya; Alasfoor, Deena; Alene, Kefyalew Addis; Ali, Raghib; Alizadeh-Navaei, Reza; Alkerwi, Ala'a; Alla, Francois; Allebeck, Peter; Allen, Christine; Al-Maskari, Fatma; Al-Raddadi, Rajaa; Alsharif, Ubai; Alsowaidi, Shirina; Altirkawi, Khalid A.; Amare, Azmeraw T.; Amini, Erfan; Ammar, Walid; Amoako, Yaw Ampem; Andersen, Hjalte H.; Antonio, Carl Abelardo T.; Anwari, Palwasha; Arnlov, Johan; Artaman, Al; Aryal, Krishna Kumar; Asayesh, Hamid; Asgedom, Solomon W.; Assadi, Reza; Atey, Tesfay Mehari; Atnafu, Niguse Tadele; Atre, Sachin R.; Avila-Burgos, Leticia; Avokpaho, Euripide Frinel G. Arthur; Awasthi, Ashish; Ayala Quintanilla, Beatriz Paulina; Saleem, Huda Omer Ba; Bacha, Umar; Badawi, Alaa; Balakrishnan, Kalpana; Banerjee, Amitava; Bannick, Marlena S.; Barac, Aleksandra; Barber, Ryan M.; Barker-Collo, Suzanne L.; Baernighausen, Till; Barquera, Simon; Barregard, Lars; Barrero, Lope H.; Basu, Sanjay; Battista, Bob; Battle, Katherine E.; Baune, Bernhard T.; Bazargan-Hejazi, Shahrzad; Beardsley, Justin; Bedi, Neeraj; Beghi, Ettore; Bejot, Yannick; Bekele, Bayu Begashaw; Bell, Michelle L.; Bennett, Derrick A.; Bensenor, Isabela M.; Benson, Jennifer; Berhane, Adugnaw; Berhe, Derbew Fikadu; Bernabe, Eduardo; Betsu, Balem Demtsu; Beuran, Mircea; Beyene, Addisu Shunu; Bhala, Neeraj; Bhansali, Anil; Bhatt, Samir; Bhutta, Zulfiqar A.; Biadgilign, Sibhatu; Bienhoff, Kelly; Bikbov, Boris; Birungi, Charles; Biryukov, Stan; Bisanzio, Donal; Bizuayehu, Habtamu Mellie; Boneya, Dube Jara; Boufous, Soufiane; Bourne, Rupert R. A.; Brazinova, Alexandra; Brugha, Traolach S.; Buchbinder, Rachelle; Bulto, Lemma Negesa Bulto; Bumgarner, Blair R.; Butt, Zahid A.; Cahuana-Hurtado, Lucero; Cameron, Ewan; Car, Mate; Carabin, Helene; Carapetis, Jonathan R.; Cardenas, Rosario; Carpenter, David O.; Carrero, Juan Jesus; Carter, Austin; Carvalho, Felix; Casey, Daniel C.; Caso, Valeria; Castaneda-Orjuela, Carlos A.; Castle, Chris D.; Catala-Lopez, Ferran; Chang, Hsing-Yi; Chang, Jung-Chen; Charlson, Fiona J.; Chen, Honglei; Chibalabala, Mirriam; Chibueze, Chioma Ezinne; Chisumpa, Vesper Hichilombwe; Chitheer, Abdulaal A.; Christopher, Devasahayam Jesudas; Ciobanu, Liliana G.; Cirillo, Massimo; Colombara, Danny; Cooper, Cyrus; Cortesi, Paolo Angelo; Criqui, Michael H.; Crump, John A.; Dadi, Abel Fekadu; Dalal, Koustuv; Dandona, Lalit; Dandona, Rakhi; das Neves, Jose; Davitoiu, Dragos V.; de Courten, Barbora; De Leo, Diego; Degenhardt, Louisa; Deiparine, Selina; Dellavalle, Robert P.; Deribe, Kebede; Des Jarlais, Don C.; Dey, Subhojit; Dharmaratne, Samath D.; Dhillon, Preet Kaur; Dicker, Daniel; Ding, Eric L.; Djalalinia, Shirin; Huyen Phuc Do,; Dorsey, E. Ray; Bender dos Santos, Kadine Priscila; Douwes-Schultz, Dirk; Doyle, Kerrie E.; Driscoll, Tim R.; Dubey, Manisha; Duncan, Bruce Bartholow; El-Khatib, Ziad Ziad; Ellerstrand, Jerisha; Enayati, Ahmadali; Endries, Aman Yesuf; Ermakov, Sergey Petrovich; Erskine, Holly E.; Eshrati, Babak; Eskandarieh, Sharareh; Esteghamati, Alireza; Estep, Kara; Fanuel, Fanuel Belayneh Bekele; Sa Farinha, Carla Sofia e; Faro, Andre; Farzadfar, Farshad; Fazeli, Mir Sohail; Feigin, Valery L.; Fereshtehnejad, Seyed-Mohammad; Fernandes, Joao C.; Ferrari, Alize J.; Feyissa, Tesfaye Regassa; Filip, Irina; Fischer, Florian; Fitzmaurice, Christina; Flaxman, Abraham D.; Flor, Luisa Sorio; Foigt, Nataliya; Foreman, Kyle J.; Franklin, Richard C.; Fullman, Nancy; Furst, Thomas; Furtado, Joao M.; Futran, Neal D.; Gakidou, Emmanuela; Ganji, Morsaleh; Garcia-Basteiro, Alberto L.; Gebre, Teshome; Gebrehiwot, Tsegaye Tewelde; Geleto, Ayele; Gemechu, Bikila Lencha; Gesesew, Hailay Abrha; Gething, Peter W.; Ghajar, Alireza; Gibney, Katherine B.; Gill, Paramjit Singh; Gillum, Richard F.; Ginawi, Ibrahim Abdelmageem Mohamed; Giref, Ababi Zergay; Gishu, Melkamu Dedefo; Giussani, Giorgia; Godwin, William W.; Gold, Audra L.; Goldberg, Ellen M.; Gona, Philimon N.; Goodridge, Amador; Gopalani, Sameer Vali; Goto, Atsushi; Goulart, Alessandra Carvalho; Griswold, Max; Gugnani, Harish Chander; Gupta, Rahul; Gupta, Rajeev; Gupta, Tanush; Gupta, Vipin; Hafezi-Nejad, Nima; Hailu, Alemayehu Desalegne; Hailu, Gessessew Bugssa; Hamadeh, Randah Ribhi; Hamidi, Samer; Handal, Alexis J.; Hankey, Graeme J.; Hao, Yuantao; Harb, Hilda L.; Hareri, Habtamu Abera; Maria Haro, Josep; Harvey, James; Hassanvand, Mohammad Sadegh; Havmoeller, Rasmus; Hawley, Caitlin; Hay, Roderick J.; Hay, Simon I.; Henry, Nathaniel J.; Beatriz Heredia-Pi, Ileana; Heydarpour, Pouria; Hoek, Hans W.; Hoffman, Howard J.; Horita, Nobuyuki; Hosgood, H. Dean; Hostiuc, Sorin; Hotez, Peter J.; Hoy, Damian G.; Htet, Aung Soe; Hu, Guoqing; Huang, Hsiang; Huynh, Chantal; Iburg, Kim Moesgaard; Igumbor, Ehimario Uche; Ikeda, Chad; Irvine, Caleb Mackay Salpeter; Jacobsen, Kathryn H.; Jahanmehr, Nader; Jakovljevic, Mihajlo B.; Jassal, Simerjot K.; Javanbakht, Mehdi; Jayaraman, Sudha P.; Jeemon, Panniyammakal; Jensen, Paul N.; Jha, Vivekanand; Jiang, Guohong; John, Denny; Johnson, Catherine O.; Johnson, Sarah Charlotte; Jonas, Jost B.; Jurisson, Mikk; Kabir, Zubair; Kadel, Rajendra; Kahsay, Amaha; Kamal, Ritul; Kan, Haidong; Karam, Nadim E.; Karch, Andre; Karema, Corine Kakizi; Kasaeian, Amir; Kassa, Getachew Mullu; Kassaw, Nigussie Assefa; Kassebaum, Nicholas J.; Kastor, Anshul; Katikireddi, Srinivasa Vittal; Kaul, Anil; Kawakami, Norito; Keiyoro, Peter Njenga; Kengne, Andre Pascal; Keren, Andre; Khader, Yousef Saleh; Khalil, Ibrahim A.; Khan, Ejaz Ahmad; Khang, Young-Ho; Khosravi, Ardeshir; Khubchandani, Jagdish; Kieling, Christian; Kim, Daniel; Kim, Pauline; Kim, Yun Jin; Kimokoti, Ruth W.; Kinfu, Yohannes; Kisa, Adnan; Kissimova-Skarbek, Katarzyna A.; Kivimaki, Mika; Knudsen, Ann Kristin; Kokubo, Yoshihiro; Kolte, Dhaval; Kopec, Jacek A.; Kosen, Soewarta; Koul, Parvaiz A.; Koyanagi, Ai; Kravchenko, Michael; Krishnaswami, Sanjay; Krohn, Kristopher J.; Defo, Barthelemy Kuate; Bicer, Burcu Kucuk; Kumar, G. Anil; Kumar, Pushpendra; Kumar, Sanjiv; Kyu, Hmwe H.; Lal, Dharmesh Kumar; Lalloo, Ratilal; Lambert, Nkurunziza; Lan, Qing; Larsson, Anders; Lavados, Pablo M.; Leasher, Janet L.; Lee, Jong-Tae; Lee, Paul H.; Leigh, James; Leshargie, Cheru Tesema; Leung, Janni; Leung, Ricky; Levi, Miriam; Li, Yichong; Li, Yongmei; Li Kappe, Darya; Liang, Xiaofeng; Liben, Misgan Legesse; Lim, Stephen S.; Linn, Shai; Liu, Angela; Liu, Patrick Y.; Liu, Shiwei; Liu, Yang; Lodha, Rakesh; Logroscino, Giancarlo; London, Stephanie J.; Looker, Katharine J.; Lopez, Alan D.; Lorkowski, Stefan; Lotufo, Paulo A.; Low, Nicola; Lozano, Rafael; Lucas, Timothy C. D.; Macarayan, Erlyn Rachelle King; Abd El Razek, Hassan Magdy; Abd El Razek, Mohammed Magdy; Mahdavi, Mahdi; Majdan, Marek; Majdzadeh, Reza; Majeed, Azeem; Malekzadeh, Reza; Malhotra, Rajesh; Malta, Deborah Carvalho; Mamun, Abdullah A.; Manguerra, Helena; Manhertz, Treh; Mantilla, Ana; Mantovani, Lorenzo G.; Mapoma, Chabila C.; Marczak, Laurie B.; Martinez-Raga, Jose; Martins-Melo, Francisco Rogerlandio; Martopullo, Ira; Maerz, Winfried; Mathur, Manu Raj; Mazidi, Mohsen; McAlinden, Colm; McGaughey, Madeline; McGrath, John J.; Mckee, Martin; McNellan, Claire; Mehata, Suresh; Mehndiratta, Man Mohan; Mekonnen, Tefera Chane; Memiah, Peter; Memish, Ziad A.; Mendoza, Walter; Mengistie, Mubarek Abera; Mengistu, Desalegn Tadese; Mensah, George A.; Meretoja, Atte; Meretoja, Tuomo J.; Mezgebe, Haftay Berhane; Micha, Renata; Millear, Anoushka; Miller, Ted R.; Mills, Edward J.; Mirarefin, Mojde; Mirrakhimov, Erkin M.; Misganaw, Awoke; Mishra, Shiva Raj; Mitchell, Philip B.; Mohammad, Karzan Abdulmuhsin; Mohammadi, Alireza; Mohammed, Kedir Endris; Mohammed, Shafiu; Mohanty, Sanjay K.; Mokdad, Ali H.; Mollenkopf, Sarah K.; Monasta, Lorenzo; Montanez Hernandez, Julio; Montico, Marcella; Moradi-Lakeh, Maziar; Moraga, Paula; Mori, Rintaro; Morozoff, Chloe; Morrison, Shane D.; Moses, Mark; Mountjoy-Venning, Cliff; Mruts, Kalayu Birhane; Mueller, Ulrich O.; Muller, Kate; Murdoch, Michele E.; Murthy, Gudlavalleti Venkata Satyanarayana; Musa, Kamarul Imran; Nachega, Jean B.; Nagel, Gabriele; Naghavi, Mohsen; Naheed, Aliya; Naidoo, Kovin S.; Naldi, Luigi; Nangia, Vinay; Natarajan, Gopalakrishnan; Negasa, Dumessa Edessa; Negoi, Ionut; Negoi, Ruxandra Irina; Newton, Charles R.; Ngunjiri, Josephine Wanjiku; Cuong Tat Nguyen,; Nguyen, Grant; Nguyen, Minh; Quyen Le Nguyen, [Unknown; Trang Huyen Nguyen,; Nichols, Emma; Ningrum, Dina Nur Anggraini; Nolte, Sandra; Vuong Minh Nong,; Norrving, Bo; Noubiap, Jean Jacques N.; O'Donnell, Martin J.; Ogbo, Felix Akpojene; Oh, In-Hwan; Okoro, Anselm; Oladimeji, Olanrewaju; Olagunju, Andrew Toyin; Olagunju, Tinuke Oluwasefunmi; Olsen, Helen E.; Olusanya, Bolajoko Olubukunola; Olusanya, Jacob Olusegun; Ong, Kanyin; Opio, John Nelson; Oren, Eyal; Ortiz, Alberto; Osgood-Zimmerman, Aaron; Osman, Majdi; Owolabi, Mayowa O.; Mahesh, P. A.; Pacella, Rosana E.; Pana, Adrian; Panda, Basant Kumar; Papachristou, Christina; Park, Eun-Kee; Parry, Charles D.; Parsaeian, Mahboubeh; Patten, Scott B.; Patton, George C.; Paulson, Katherine; Pearce, Neil; Pereira, David M.; Perico, Norberto; Pesudovs, Konrad; Peterson, Carrie Beth; Petzold, Max; Phillips, Michael Robert; Pigott, David M.; Pillay, Julian David; Pinho, Christine; Plass, Dietrich; Pletcher, Martin A.; Popova, Svetlana; Poulton, Richie G.; Pourmalek, Farshad; Prabhakaran, Dorairaj; Prasad, Narayan; Prasad, Noela M.; Purcell, Carrie; Qorbani, Mostafa; Quansah, Reginald; Rabiee, Rynaz H. S.; Radfar, Amir; Rafay, Anwar; Rahimi, Kazem; Rahimi-Movaghar, Afarin; Rahimi-Movaghar, Vafa; Rahman, Mahfuzar; Rahman, Mohammad Hifz Ur; Rai, Rajesh Kumar; Rajsic, Sasa; Ram, Usha; Ranabhat, Chhabi Lal; Rankin, Zane; Rao, Paturi Vishnupriya; Rao, Puja C.; Rawaf, Salman; Ray, Sarah E.; Reiner, Robert C.; Reinig, Nikolas; Reitsma, Marissa B.; Remuzzi, Giuseppe; Renzaho, Andre M. N.; Resnikoff, Serge; Rezaei, Satar; Ribeiro, Antonio L.; Ronfani, Luca; Roshandel, Gholamreza; Roth, Gregory A.; Roy, Ambuj; Rubagotti, Enrico; Ruhago, George Mugambage; Saadat, Soheil; Sadat, Nafis; Safdarian, Mahdi; Safi, Sare; Safiri, Saeid; Sagar, Rajesh; Sahathevan, Ramesh; Salama, Joseph; Salomon, Joshua A.; Salvi, Sundeep Santosh; Samy, Abdallah M.; Sanabria, Juan R.; Santomauro, Damian; Santos, Itamar S.; Santos, Joao Vasco; Milicevic, Milena M. Santric; Sartorius, Benn; Satpathy, Maheswar; Sawhney, Monika; Saxena, Sonia; Schmidt, Maria Ines; Schneider, Ione J. C.; Schoettker, Ben; Schwebel, David C.; Schwendicke, Falk; Seedat, Soraya; Sepanlou, Sadaf G.; Servan-Mori, Edson E.; Setegn, Tesfaye; Shackelford, Katya Anne; Shaheen, Amira; Shaikh, Masood Ali; Shamsipour, Mansour; Islam, Sheikh Mohammed Shariful; Sharma, Jayendra; Sharma, Rajesh; She, Jun; Shi, Peilin; Shields, Chloe; Shigematsu, Mika; Shinohara, Yukito; Shiri, Rahman; Shirkoohi, Reza; Shirude, Shreya; Shishani, Kawkab; Shrime, Mark G.; Sibai, Abla Mehio; Sigfusdottir, Inga Dora; Santos Silva, Diego Augusto; Silva, Joao Pedro; Alves Silveira, Dayane Gabriele; Singh, Jasvinder A.; Singh, Narinder Pal; Sinha, Dhirendra Narain; Skiadaresi, Eirini; Skirbekk, Vegard; Slepak, Erica Leigh; Sligar, Amber; Smith, David L.; Smith, Mari; Sobaih, Badr H. A.; Sobngwi, Eugene; Sorensen, Reed J. D.; Moraes Sousa, Tatiane Cristina; Sposato, Luciano A.; Sreeramareddy, Chandrashekhar T.; Srinivasan, Vinay; Stanaway, Jeffrey D.; Stathopoulou, Vasiliki; Steel, Nicholas; Stein, Dan J.; Stein, Murray B.; Steiner, Caitlyn; Steiner, Timothy J.; Steinke, Sabine; Stokes, Mark Andrew; Stovner, Lars Jacob; Strub, Bryan; Subart, Michelle; Sufiyan, Muawiyyah Babale; Abdulkader, Rizwan Suliankatchi; Sunguya, Bruno F.; Sur, Patrick J.; Swaminathan, Soumya; Sykes, Bryan L.; Sylte, Dillon O.; Tabares-Seisdedos, Rafael; Taffere, Getachew Redae; Takala, Jukka S.; Tandon, Nikhil; Tavakkoli, Mohammad; Taveira, Nuno; Taylor, Hugh R.; Tehrani-Banihashemi, Arash; Tekelab, Tesfalidet; Shifa, Girma Temam; Terkawi, Abdullah Sulieman; Tesfaye, Dawit Jember; Tesssema, Belay; Thamsuwan, Ornwipa; Thomas, Katie E.; Thrift, Amanda G.; Tiruye, Tenaw Yimer; Tobe-Gai, Ruoyan; Tollanes, Mette C.; Tonelli, Marcello; Topor-Madry, Roman; Tortajada, Miguel; Touvier, Mathilde; Bach Xuan Tran,; Tripathi, Suryakant; Troeger, Christopher; Truelsen, Thomas; Tsoi, Derrick; Tuem, Kald Beshir; Tuzcu, Emin Murat; Tyrovolas, Stefanos; Ukwaja, Kingsley N.; Undurraga, Eduardo A.; Uneke, Chigozie Jesse; Updike, Rachel; Uthman, Olalekan A.; Uzochukwu, Benjamin S. Chudi; van Boven, Job F. M.; Varughese, Santosh; Vasankari, Tommi; Venkatesh, S.; Venketasubramanian, Narayanaswamy; Vidavalur, Ramesh; Violante, Francesco S.; Vladimirov, Sergey K.; Vlassov, Vasiliy Victorovich; Vollset, Stein Emil; Wadilo, Fiseha; Wakayo, Tolassa; Wang, Yuan-Pang; Weaver, Marcia; Weichenthal, Scott; Weiderpass, Elisabete; Weintraub, Robert G.; Werdecker, Andrea; Westerman, Ronny; Whiteford, Harvey A.; Wijeratne, Tissa; Wiysonge, Charles Shey; Wolfe, Charles D. A.; Woodbrook, Rachel; Woolf, Anthony D.; Workicho, Abdulhalik; Hanson, Sarah Wulf; Xavier, Denis; Xu, Gelin; Yadgir, Simon; Yaghoubi, Mohsen; Yakob, Bereket; Yan, Lijing L.; Yano, Yuichiro; Ye, Pengpeng; Yimam, Hassen Hamid; Yip, Paul; Yonemoto, Naohiro; Yoon, Seok-Jun; Yotebieng, Marcel; Younis, Mustafa Z.; Zaidi, Zoubida; Zaki, Maysaa El Sayed; Zegeye, Elias Asfaw; Zenebe, Zerihun Menlkalew; Zhang, Xueying; Zhou, Maigeng; Zipkin, Ben; Zodpey, Sanjay; Zuhlke, Liesl Joanna; Murray, Christopher J. L.

    2017-01-01

    Background As mortality rates decline, life expectancy increases, and populations age, non-fatal outcomes of diseases and injuries are becoming a larger component of the global burden of disease. The Global Burden of Diseases, Injuries, and Risk Factors Study 2016 (GBD 2016) provides a comprehensive

  4. Global, regional, and national disability-adjusted life-years (DALYs) for 333 diseases and injuries and healthy life expectancy (HALE) for 195 countries and territories, 1990-2016 : a systematic analysis for the Global Burden of Disease Study 2016

    NARCIS (Netherlands)

    Hay, Simon I.; Abajobir, Amanuel Alemu; Abate, Kalkidan Hassen; Abbafati, Cristiana; Abbas, Kaja M.; Abd-Allah, Foad; Abdulle, Abdishakur M.; Abebo, Teshome Abuka; Abera, Semaw Ferede; Aboyans, Victor; Abu-Raddad, Laith J.; Ackerman, Ilana N.; Adedeji, Isaac A.; Adetokunboh, Olatunji; Afshin, Ashkan; Aggarwal, Rakesh; Agrawal, Sutapa; Agrawal, Anurag; Kiadaliri, Aliasghar Ahmad; Ahmed, Muktar Beshir; Aichour, Amani Nidhal; Aichour, Ibtihel; Aichour, Miloud Taki Eddine; Aiyar, Sneha; Akinyemiju, Tomi F.; Akseer, Nadia; Al Lami, Faris Hasan; Alahdab, Fares; Al-Aly, Ziyad; Alam, Khurshid; Alam, Noore; Alam, Tahiya; Alasfoor, Deena; Alene, Kefyalew Addis; Ali, Raghib; Alizadeh-Navaei, Reza; Alkaabi, Juma M.; Alkerwi, Ala'a; Alla, Francois; Allebeck, Peter; Allen, Christine; Al-Maskari, Fatma; AlMazroa, Mohammad AbdulAziz; Al-Raddadi, Rajaa; Alsharif, Ubai; Alsowaidi, Shirina; Althouse, Benjamin M.; Altirkawi, Khalid A.; Alvis-Guzman, Nelson; Amare, Azmeraw T.; Amini, Erfan; Ammar, Walid; Ampem, Yaw Amoako; Ansha, Mustafa Geleto; Antonio, Carl Abelardo T.; Anwari, Palwasha; Arnlov, Johan; Arora, Megha; Al Artaman, Ali; Aryal, Krishna Kumar; Asgedom, Solomon W.; Atey, Tesfay Mehari; Atnafu, Niguse Tadele; Avila-Burgos, Leticia; Avokpaho, Euripide Frinel G. Arthur; Awasthi, Ashish; Awasthi, Shally; Quintanilla, Beatriz Paulina Ayala; Azarpazhooh, Mahmoud Reza; Azzopardi, Peter; Babalola, Tesleem Kayode; Bacha, Umar; Badawi, Alaa; Balakrishnan, Kalpana; Bannick, Marlena S.; Barac, Aleksandra; Barker-Collo, Suzanne L.; Barnighausen, Till; Barquera, Simon; Barrero, Lope H.; Basu, Sanjay; Battista, Robert; Battle, Katherine E.; Baune, Bernhard T.; Bazargan-Hejazi, Shahrzad; Beardsley, Justin; Bedi, Neeraj; Bejot, Yannick; Bekele, Bayu Begashaw; Bell, Michelle L.; Bennett, Derrick A.; Bennett, James R.; Bensenor, Isabela M.; Benson, Jennifer; Berhane, Adugnaw; Berhe, Derbew Fikadu; Bernabe, Eduardo; Betsu, Balem Demtsu; Beuran, Mircea; Beyene, Addisu Shunu; Bhansali, Anil; Bhatt, Samir; Bhutta, Zulfiqar A.; Biadgilign, Sibhatu; Bienhoff, Kelly; Bikbov, Boris; Birungi, Charles; Biryukov, Stan; Bisanzio, Donal; Bizuayehu, Habtamu Mellie; Blyth, Fiona M.; Boneya, Dube Jara; Bose, Dipan; Bou-Orm, Ibrahim R.; Bourne, Rupert R. A.; Brainin, Michael; Brayne, Carol E. G.; Brazinova, Alexandra; Breitborde, Nicholas J. K.; Briant, Paul S.; Britton, Gabrielle; Brugha, Traolach S.; Buchbinder, Rachelle; Bulto, Lemma Negesa Bulto; Bumgarner, Blair; Butt, Zahid A.; Cahuana-Hurtado, Lucero; Cameron, Ewan; Ricardo Campos-Nonato, Ismael; Carabin, Helene; Cardenas, Rosario; Carpenter, David O.; Carrero, Juan Jesus; Carter, Austin; Carvalho, Felix; Casey, Daniel; Castaneda-Orjuela, Carlos A.; Rivas, Jacqueline Castillo; Castle, Chris D.; Catala-Lopez, Ferran; Chang, Jung-Chen; Charlson, Fiona J.; Chaturvedi, Pankaj; Chen, Honglei; Chibalabala, Mirriam; Chibueze, Chioma Ezinne; Chisumpa, Vesper Hichilombwe; Chitheer, Abdulaal A.; Chowdhury, Rajiv; Christopher, Devasahayam Jesudas; Ciobanu, Liliana G.; Cirillo, Massimo; Colombara, Danny; Cooper, Leslie Trumbull; Cooper, Cyrus; Cortesi, Paolo Angelo; Cortinovis, Monica; Criqui, Michael H.; Cromwell, Elizabeth A.; Cross, Marita; Crump, John A.; Dadi, Abel Fekadu; Dalal, Koustuv; Damasceno, Albertino; Dandona, Lalit; Dandona, Rakhi; das Neves, Jose; Davitoiu, Dragos V.; Davletov, Kairat; de Courten, Barbora; de Leo, Diego; De Steur, Hans; Degenhardt, Louisa; Deiparine, Selina; Dellavalle, Robert P.; Deribe, Kebede; Deribew, Amare; Des Jarlais, Don C.; Dey, Subhojit; Dharmaratne, Samath D.; Dhillon, Preet K.; Dicker, Daniel; Djalalinia, Shirin; Huyen Phuc Do,; Dokova, Klara; Doku, David Teye; Dorsey, E. Ray; Bender dos Santos, Kadine Priscila; Driscoll, Tim R.; Dubey, Manisha; Duncan, Bruce Bartholow; Ebel, Beth E.; Echko, Michelle; El-Khatib, Ziad Ziad; Enayati, Ahmadali; Endries, Aman Yesuf; Ermakov, Sergey Petrovich; Erskine, Holly E.; Eshetie, Setegn; Eshrati, Babak; Esteghamati, Alireza; Estep, Kara; Fanuel, Fanuel Belayneh Bekele; Farag, Tamer; Sofia, Carla; Farinha, Sa; Faro, Andre; Farzadfar, Farshad; Fazeli, Mir Sohail; Feigin, Valery L.; Feigl, Andrea B.; Fereshtehnejad, Seyed-Mohammad; Fernandes, Joao C.; Ferrari, Alize J.; Feyissa, Tesfaye Regassa; Filip, Irina; Fischer, Florian; Fitzmaurice, Christina; Flaxman, Abraham D.; Foigt, Nataliya; Foreman, Kyle J.; Franklin, Richard C.; Frostad, Joseph J.; Fullman, Nancy; Furst, Thomas; Furtado, Joao M.; Futran, Neal D.; Gakidou, Emmanuela; Garcia-Basteiro, Alberto L.; Gebre, Teshome; Gebregergs, Gebremedhin Berhe; Gebrehiwot, Tsegaye Tewelde; Geleijnse, Johanna M.; Geleto, Ayele; Gemechu, Bikila Lencha; Gesesew, Hailay Abrha; Gething, Peter W.; Ghajar, Alireza; Gibney, Katherine B.; Gillum, Richard F.; Ginawi, Ibrahim Abdelmageem Mohamed; Gishu, Melkamu Dedefo; Giussani, Giorgia; Godwin, William W.; Goel, Kashish; Goenka, Shifalika; Goldberg, Ellen M.; Gona, Philimon N.; Goodridge, Amador; Gopalani, Sameer Vali; Gosselin, Richard A.; Gotay, Carolyn C.; Goto, Atsushi; Goulart, Alessandra Carvalho; Graetz, Nicholas; Gugnani, Harish Chander; Gupta, Rajeev; Gupta, Prakash C.; Gupta, Tanush; Gupta, Vipin; Gupta, Rahul; Gutierrez, Reyna A.; Hachinski, Vladimir; Hafezi-Nejad, Nima; Hailu, Alemayehu Desalegne; Hailu, Gessessew Bugssa; Hamadeh, Randah Ribhi; Hamidi, Samer; Hammami, Mouhanad; Handal, Alexis J.; Hankey, Graeme J.; Hao, Yuantao; Harb, Hilda L.; Hareri, Habtamu Abera; Haro, Josep Maria; Harun, Kimani M.; Harvey, James; Hassanvand, Mohammad Sadegh; Havmoeller, Rasmus; Hay, Roderick J.; Hedayati, Mohammad T.; Hendrie, Delia; Henry, Nathaniel J.; Heredia-Pi, Ileana Beatriz; Heydarpour, Pouria; Hoek, Hans W.; Hoffman, Howard J.; Horino, Masako; Horita, Nobuyuki; Hosgood, H. Dean; Hostiuc, Sorin; Hotez, Peter J.; Hoy, Damian G.; Htet, Aung Soe; Hu, Guoqing; Huang, John J.; Huynh, Chantal; Iburg, Kim Moesgaard; Igumbor, Ehimario Uche; Ikeda, Chad; Irvine, Caleb Mackay Salpeter; Jacobsen, Kathryn H.; Jahanmehr, Nader; Jakovljevic, Mihajlo B.; James, Peter; Jassal, Simerjot K.; Javanbakht, Mehdi; Jayaraman, Sudha P.; Jeemon, Panniyammakal; Jensen, Paul N.; Jha, Vivekanand; Jiang, Guohong; John, Denny; Johnson, Catherine O.; Johnson, Sarah Charlotte; Jonas, Jost B.; Jurisson, Mikk; Kabir, Zubair; Kadel, Rajendra; Kahsay, Amaha; Kamal, Ritul; Kar, Chittaranjan; Karam, Nadim E.; Karch, Andre; Karema, Corine Kakizi; Karimi, Seyed M.; Karimkhani, Chante; Kasaeian, Amir; Kassa, Getachew Mullu; Kassebaum, Nicholas J.; Kassaw, Nigussie Assefa; Kastor, Anshul; Katikireddi, Srinivasa Vittal; Kaul, Anil; Kawakami, Norito; Keiyoro, Peter Njenga; Kemmer, Laura; Kengne, Andre Pascal; Keren, Andre; Kesavachandran, Chandrasekharan Nair; Khader, Yousef Saleh; Khalil, Ibrahim A.; Khan, Ejaz Ahmad; Khang, Young-Ho; Khoja, Abdullah T.; Khosravi, Ardeshir; Khubchandani, Jagdish; Kieling, Christian; Kim, Yun Jin; Kim, Daniel; Kimokoti, Ruth W.; Kinfu, Yohannes; Kisa, Adnan; Kissimova-Skarbek, Katarzyna A.; Kissoon, Niranjan; Kivimaki, Mika; Knudsen, Ann Kristin; Kokubo, Yoshihiro; Kolte, Dhaval; Kopec, Jacek A.; Kosen, Soewarta; Kotsakis, Georgios A.; Koul, Parvaiz A.; Koyanagi, Ai; Kravchenko, Michael; Krohn, Kristopher J.; Defo, Barthelemy Kuate; Bicer, Burcu Kucuk; Kumar, G. Anil; Kumar, Pushpendra; Kyu, Hmwe H.; Lager, Anton Carl Jonas; Lal, Dharmesh Kumar; Lalloo, Ratilal; Lallukka, Tea; Lambert, Nkurunziza; Lan, Qing; Lansingh, Van C.; Larsson, Anders; Leasher, Janet L.; Lee, Paul H.; Leigh, James; Leshargie, Cheru Tesema; Leung, Janni; Leung, Ricky; Levi, Miriam; Li, Yichong; Li, Yongmei; Liang, Xiaofeng; Liben, Misgan Legesse; Lim, Stephen S.; Linn, Shai; Liu, Angela; Liu, Patrick Y.; Liu, Shiwei; Liu, Yang; Lodha, Rakesh; Logroscino, Giancarlo; Looker, Katharine J.; Lopez, Alan D.; Lorkowski, Stefan; Lotufo, Paulo A.; Lozano, Rafael; Lucas, Timothy C. D.; Lunevicius, Raimundas; Lyons, Ronan A.; Macarayan, Erlyn Rachelle King; Maddison, Emilie R.; Abd el Razek, Hassan Magdy; Magis-Rodriguez, Carlos; Mahdavi, Mahdi; Majdan, Marek; Majdzadeh, Reza; Majeed, Azeem; Malekzadeh, Reza; Malhotra, Rajesh; Malta, Deborah Carvalho; Mamun, Abdullah A.; Manguerra, Helena; Manhertz, Treh; Mantovani, Lorenzo G.; Mapoma, Chabila C.; March, Lyn M.; Marczak, Laurie B.; Martinez-Raga, Jose; Henrique, Paulo; Martins, Viegas; Martins-Melo, Francisco Rogerlndio; Martopullo, Ira; Marz, Winfried; Mathur, Manu Raj; Mazidi, Mohsen; McAlinden, Colm; McGaughey, Madeline; McGrath, John J.; Mckee, Martin; Mehata, Suresh; Meier, Toni; Meles, Kidanu Gebremariam; Memiah, Peter; Memish, Ziad A.; Mendoza, Walter; Mengesha, Melkamu Merid; Mengistie, Mubarek Abera; Mengistu, Desalegn Tadese; Mensah, George A.; Meretoja, Atte; Meretoja, Tuomo J.; Mezgebe, Haftay Berhane; Micha, Renata; Millear, Anoushka; Miller, Ted R.; Minnig, Shawn; Mirarefin, Mojde; Mirrakhimov, Erkin M.; Misganaw, Awoke; Mishra, Shiva Raj; Mitchell, Philip B.; Mohammad, Karzan Abdulmuhsin; Mohammadi, Alireza; Mohammed, Shafiu; Mohammed, Kedir Endris; Mohammed, Muktar Sano Kedir; Mohan, Murali B. V.; Mokdad, Ali H.; Mollenkopf, Sarah K.; Monasta, Lorenzo; Montanez Hernandez, Julio Cesar; Montico, Marcella; Moradi-Lakeh, Maziar; Moraga, Paula; Morawska, Lidia; Mori, Rintaro; Morrison, Shane D.; Moses, Mark; Mountjoy-Venning, Cliff; Mruts, Kalayu Birhane; Mueller, Ulrich O.; Muller, Kate; Mudoch, Michele E.; Murthy, Srinivas; Murthy, Gudlavalleti Venkata Satyanarayana; Musa, Kamarul Imran; Nachega, Jean B.; Nagel, Gabriele; Naghavi, Mohsen; Naheed, Aliya; Naidoo, Kovin S.; Nangia, Vinay; Nasher, Jamal T.; Natarajan, Gopalakrishnan; Negasa, Dumessa Edessa; Negoi, Ionut; Negoi, Ruxandra Irina; Newton, Charles R.; Ngunjiri, Josephine Wanjiku; Cuong Tat Nguyen,; Quyen Le Nguyen, [Unknown; Grant Nguyen,; Trang Huyen Nguyen,; Minh Nguyen, [No Value; Nichols, Emma; Ningrum, Dina Nur Anggraini; Vuong Minh Nong,; Norheim, Ole F.; Norrving, Bo; Noubiap, Jean Jacques N.; Nyandwi, Alypio; Obermeyer, Carla Makhlouf; O'Donnell, Martin J.; Ogbo, Felix Akpojene; Oh, In-Hwan; Okoro, Anselm; Oladimeji, Olanrewaju; Olagunju, Andrew Toyin; Olagunju, Tinuke Oluwasefunmi; Olsen, Helen E.; Olusanya, Bolajoko Olubukunola; Olusanya, Jacob Olusegun; Ong, Kanyin; Opio, John Nelson; Oren, Eyal; Ortiz, Alberto; Osborne, Richard H.; Osgood-Zimmerman, Aaron; Osman, Majdi; Ota, Erika; Owolabi, Mayowa O.; Pa, Mahesh; Pacella, Rosana E.; Panda, Basant Kumar; Pandian, Jeyaraj D.; Papachristou, Christina; Park, Eun-Kee; Parry, Charles D.; Parsaeian, Mahboubeh; Patil, Snehal T.; Patten, Scott B.; Patton, George C.; Paudel, Deepak; Paulson, Katherine; Pearce, Neil; Pereira, David M.; Perez, Krystle Marie; Perico, Norberto; Pesudovs, Konrad; Peterson, Carrie Beth; Petri, William Arthur; Petzold, Max; Phillips, Michael Robert; Phipps, Geoffrey; Pigott, David M.; Pillay, Julian David; Pinho, Christine; Piradov, Michael A.; Plass, Dietrich; Pletcher, Martin A.; Popova, Svetlana; Poulton, Richie G.; Pourmalek, Farshad; Prabhakaran, Dorairaj; Prasad, Narayan; Purcell, Carrie; Purwar, Manorama; Qorbani, Mostafa; Rabiee, Rynaz H. S.; Radfar, Amir; Rafay, Anwar; Rahimi, Kazem; Rahimi-Movaghar, Afarin; Rahimi-Movaghar, Vafa; Rahman, Mahfuzar; Rahman, Muhammad Aziz; Rahman, Mohammad Hifz Ur; Rai, Rajesh Kumar; Rajsic, Sasa; Ram, Usha; Ranabhat, Chhabi Lal; Rangaswamy, Thara; Rankin, Zane; Rao, Paturi Vishnupriya; Rao, Puja C.; Rawaf, Salman; Ray, Sarah E.; Reiner, Robert C.; Reinig, Nikolas; Reitsma, Marissa; Remuzzi, Giuseppe; Renzaho, Andre M. N.; Resnikoff, Serge; Rezaei, Satar; Ribeiro, Antonio L.; Roba, Hirbo Shore; Robinson, Stephen R.; Rojas-Rueda, David; Rokni, Mohammad Bagher; Ronfani, Luca; Roshandel, Gholamreza; Roth, Gregory A.; Rothenbacher, Dietrich; Roy, Ambuj; Rubagotti, Enrico; Ruhago, George Mugambage; Saadat, Soheil; Safdarian, Mahdi; Safiri, Saeid; Sagar, Rajesh; Sahathevan, Ramesh; Sahraian, Mohammad Ali; Salama, Joseph; Saleh, Muhammad Muhammad; Salomon, Joshua A.; Salvi, Sundeep Santosh; Samy, Abdallah M.; Sanabria, Juan Ramon; Dolores Sanchez-Nino, Maria; Santomauro, Damian; Santos, Joao Vasco; Santos, Itamar S.; Milicevic, Milena M. Santric; Sartorius, Benn; Satpathy, Maheswar; Sawhney, Monika; Saxena, Sonia; Schelonka, Kathryn; Schmidt, Maria Ines; Schneider, Ione J. C.; Ben Schottker,; Schutte, Aletta E.; Schwebel, David C.; Schwendicke, Falk; Seedat, Soraya; Sepanlou, Sadaf G.; Servan-Mori, Edson E.; Shaheen, Amira; Shaikh, Masood Ali; Shamsipour, Mansour; Islam, Sheikh Mohammed Shariful; Sharma, Rajesh; Sharma, Jayendra; She, Jun; Shi, Peilin; Shibuya, Kenji; Shields, Chloe; Shiferaw, Mekonnen Sisay; Shigematsu, Mika; Shiri, Rahman; Shirkoohi, Reza; Shirude, Shreya; Shishani, Kawkab; Shoman, Haitham; Siabani, Soraya; Sibai, Abla Mehio; Sigfusdottir, Inga Dora; Silberberg, Donald H.; Silva, Joao Pedro; Santos Silva, Diego Augusto; Alves Silveira, Dayane Gabriele; Singh, Jasvinder A.; Singh, Virendra; Singh, Om Prakash; Singh, Narinder Pal; Sinha, Dhirendra Narain; Skiadaresi, Eirini; Skirbekk, Vegard; Slepak, Erica Leigh; Smith, David L.; Smith, Mari; Sobaih, Badr H. A.; Sobngwi, Eugene; Soljak, Michael; Sorensen, Reed J. D.; Moraes Sousa, Tatiane Cristina; Sposato, Luciano A.; Sufiyan, Muawiyyah Babale; Abdulkader, Rizwan Suliankatchi; Sunguya, Bruno F.; Sur, Patrick J.; Swaminathan, Soumya; Sykes, Bryan L.; Sylte, Dillon; Szoeke, Cassandra E. I.; Tabares-Seisdedos, Rafael; Tadakamadla, Santosh Kumar; Taffere, Getachew Redae; Takala, Jukka S.; Tandon, Nikhil; Tanne, David; Tarekegn, Yihunie L.; Tavakkoli, Mohammad; Taveira, Nuno; Taylor, Hugh R.; Tegegne, Teketo Kassaw; Tehrani-Banihashemi, Arash; Tekelab, Tesfalidet; Shifa, Girma Temam; Terkawi, Abdullah Sulieman; Tesfaye, Dawit Jember; Tesssema, Belay; Thakur, J. S.; Thamsuwan, Ornwipa; Theadom, Alice M.; Theis, Andrew M.; Thomas, Katie E.; Thomas, Nihal; Thompson, Robert; Thrift, Amanda G.; Tobe-Gai, Ruoyan; Tobollik, Myriam; Tonelli, Marcello; Topor-Madry, Roman; Tortajada, Miguel; Touvier, Mathilde; Traebert, Jefferson; Tran, Bach Xuan; Troeger, Christopher; Truelsen, Thomas; Tsoi, Derrick; Tuzcu, Emin Murat; Tymeson, Hayley; Tyrovolas, Stefanos; Ukwaja, Kingsley Nnanna; Undurraga, Eduardo A.; Uneke, Chigozie Jesse; Updike, Rachel; Uthman, Olalekan A.; Uzochukwu, Benjamin S. Chudi; van Boven, Job F. M.; Varughese, Santosh; Vasankari, Tommi; Veerman, Lennert J.; Venkatesh, S.; Venketasubramanian, Narayanaswamy; Vidavalur, Ramesh; Vijayakumar, Lakshmi; Violante, Francesco S.; Vishnu, Abhishek; Vladimirov, Sergey K.; Vlassov, Vasiliy Victorovich; Vollset, Stein Emil; Vos, Theo; Wadilo, Fiseha; Wakayo, Tolassa; Wallin, Mitchell T.; Wang, Yuan-Pang; Weichenthal, Scott; Weiderpass, Elisabete; Weintraub, Robert G.; Weiss, Daniel J.; Werdecker, Andrea; Westerman, Ronny; Whiteford, Harvey A.; Wijeratne, Tissa; Williams, Hywel C.; Wiysonge, Charles Shey; Woldeyes, Belete Getahun; Wolfe, Charles D. A.; Woodbrook, Rachel; Woolf, Anthony D.; Workicho, Abdulhalik; Xavier, Denis; Xu, Gelin; Yadgir, Simon; Yaghoubi, Mohsen; Yakob, Bereket; Yan, Lijing L.; Yano, Yuichiro; Ye, Pengpeng; Yihdego, Mahari Gidey; Yimam, Hassen Hamid; Yip, Paul; Yonemoto, Naohiro; Yoon, Seok-Jun; Yotebieng, Marcel; Younis, Mustafa Z.; Yu, Chuanhua; Zaidi, Zoubida; Zaki, Maysaa El Sayed; Zegeye, Elias Asfaw; Zenebe, Zerihun Menlkalew; Zhang, Xueying; Zheng, Yingfeng; Zhou, Maigeng; Zipkin, Ben; Zodpey, Sanjay; Zoeckler, Leo; Zuhlke, Liesl Joanna; Murray, Christopher J. L.

    2017-01-01

    Background Measurement of changes in health across locations is useful to compare and contrast changing epidemiological patterns against health system performance and identify specific needs for resource allocation in research, policy development, and programme decision making. Using the Global

  5. Corrigendum to "A helium-based model for the effects of radiation damage annealing on helium diffusion kinetics in apatite" [Earth Planet. Sci. Lett. 477 (2017) 195-204

    Science.gov (United States)

    Willett, Chelsea D.; Fox, Matthew; Shuster, David L.

    2018-01-01

    The authors regret to have found two typographical errors in the publication, both of which preclude interested readers from reproducing Figure 1. None of the conclusions or findings presented in the original publication is influenced by these typographical errors.

  6. Multibeam collection for KN195-12: Multibeam data collected aboard Knorr from 2009-07-27 to 2009-08-09, departing from Honolulu, HI and returning to Honolulu, HI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  7. Por uma concepção disciplinar autônoma da informação documentária 10.5007/1518-2924.2006v11n22p195

    Directory of Open Access Journals (Sweden)

    Leilah Santiago Bufrem

    2006-12-01

    Full Text Available MOREIRO GONZÁLEZ, José Antonio. Conceptos introductorios al estudio de la información documental. Salvador: EDUFBA/Fondo Editorial de la Pontificia Universidad Católica del Perú, 2005.

  8. Decreased Affinity of Recombinant Human Tumor Necrosis Factor-related Apoptosis-inducing Ligand (rhTRAIL) D269H/E195R to Osteoprotegerin (OPG) Overcomes TRAIL Resistance Mediated by the Bone Microenvironment

    NARCIS (Netherlands)

    Bosman, Matthieu C. J.; Reis, C.R.; Schuringa, Jan J.; Vellenga, Edo; Quax, Wim J.

    2014-01-01

    The bone marrow microenvironment provides important signals for the survival and proliferation of hematopoietic and malignant cells. In multiple myeloma, plasma cells are surrounded by stromal cells including osteoblasts. These stromal cells protect multiple myeloma cells from apoptosis induced by

  9. Changes in serum cartilage oligomeric matrix protein (COMP), plasma CPK and plasma hs-CRP in relation to running distance in a marathon (42.195 km) and an ultra-marathon (200 km) race.

    Science.gov (United States)

    Kim, Hyo Jeong; Lee, Yoon Hee; Kim, Chang Keun

    2009-03-01

    Marathon running is frequently associated with numerous cellular changes, but little information is available on the effects of exercise-mediated prolonged impact-stress on cartilage integrity. This study was undertaken to evaluate muscle and cartilage damage with different running distances. Twenty male marathoners and ultra-marathoners participated in the study. Serum COMP and plasma CPK and hs-CRP were measured as markers of cartilage and muscle damage and inflammation. Serum COMP was increased 1.6-fold at 10 km during a marathon race and declined to the pre-race level after 2 days recovery. In contrast, serum COMP was increased 1.9-fold after a 200-km race and maintained until day 3 of recovery, only returning to the pre-race level on day 6. Plasma CPK was increased at 10 km of the marathon race and up to threefold at the end of the race. This was further increased on day 1, only returning to pre-race level on day 6. Plasma CPK was increased 35-fold at the end of the 200-km race and remained increased until day 5. There was no change in plasma hs-CRP during the marathon race, but this was increased 3.4-fold by day 1, returning to the pre-race level on day 4. Plasma hs-CRP increased 40-fold by the end of the 200-km race and was still increased on day 6 of recovery. Therefore, longer distance running may induce more impact-stress both on muscle and cartilage. Further, the required time for recovery may vary with running distance and the tissue type, e.g. cartilage or skeletal muscle as in this case.

  10. Perfil antropométrico e risco cardiovascular de idosos institucionalizados na cidade de Pelotas
    doi: 10.12662/2317-3076jhbs.v3i4.198.p195-201.2015

    OpenAIRE

    Francine Silva dos Santos; Gicele Costa Mintem

    2015-01-01

    Introdução: Devido ao aumento da população idosa, é necessário verificar as características dos indivíduos nesta faixa etária, incluindo os institucionalizados, por sua maior vulnerabilidade aos distúrbios nutricionais. Objetivo: Identificar o perfil antropométrico e o risco cardiovascular de idosos institucionalizados. Métodos: Realizou-se o estudo em três Instituições de Longa Permanência, com indivíduos de 60 anos, ou mais, residentes em tempo integral nos locais participantes. Foram aferi...

  11. Physical data collected from Seaglider SG195 during Cuddy Survey in the North Pacific Ocean, Coastal Waters of Washington/Oregon deployed from 2013-10-25 to 2014-02-22 (NCEI Accession 0162357)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Seaglider is a buoyancy driven autonomous underwater vehicle (AUV) developed by scientists and engineers at the University of Washington's School of Oceanography and...

  12. Densification of Ce0.9Gd0.1O1.95 barrier layer by in-situ solid state reaction

    DEFF Research Database (Denmark)

    Ni, De Wei; Esposito, Vincenzo

    2014-01-01

    A novel methodology, called in-situ solid state reaction (SSR), is developed and achieved for the densification of gadolinia doped ceria (CGO) barrier layer (BL) within the solid oxide fuel cell (SOFC) technology. The method is based on the combined use of impregnation technique and a designed tw...... was proved on both screen printed and tape cast CGO-BL, showing feasibility for the densification of generic ceramic multilayer systems undergoing different constrained sintering conditions and for a large variety of materials. © 2014 Elsevier B.V. All rights reserved....

  13. Super-GCA connection with tensionless strings: Addendum to “Super-GCA from N=(2,2 super-Virasoro” [Phys. Lett. B 754 (2016 195–200

    Directory of Open Access Journals (Sweden)

    Ipsita Mandal

    2016-09-01

    Full Text Available In this addendum, we consider the connection between certain 2d super-GCA, obtained from the parametric contractions of 2d SCFTs, which can describe the constraint algebra of null spinning strings.

  14. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...

  15. ORF Sequence: NC_002936 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available se, catalytic subunit, putative/rubredoxin [Dehalococcoides ethenogenes 195] MSQQLPEPAEDLALFQLRLRSEAEASGYHLN...PDNAFVKMLAEGLLANRQRYGYQSCPCRLAEGNRKADLDIICPCDYRDADINEFGSCYCALYVDSQIAKGEKKPQPVPERRHAPKTLPKAKTAQAPASLAYPVWRCRVCGYLCGRDEAPDQCPICKADKERFELFMQ

  16. La0.99Co0.4Ni0.6O3−δ–Ce0.8Gd0.2O1.95 as composite cathode for solid oxide fuel cells

    DEFF Research Database (Denmark)

    Hjalmarsson, Per; Mogensen, Mogens Bjerg

    2011-01-01

    model consisting of a high frequency ZRQ circuit and a medium frequency Gerischer impedance, ZG. The resistance of ZG was found to decrease with approximately a factor of two as a consequence of infiltration of (La0.6Sr0.4)0.99CoO3 into the porous LCN60–CGO structure. RP of both infiltrated and non...

  17. Revista educação temática digital: aproximação entre educação e ciência da informação 10.5007/1518-2924.2007v12n23p195

    Directory of Open Access Journals (Sweden)

    Leilah Santiago Bufrem

    2007-12-01

    Full Text Available Análise do periódico Educação Temática Digital. Discorre sobre o histórico da revista desde a criação, em 1999, como Revista Online da Biblioteca Prof. Joel Martins. Examina o conteúdo temático dessa produção, enfatizando as aproximações entre a educação e a ciência da informação. Apresenta a distribuição dos 147 artigos por ano e por título da revista. Para discutir as tendências temáticas presentes nos artigos, realiza padronização dos termos da base de dados, com posterior reunião em grupos temáticos mais abrangentes e representativos de um espectro amplo de assuntos. Identifica como tema mais freqüente, entre o universo de descritores, a educação (incluindo-se os termos compostos como educação a distância, básica, colonial, cultural, entre outros seguida de ensino (ensino a distância, ensino inclusivo etc. e formação. Evidencia a contribuição da revista como expressão planejada de iniciativas editoriais interessadas nas questões da educação.

  18. Oxygen transport properties of tubular Ce0.9Gd0.1O1.95-La0.6Sr0.4FeO3−d composite asymmetric oxygen permeation membranes supported on magnesium oxide

    DEFF Research Database (Denmark)

    Ovtar, Simona; Gurauskis, Jonas; Bjørnetun Haugen, Astri

    2017-01-01

    with the theoretically estimated one, taking into account the transport properties of the composite, surface exchange losses, gas diffusion and gas conversion in the MgO support. The performance of the membrane was limited by the surface exchange for the operation in N2/air, CO2/air and H2/air at low temperatures...... and most probably by the porosity of the MgO support for the operation in H2/air at 850 °C. The stability tests of the membrane in CO2/air and H2/air configurations revealed that an initial degradation of the oxygen flux occurs and it is followed by a relatively stable performance. Post-mortem analysis...

  19. Scholars in International Relations Cite Books More Frequently than Journals: More Research is Needed to Better Understand Research Behaviour and Use. A Review of: Zhang, Li. ʺCitation Analysis for Collection Development: A Study of International Relations Journal Literature.ʺ Library Collections, Acquisitions, and Technical Services 31.3‐4 (2007: 195‐207.

    Directory of Open Access Journals (Sweden)

    Megan von Isenburg

    2009-09-01

    Full Text Available Objective – To determine primary type, format, language and subject category of research materials used by U.S. scholars of international relations. Also, to investigate whether research method, qualitative or quantitative, can be correlated with the type and age of sources that scholars use.Design – Citation analysis.Setting – Research articles published in three journals on international relations with high impact factors: International Organization, International Studies Quarterly, and World Politics.Subjects – A random sample of cited references taken from the 410 full‐length research articles published in these journals from 2000 to 2005. Cited references of articles written by authors of foreign institutions (i.e., non‐American institutions, as well as cited references of editorial and research notes, comments, responses, and review essays were excluded.Methods – Cited references were exported from ISI’s Social Science Citation Index (SSCI to MS Excel spreadsheets for analysis. Data was verified against original reference lists. Citations were numbered and identified by source format, place of publication (foreign or domestic, age, and language used, if other than English. The author used a random number generator to select a random sample of 651 from a total of 29,862 citations. Citations were randomly drawn from each journal according to the proportion of the journals’ citations to the total. These citations were analyzed by material type and language. The author also used the Library of Congress Classification Outline to identify the subject category of each book and journal citation in the sample. A separate sampling method was used to investigate if there is a relationship between research methodology and citation behaviour. Each of the original 410 articles was categorized according to research method: quantitative, qualitative or a combination of the two. Two articles representing qualitative research and two representing quantitative research were randomly selected from each of the three journals for each of the six years. Subsequently, five citations from each of the resulting pool of 72 articles were randomly selected to create a sample of 360 citations. These citations were analyzed by material type and age of source.Main Results – Analysis of the citation data showed that books (including monographs, edited books, book chapters and dictionaries made up 48.2% of the total citations; journals (including scholarly and non‐scholarly titles made up 38.4% of the citations; and government publications made up 4.5% of the citations. Electronic resources, which primarily refer to Web sites and digital collections in this study, represented 1.7% of the citations. Other sources of citations included magazines (1.1%, newspapers (1.1%, working papers (1.1%, theses (0.9%, conference papers not yet published as articles (0.6%, and a miscellaneous category, which included items such as committee minutes, radio broadcasts, unpublished materials and personal communications (2.5%. The average age of book citations was 14.3 years and the median age was 8 years. Foreign language citations represented 3.7% of the 651 total citations. The top ranked foreign languages were German (7, French (5, Russian (4, Spanish (3, Korean (2 and Swedish (number not given. Subject analysis of the citations revealed that 38% of all citations were from international relations and two related disciplines, political science, political theory, and public administration. Subject areas outside international relations included social sciences (23.4% ‐ including economics, commerce, industries and finance, history (16.3%, sociology (6.2%, and law (5.9%. Citations from philosophy, psychology, military science and general works together made up 7.3% of the total citations. Citations from science, linguistics, literature, geography and medicine made up less than 2% of the total.Authors of qualitative research articles were more likely to cite books (56.7% than journals (29.4% while authors of quantitative research articles were more likely to cite journals (58.3% than books (28.9%. Authors of qualitative research articles were also more likely to cite government publications and electronic resources than those of quantitative articles. However, authors of quantitative research articles were more likely to cite other materials, such as dissertations, conference papers, working papers and unpublished materials.The age of cited materials for both qualitative and quantitative research articles is similar. Citations to recent materials up to 5 years old were most frequent, followed by materials 6 to 10 years old, materials 11 to 15 years old, and those 26 or more years old. The least frequently cited materials were 16 to 20 and 21 to 25 years old.Conclusion – Scholars in international relations primarily cite books, followed by journals and government publications. Citations to electronic resources such as Web sites and digital collections, and to other materials are far less common. Scholars primarily cite English‐language materials on international relations and related subjects. Authors of qualitative research articles are more likely to cite books than journals, while authors of quantitative research articles are more likely to cite journals than books. Recent materials are more frequently cited than older materials, though materials that are more than 26 years old are still being cited regularly.

  20. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  1. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  2. Nuclear and in-source laser spectroscopy with the ISAC yield station

    Energy Technology Data Exchange (ETDEWEB)

    Kunz, Peter, E-mail: pkunz@triumf.ca; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning [TRIUMF, 4004 Wesbrook Mall, Vancouver, British Columbia V6T 2A3 (Canada); Andreoiu, Corina; Wong, Fiona [Department of Chemistry, Simon Fraser University, Burnaby, British Columbia V5A 1S6 (Canada)

    2014-05-15

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10{sup 11} ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of {sup 46}K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  3. Nuclear and in-source laser spectroscopy with the ISAC yield station.

    Science.gov (United States)

    Kunz, Peter; Andreoiu, Corina; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning; Wong, Fiona

    2014-05-01

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10(11) ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of (46)K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  4. Radiopharmaceutical chemistry of targeted radiotherapeutics, part 4: Strategies for211At labeling at high activities and radiation doses of211At α-particles.

    Science.gov (United States)

    Pozzi, Oscar R; Zalutsky, Michael R

    2017-03-01

    Alpha particles are radiation of high energy and short range, properties that can lead to radiolysis-mediated complications in labeling chemistry at the high radioactivity levels required for clinical application. In previous papers in this series, we have shown that radiation dose has a profound effect on the astatine species that are present in the labeling reaction and their suitability for the synthesis of N-succinimidyl 3-[ 211 At]astatobenzoate. The purpose of this study was to evaluate the effects of adding N-chlorosuccinimide (NCS) to the methanol solution used for initial isolation of 211 At after distillation, a process referred to as 211 At stabilization, on 211 At chemistry after exposure to high radiation doses. High performance liquid chromatography was used to evaluate the distribution of 211 At species present in methanol in the 500-65,000Gy radiation dose range and the synthesis of SAB from N-succinimidyl 3-(tri-n-butylstannyl)benzoate in the 500-120,000Gy radiation dose range using different 211 At timeactivity combinations under conditions with/without 211 At stabilization. In the absence of NCS stabilization, a reduced form of astatine, At(2), increased with increasing radiation dose, accounting for about half the total activity by about 15,000Gy, while with stabilization, At(2) accounted for 60,000Gy. SAB yields without stabilization rapidly declined with increasing dose, falling to ~20% at about 5000Gy while with stabilization, yields >80% were obtained with 211 At solutions stored for more than 23h and receiving radiation doses >100,000Gy. Adding NCS to the methanol solution used for initial isolation of 211 At is a promising strategy for countering the deleterious effects of radiolysis on 211 At chemistry. This strategy could facilitate the ability to perform 211 At labeling at sites remote from its production and at the high activity levels required for clinical applications. Copyright © 2016 Elsevier Inc. All rights reserved.

  5. Genetic and bibliographic information: EYA4 [GenLibi

    Lifescience Database Archive (English)

    Full Text Available ed cardiomyopathy; sensorineural hearing loss Cardiovascular Diseases (C14) > Heart Diseases (C14.280) > Car...diomegaly (C14.280.195) > Cardiomyopathy, Dilated (C14.280.195.160) Cardiovascular Diseases (C14) > Heart Diseases

  6. Gclust Server: 47694 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Cluster Sequences Related Sequences(16) 195 MEE56 (maternal effect embryo arrest 56); metal ion binding 2...Sequence length 195 Representative annotation MEE56 (maternal effect embryo arrest 56); metal ion binding Number

  7. Gclust Server: 36128 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 36128 HSA_21070976 Cluster Sequences - 195 NP_620307.1 diablo isoform 3 precursor ;... to cluster sequences Cluster Sequences Link to related sequences - Sequence length 195 Representative annotation NP_620307.1 diablo

  8. ORF Alignment: NC_004668 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 583] ... Length = 110 ... Query: 136 ETAGAIMTTEFVSIVANQTVRSAMYVLKNQADMAETIYYVYVVDQENHLVGVISLRDLIV 195 ... ETAG...AIMTTEFVSIVANQTVRSAMYVLKNQADMAETIYYVYVVDQENHLVGVISLRDLIV Sbjct: 1 ... ETAGAIMTTEFVSIVANQTVRSAMYVLKNQADMAETIYYVYVVDQENHLVGVISLRDLIV 60 ...

  9. 78 FR 24985 - Airworthiness Directives; Cessna Aircraft Company Airplanes

    Science.gov (United States)

    2013-04-29

    ... Company Airplanes AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final rule; correction.... That AD applies to all Cessna Aircraft Company (Cessna) Models 190, 195 (L-126A,B,C), 195A, and 195B... amendatory instruction are corrected to read as follows: 2004-21-08 R1 Cessna Aircraft Company: Amendment 39...

  10. Diffusion of Implanted Radioisotopes in Solids

    CERN Multimedia

    2002-01-01

    Implantation of radioisotopes into metal and semiconductor samples is performed. The implanted isotope or its decay-product should have a half-life long enough for radiotracer diffusion experiments. Such radioisotopes are utilized to investigate basic diffusion properties in semiconductors and metals and to improve our understanding of the atomic mechanisms of diffusion. For suitably chosen systems the combination of on-line production and clean implantation of radioisotopes at the ISOLDE facility opens new possibilities for diffusion studies in solids. \\\\ \\\\ The investigations are concentrated on diffusion studies of $^{195}$Au in amorphous materials. The isotope $^{195}$Au was obtained from the mass 195 of the mercury beam. $^{195}$Hg decays into $^{195}$Au which is a very convenient isotope for diffusion experiments. \\\\ \\\\ It was found that $^{195}$Au is a slow diffusor in amorphous Co-Zr alloys, whereas Co is a fast diffusor in the same matrix. The ``asymmetry'' in the diffusion behaviour is of considerab...

  11. 20 CFR 655.700 - What statutory provisions govern the employment of H-1B, H-1B1, and E-3 nonimmigrants and how do...

    Science.gov (United States)

    2010-04-01

    ... issued H-1B visas— (i) 195,000 in fiscal year 2001; (ii) 195,000 in fiscal year 2002; (iii) 195,000 in... employment of H-1B, H-1B1, and E-3 nonimmigrants and how do employers apply for H-1B, H-1B1, and E-3 visas... Requirements for Employers Seeking To Employ Nonimmigrants on H-1b Visas in Specialty Occupations and as...

  12. ORF Alignment: NC_002936 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available e kinase ... [Dehalococcoides ethenogenes 195] ... Length = 120 ... Query: 20 ... LKKERLKYRELFNRANDA...ILLFKFNSPNEPVTITEANTAACKHFGYTYEELIGKTNLFID 79 ... LKKERLKYRELFNRANDAILLFKF...NSPNEPVTITEANTAACKHFGYTYEELIGKTNLFID Sbjct: 1 ... LKKERLKYRELFNRANDAILLFKFNSPNEPVTITEANTAACKHFGYTYEELIGKTNLFID 60 ...

  13. ORF Alignment: NC_002936 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available utative ... [Dehalococcoides ethenogenes 195] ... Length = 163 ... Query: 8 ... KVSMEDIARKARVSPTTIY...NNFGGRKALVQGVVKKIIDDNIAQAKSIMAGSLPFPDKIQL 67 ... KVSMEDIARKARVSPTTIYNNFGGR...KALVQGVVKKIIDDNIAQAKSIMAGSLPFPDKIQL Sbjct: 1 ... KVSMEDIARKARVSPTTIYNNFGGRKALVQGVVKKIIDDNIAQAKSIMAGSLPFPDKIQL

  14. ORF Alignment: NC_002936 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Dehalococcoides ethenogenes 195] ... Length = 86 ... Query: 1 ... MSLHAGILKLWLDLPENTSLKGKXXXXXXXXXXXXNRFNLSVAEAEEMDR...WKTAVIGISC 60 ... MSLHAGILKLWLDLPENTSLKGK ... NRFNLSVAEAEEMDR...WKTAVIGISC Sbjct: 1 ... MSLHAGILKLWLDLPENTSLKGKRQIIQPLIRQLQNRFNLSVAEAEEMDRWKTAVIGISC 60 ...

  15. ORF Alignment: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available YVVKTG ... QNIEPE Sbjct: 1 ... KIREFLKEELGLSSRLIRSAAIDKRIKVDGVAVKMNYVVKTGEEIKIELSKKESQNIEPE 60 ... Query: 136 NTSGLI...IIGKNQYAHMVLSNEMKTDKFQKRYLAIVHGNLEEKEGTINRPIYRPAEDTIKR 195 ... NTSGLIIIGKNQYAHMVLSNEMKTDKFQ...KRYLAIVHGNLEEKEGTINRPIYRPAEDTIKR Sbjct: 121 NTSGLIIIGKNQYAHMVLSNEMKTDKFQKRYLAIVHG

  16. Alpha particle emitters in medicine

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, D.R.

    1989-09-01

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ({sup 211}At) and natural bismuth-212 ({sup 212}Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ({sup 223}Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs.

  17. α decay of the very neutron-deficient isotopes 197-199Fr

    Science.gov (United States)

    Kalaninová, Z.; Andreyev, A. N.; Antalic, S.; Heßberger, F. P.; Ackermann, D.; Andel, B.; Drummond, M. C.; Hofmann, S.; Huyse, M.; Kindler, B.; Lane, J. F. W.; Liberati, V.; Lommel, B.; Page, R. D.; Rapisarda, E.; Sandhu, K.; Šáro, Š.; Thornthwaite, A.; Van Duppen, P.

    2013-04-01

    Decay properties of the very neutron-deficient isotopes 197-199Fr were studied at the velocity filter Separator for Heavy Ion reaction Products (SHIP) at GSI in Darmstadt. The isotopes were produced in the 2n-4n evaporation channels of the fusion-evaporation reaction 60Ni+141Pr → 201Fr*. Improved α-decay properties of 199Fr were determined and the possible existence of two α-decaying states in this nucleus is discussed. For the isotope 198Fr a broad α-decay energy distribution was detected in the range of (7470-7930) keV and two α-decaying states were observed with half-lives of 1.1(7) and 15(3) ms. The new isotope 197Fr was identified based on the observation of one α-decay chain yielding Eα=7728(15) keV and T1/2=0.6-0.3+3.0 ms. The systematics of reduced α-decay widths are presented for neutron-deficient francium, radon, and astatine isotopes.

  18. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Directory of Open Access Journals (Sweden)

    Sherif S Nafee

    Full Text Available Thallium (81(217Tl, Bismuth (83(217Bi, Astatine (85(217At, Francium (87(217Fr, Actinium (89(217Ac and Protactinium (91(217Pa are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221Fr-, (221Ac- and (221Pa-α-decays.

  19. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Science.gov (United States)

    Nafee, Sherif S; Shaheen, Salem A; Al-Ramady, Amir M

    2016-01-01

    Thallium (81(217)Tl, Bismuth (83(217)Bi), Astatine (85(217)At), Francium (87(217)Fr), Actinium (89(217)Ac) and Protactinium (91(217)Pa) are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α) has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF) calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221)Fr-, (221)Ac- and (221)Pa-α-decays.

  20. On the theory of time dilation in chemical kinetics

    Science.gov (United States)

    Baig, Mirza Wasif

    2017-10-01

    The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

  1. SPECT assay of radiolabeled monoclonal antibodies. Progress report, September 1, 1992--August 24, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1993-08-20

    The overall goal of this project is to improve the effectiveness of single photon emission computed tomography (SPECT) to image and quantify radiolabeled monoclonal antibodies. During the past year, we have made significant progress toward this goal, and this report summarizes that work. Our efforts have been mainly directed along three fronts. First, we have developed and tested new reconstruction methods including three-dimensional iterative algorithms that model non-uniform attenuation and distance-dependent detector response. Both fan beam and parallel beam collimator geometries have been modeled and novel ways of improving the efficiency of the computationally intensive methods have been introduced. Second, an ultra-high resolution, small field-of-view pinhole collimator has been constructed and evaluated. Reconstructed spatial resolution of 1 to 3 mm (FWHM) has been achieved in phantom scans with a useful field-of-view of 9 to 10 cm. Finally, we have investigated the ability of SPECT to image and quantify astatine-211 distributions. Reconstructed images of phantom data demonstrated quantitative accuracy to within 10% with proper attenuation and scatter compensation.

  2. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Science.gov (United States)

    Marsh, B. A.; Andel, B.; Andreyev, A. N.; Antalic, S.; Atanasov, D.; Barzakh, A. E.; Bastin, B.; Borgmann, Ch.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Dehairs, M.; Derkx, X.; De Witte, H.; Fedorov, D. V.; Fedosseev, V. N.; Focker, G. J.; Fink, D. A.; Flanagan, K. T.; Franchoo, S.; Ghys, L.; Huyse, M.; Imai, N.; Kalaninova, Z.; Köster, U.; Kreim, S.; Kesteloot, N.; Kudryavtsev, Yu.; Lane, J.; Lecesne, N.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Molkanov, P. L.; Nicol, T.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Schweikhard, L.; Seliverstov, M. D.; Sels, S.; Sjödin, A. M.; Truesdale, V.; Van Beveren, C.; Van Duppen, P.; Wendt, K.; Wienholtz, F.; Wolf, R. N.; Zemlyanoy, S. G.

    2013-12-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  3. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  4. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  5. Evaluating 99mTc Auger electrons for targeted tumor radiotherapy by computational methods.

    Science.gov (United States)

    Tavares, Adriana Alexandre S; Tavares, João Manuel R S

    2010-07-01

    Technetium-99m (99mTc) has been widely used as an imaging agent but only recently has been considered for therapeutic applications. This study aims to analyze the potential use of 99mTc Auger electrons for targeted tumor radiotherapy by evaluating the DNA damage and its probability of correct repair and by studying the cellular kinetics, following 99mTc Auger electron irradiation in comparison to iodine-131 (131I) beta minus particles and astatine-211 (211At) alpha particle irradiation. Computational models were used to estimate the yield of DNA damage (fast Monte Carlo damage algorithm), the probability of correct repair (Monte Carlo excision repair algorithm), and cell kinetic effects (virtual cell radiobiology algorithm) after irradiation with the selected particles. The results obtained with the algorithms used suggested that 99mTc CKMMX (all M-shell Coster-Kroning--CK--and super-CK transitions) electrons and Auger MXY (all M-shell Auger transitions) have a therapeutic potential comparable to high linear energy transfer 211At alpha particles and higher than 131I beta minus particles. All the other 99mTc electrons had a therapeutic potential similar to 131I beta minus particles. 99mTc CKMMX electrons and Auger MXY presented a higher probability to induce apoptosis than 131I beta minus particles and a probability similar to 211At alpha particles. Based on the results here, 99mTc CKMMX electrons and Auger MXY are useful electrons for targeted tumor radiotherapy.

  6. Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

    Energy Technology Data Exchange (ETDEWEB)

    Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se

    2005-08-01

    Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

  7. Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

  8. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  9. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  10. Book Review: Organizations: A Systems Approach

    DEFF Research Database (Denmark)

    Schoeneborn, Dennis

    2016-01-01

    Review of: Stefan Kühl: Organizations. A Systems Approach (trans. P. Schmitz). Farnham: Gower Publishing, 2013. 195 pp. £14.99. ISBN 9781472413413.......Review of: Stefan Kühl: Organizations. A Systems Approach (trans. P. Schmitz). Farnham: Gower Publishing, 2013. 195 pp. £14.99. ISBN 9781472413413....

  11. Evaluation of the Military Criminal Investigative Organizations Sexual Assault Investigations

    Science.gov (United States)

    2013-07-09

    and procedures for completing, retaining, and storing. CID Regulation ( CIDR ) 195-1, “Criminal Investigation (Operational Procedures),” March 22, 2010...in the case folder.” CIDR 195-1, section 5-7c.6, further states that “[s]pecial care will be taken to see that any written statement and/or notes

  12. 77 FR 49002 - Towing Safety Advisory Committee; Meeting

    Science.gov (United States)

    2012-08-15

    ... then recess for the separate but concurrent meetings of the four subcommittees, ``Recommendations for... revision of NVIC 1-95, Voluntary Training Standards for Entry-Level Personnel on Towing Industry Vessels... revision of NVIC 1-95, Voluntary Training Standards for Entry-Level Personnel on Towing Industry Vessels...

  13. Search for shipwrecks in Goa water

    Digital Repository Service at National Institute of Oceanography (India)

    Thakkar, M.

    stream_size 3 stream_content_type text/plain stream_name 2_Indian_Conf_Mar_Archaeol_I.O._Countries_1990_195.pdf.txt stream_source_info 2_Indian_Conf_Mar_Archaeol_I.O._Countries_1990_195.pdf.txt Content-Encoding ISO-8859-1 Content...

  14. NCBI nr-aa BLAST: CBRC-MMUS-03-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-03-0072 ref|YP_181793.1| tail tape measure protein, TP901 family [Dehaloc...occoides ethenogenes 195] gb|AAW39679.1| tail tape measure protein, TP901 family [Dehalococcoides ethenogenes 195] YP_181793.1 0.56 23% ...

  15. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 195 of 195 ... Vol 9, No 2 (2012), The Politics and Challenge of Institutional ... evidence from the Bilateral Real Exchange Rate between Mexico ... Vol 7, No 1 (2010), Women in Politics in Ghana: A Study on Local Government in the ...

  16. Dicty_cDB: Contig-U02685-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e mRNA, co... 195 2e-48 AB074145_1( AB074145 |pid:none) Synthetic construct gene for Raich... 195 2e-48 BT04...97 |pid:none) Synthetic construct gene for Raich... 160 5e-38 AB060650_1( AB060650 |pid:none) Mus musculus m

  17. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 195 of 195 ... Vol 10, No 1-2 (2010), Shoulder Dislocation in the course of Revenue Collection: A Need to Caution Revenue Agents in Port Harcourt, Abstract PDF ... Vol 10, No 1-2 (2010), The Effects of Crude Neem Leaf Acetone-Water Extract on Prothrombin Time (PT) and Activated Partial Thromboplastin Time ...

  18. 76 FR 26793 - Pipeline Safety: Request for Special Permit

    Science.gov (United States)

    2011-05-09

    ... exception in two 195.406(a)(1), general categories: First for permission and 195.653. to allow flexible steel pipe in Federally regulated service, and second, to adopt the use of requirements and standards appropriate for flexible steel pipes. Belle Fourche further seeks permission to install 4-inch FlexSteelTM...

  19. Domain Modeling: NP_001075224.1 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_001075224.1 chr7 CRYSTAL STRUCTURE OF INVASIN: A BACTERIAL INTEGRIN-BINDING PROT...EIN c1cwva_ chr7/NP_001075224.1/NP_001075224.1_holo_195-672.pdb swppa 195F,196G,197G,198P,225K,277V,278G,279G CIT 0 ...

  20. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15967089 >1jsxA 1 190 1 195 3e-31 ... emb|CAC47915.1| PROBABLE GLUCOSE INHIBITED DIVISIO...N PROTEIN B [Sinorhizobium ... meliloti] ref|NP_387442.1| PROBABLE GLUCOSE INHIBITED ... DIVISIO...e gidB (Glucose ... inhibited division protein B) ... Length = 195 ...

  1. Environmental Law Deskbook

    Science.gov (United States)

    1991-10-01

    19-5 1908 VOLATILE ORGANIC COMPOUNDS (VOCS) 19-5 1909 ACID RAIN 19-6 1910 GLOBAL CLIMATE PROTECTION 19-7 1911 TOXIC AIR POLLUTION 19-7 1912 PERMITS...1910 GLOBAL CLIMATE PROTECTION . Title VI of the 1990 amendments reflects congressional concern for stratospheric ozone and "greenhouse effect." To

  2. 77 FR 1062 - Arbitration Panel Decision Under the Randolph-Sheppard Act

    Science.gov (United States)

    2012-01-09

    ... denied her bid to manage Vending Facility 195, a vending machine facility, at the Internal Revenue... synopsis of each arbitration panel decision affecting the administration of vending facilities on Federal... vendors notifying them of a Level II vending opening at Vending Facility 195. On November 5, 2009...

  3. Single and binary adsorption of reactive dyes from aqueous solutions onto clinoptilolite.

    Science.gov (United States)

    Sismanoglu, Tuba; Kismir, Yasemin; Karakus, Selcan

    2010-12-15

    The adsorption of Reactive Blue 21 (RB21) and Reactive Red 195 (RR195) onto clinoptilolite type natural zeolite (ZEC) has been investigated at 298.15K. The uptake of single and binary reactive dyes from aqueous solutions has been determined by UV-vis spectroscopy. Two mono-component (RB21 and RR195) and binary component (RB21 with RR195, and RR195 with RB21), isotherms were determined. The mono-component Langmuir isotherm model was applied to experimental data and the isotherm constants were calculated for RB21 and RR195 dyes. The monolayer coverage capacities of clinoptilolite for RB21 and RR195 dyes in single solution system were found as 9.652 and 3.186 mg/g, respectively. Equilibrium adsorption for binary systems was analyzed by using the extended Langmuir models. The rate of kinetic processes of single and binary dye systems onto clinoptilolite was described by using two kinetics adsorption models. The pseudo-second-order model was the best choice among the kinetic models to describe the adsorption behaviour of single and binary dyes onto clinoptilolite. Copyright © 2010 Elsevier B.V. All rights reserved.

  4. Evaluation of the Military Criminal Investigative Organizations’ Adult Sexual Assault Investigation Policies

    Science.gov (United States)

    2014-09-16

    of a sexual assault incident.” Within CID, according to U.S. Army Criminal Investigation Command Regulation ( CIDR ) 195-1, “Criminal Investigation...agrees or declines to cooperate in the criminal investigation. CIDR 195-1, paragraph 15.1.h.(7), states: When making a restricted report, the victim is...enforcement programs. . . .” CIDR 195-1, paragraph 15.6.d., describes what it identifies as “non-CID purview offenses”7 as follows: If the

  5. Structure of $^{191}$Pb from $\\alpha$- and $\\beta$-decay spectroscopy

    CERN Document Server

    Cocolios, T E; Van de Walle, J; Franchoo, S; Marsh, B A; Sjoedin, A M; Huyse, M; Zemlyanoy, S; Cocolios, T E; Bastin, B; Barzakh, A; Page, R D; Mane, E; Van Duppen, P; Darby, I G; Venhart, M; Kudryavtsev, Yu; Huber, G; Fedosseev, V N; Andreyev, A N; Keupers, M; Flanagan, K T; Stefan, I; Dexters, W; Koester, U; Antalic, S; Buscher, J; Molkanov, P; Fedorov, D V

    2010-01-01

    Complementary studies of $^{191}$Pb have been made in the $\\beta$- decay of $^{191}$Bi at LISOL (CRC) and in the $\\alpha$- decay of $^{195}$Po at ISOLDE (CERN). Fine structures in the $\\alpha$- decay of the low-spin and high-spin isomers of $^{195}$Po have been fully resolved. Identification of the parent state is made possible via isomer selection based on narrow-band laser frequency scanning. The $\\alpha$-particle and $\\gamma$-ray energies have been determined with greater precision. New $\\alpha$-particle and $\\gamma$-ray energies are identified. Branching ratios in the decay of $^{195}$Po and $^{191}$Pb have been examined.

  6. Optimizing MIBG therapy of neuroendocrine tumors: preclinical evidence of dose maximization and synergy

    Energy Technology Data Exchange (ETDEWEB)

    Mairs, Rob J. [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)], E-mail: r.mairs@beatson.gla.ac.uk; Boyd, Marie [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)

    2008-08-15

    [{sup 131}I]meta-Iodobenzylguanidine ([{sup 131}I]MIBG) has been used for the therapy of tumors of neuroectodermal origin since the 1980s. Its role in the management of these malignancies remains controversial because of the large variation in response rates. Appreciation of the mode of conveyance of [{sup 131}I]MIBG via the noradrenaline transporter into malignant cells and of factors that influence the activity of the uptake mechanism has indicated various ways in which the effectiveness of this type of targeted radiotherapy may be improved. Experimental observations indicate that radiolabeling of MIBG to high specific activity reduced the amount of cold competitor, thereby increasing tumor dose and minimizing pressor effects. We observed supra-additive tumor cell kill and inhibition of tumor growth following combined topotecan and [{sup 131}I]MIBG treatment. The improved efficacy is related to topotecan's increased disruption of DNA repair. Radiation damage to targeted tumors may also be enhanced by the use of the {alpha}-particle emitter [{sup 211}At]astatine rather than {sup 131}I as radiolabel. Furthermore, recent experimental findings indicate that [{sup 123}I]MIBG may have therapeutic potential over and above its utility as an imaging agent. It has recently been demonstrated that potent cytotoxic bystander effects were induced by the intracellular concentration of [{sup 131}I]MIBG, [{sup 123}I]MIBG or meta-[{sup 211}At]astatobenzylguanidine. Identification of the nature of bystander factors could be exploited to maximize the specificity and potency of MIBG-targeted radiotherapy. By employing a range of strategies, there are good prospects for the improvement of the [{sup 131}I]MIBG therapy of neuroectodermal tumors.

  7. Immuno-vectorization of radioelements emitters of alpha particles: a new therapy in cancerology; Immunovectorisation de radioelements emetteurs de particules alpha: une nouvelle voie therapeutique en cancerologie

    Energy Technology Data Exchange (ETDEWEB)

    Bourgeois, M

    2007-05-15

    The radio-immunotherapy is an anti cancerous therapy which consists in vectorising with immuno-specific agents very radio toxic radioelements on tumors or in their environment to destroy them. The first part of this report presents the different characteristics of antibodies as well as their means of production under monoclonal shapes specifically steered against a tumoral antigen of interest. The second part of this report replaces the importance of the immunological vectors in the context of the nuclear medicine. It is notably described that the different methods which allow to radio-label the vector, as well as the different ways of optimization which were envisaged to improve the targeting of radioelements on a tumor. These different developments allow to define the potential place of the alpha radio-immunotherapy in treatments and so re-place the interest of the experimental part. If the radio-immunotherapy, using beta emitters isotopes as the {sup 131}iodine or the{sup 90}yttrium, is today current in anti cancerous therapy, it finds limits because of the disintegration characteristics of the isotopes it uses. Indeed, compared with alpha particles, the beta particles deposit less energy by unit of length in the crossed material.The experimental part of this report aims at studying the feasibility of the coupling between an immunological vector and an alpha emitter isotope.The different tests led on the bismuth 213, the bismuth 212, the lead 212 and the astatine 211 demonstrated that the fixation of these radionuclides was possible. This research theme is strengthened by the construction in Nantes of a cyclotron with high energy ( A.R.R.O.N.A.X.) and the optimization of the obtained promising results should allow a therapeutic use in oncology of the alpha radio-immunotherapy. (N.C.)

  8. Locoregional therapy with α-emitting trastuzumab against peritoneal metastasis of human epidermal growth factor receptor 2-positive gastric cancer in mice.

    Science.gov (United States)

    Li, Huizi Keiko; Morokoshi, Yukie; Nagatsu, Kotaro; Kamada, Tadashi; Hasegawa, Sumitaka

    2017-08-01

    Peritoneal metastasis of gastric cancer (PMGC) is incurable and thus has an extremely poor prognosis. We have found, however, that locoregionally administered trastuzumab armed with astatine-211 ((211) At-trastuzumab) is effective against human epidermal growth factor receptor 2 (HER2)-positive PMGC in a xenograft mouse model. We first observed that (211) At-trastuzumab can specifically bind and effectively kill NCI-N87 (N87) cells, which are HER2-positive human metastatic GC cells, both in vitro and in s.c. tumors. We established a PMGC mouse model using N87 xenografts stably expressing luciferase to test α-particle radioimmunotherapy with (211) At-trastuzumab against PMGC. Biodistribution analysis in this PMGC mouse model revealed that the i.p. administration of (211) At-trastuzumab (1 MBq) was a more efficient means of delivery of (211) At into metastatic tumors than i.v. injection; the maximum tumor uptake with i.p. administration was over 60% injected dose per gram of tissue (%ID/g) compared to approximately 18%ID/g with i.v. injection. Surprisingly, a single i.p. injection of (211) At-trastuzumab (1 MBq) was sufficient to completely eradicate intraperitoneally disseminated HER2-positive GC xenografts in two of six treated mice by inducing DNA double-strand breaks, and to drastically reduce the tumor burden in another three mice. No bodyweight loss, leukocytopenia, or significant biochemical changes in liver or kidney function were observed in the treatment group. Accordingly, locoregionally administered (211) At-trastuzumab significantly prolonged the survival time of HER2-positive PMGC mice compared with control treatments. Our results provide a proof-of-concept demonstration that locoregional therapy with (211) At-trastuzumab may offer a new treatment option for HER2-positive PMGC. © 2017 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.

  9. 36 http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    195 e.v., Drachman. (1977), Hooper 1978, vir 'n bespreking van die verskillende argumente. 17. Bevestiging vir die oningeligtheid van die kenmerke van die fenomeen. "taal", en die gevolglike oppervlakkige en foutiewe uitsprake in die.

  10. Dua-Sharma, Prof. Sushil

    Indian Academy of Sciences (India)

    AIIMS), Ph.D. (Panjab), FAMS. Date of birth: 4 April 1926. Specialization: Neurophysiology, Reproductive Biology and Nutrition Address: C-195, Ramprastha, P.O. Chandernagar, Ghaziabad 201 011, U.P.. Contact: Mobile: 99863 39224

  11. The Theory of Global Governance, Constitutionalization and Comparative Constitutional Law

    Czech Academy of Sciences Publication Activity Database

    Blahož, Josef

    2013-01-01

    Roč. 3, č. 3 (2013), s. 195-207 ISSN 1805-8396 Institutional support: RVO:68378122 Keywords : globalization of political culture * global constitutionalism * comparative constitutional law Subject RIV: AG - Legal Sciences

  12. Target Costing und Product Life Cycle Costing als Instrument des Kostenmanagements

    OpenAIRE

    Fischer, Thomas

    1997-01-01

    Target Costing und Product Life Cycle Costing als Instrument des Kostenmanagements / Adolf Gerhard Coenenberg ; Thomas Fischer ; Jochen Schmitz. - In: Kostenmanagement / Carl-Christian Freidank ... (Hrsg.). - Berlin u.a. : Springer, 1997. - S. 195-232

  13. South African Journal of Higher Education - Vol 25, No 2 (2011)

    African Journals Online (AJOL)

    Speaking truth to power: Understanding education research and the educational turn in South Africa's new century · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. RJ Balfour, R Moletsane, J Karlsson, 195–215 ...

  14. 77 FR 10807 - Designation of One Entity Pursuant to Executive Order 13553

    Science.gov (United States)

    2012-02-23

    ..., Accountability, and Divestment Act of 2010 (Public Law 111-195). In the Order, the President took additional... to the Order. The listing for this entity is as follows: IRANIAN MINISTRY OF INTELLIGENCE AND...

  15. Methylomes of renal cell lines and tumors or metastases differ significantly with impact on pharmacogenes

    National Research Council Canada - National Science Library

    Winter, Stefan; Fisel, Pascale; Büttner, Florian; Rausch, Steffen; D'Amico, Debora; Hennenlotter, Jörg; Kruck, Stephan; Nies, Anne T; Stenzl, Arnulf; Junker, Kerstin; Scharpf, Marcus; Hofmann, Ute; van der Kuip, Heiko; Fend, Falko; Ott, German; Agaimy, Abbas; Hartmann, Arndt; Bedke, Jens; Schwab, Matthias; Schaeffeler, Elke

    2016-01-01

    .... Here we show through genome-wide DNA methylation profiling, that methylation patterns are concordant between primary ccRCC and macro-metastases irrespective of metastatic sites (rs ≥ 0.92). However, 195,038 (41...

  16. Native language, spoken language, translation and trade

    National Research Council Canada - National Science Library

    Melitz, Jacques; Toubal, Farid

    2014-01-01

    We construct new series for common native language and common spoken language for 195 countries, which we use together with series for common official language and linguistic proximity in order to draw inferences about (1...

  17. United States Counter-narcotics Policies towards Burma, and How the Illegal Myanmar Regime is Manipulating Those Policies to Commit Ethnic Genocide

    Science.gov (United States)

    2006-06-01

    country189. Although Malaysia has maintained a strong economic relationship with the Myanmar regime, many Malaysian foreign ministers have established...Company funneled the 195 Greek for “ sleep inducing poppy.” 196 Chouvy – Golden Triangle article

  18. Dicty_cDB: CFD893 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s cylindrus cDNA clone Antarctic 5', mRNA sequence. 90 5e-20 2 CF925067 |IF42_MOUSE Eukaryotic initiation fa... Fcylcold195 Fragilariopsis cylindrus SMART cDNA library (Clontech) Fragilariopsi

  19. Disease: H01113 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H01113 Acid phosphatase deficiency Acid phosphatase deficiency is caused by defects...(1970) PMID:4139985 Nadler HL Treatment of acid phosphatase deficiency disorders. Birth Defects Orig Artic Ser 9:195-7 (1973) ...

  20. Eimuntas Nekroshiuse teatripoeetika / Ruta Mazheikiene ; tõlk. Tiina Kattel

    Index Scriptorium Estoniae

    Mazheikiene, Ruta

    2004-01-01

    E. Nekroshiuse lavastustele iseloomulikest joontest, toetudes tema lavastustele "Hamlet" "Macbeth", "Othello", "Onu Vanja", "Nina". Samuti näitlejatega töötamise strateegiast. Kasut. kirjandus, lk. 194-195

  1. Ravimifirmad kingivad arstidele kalleid reise / Sirje Niitra, Sander Sõõrumaa ; kommenteerinud Marko Koistila, Andres Lehtmets, Anne Veskimeister

    Index Scriptorium Estoniae

    Niitra, Sirje, 1948-

    2010-01-01

    Ravimimüüjad toetasid 2009. aastal Eesti arstide ja apteekrite osalemist koolitustel ja teaduskonverentsidel 19,5 miljoni krooniga. Enim jagas toetusi originaalravimeid tootev GlaxoSmithKline Eesti OÜ. Kaart

  2. Hindemith: Symphonic Metamorphosis on Themes of Carl Maria von Weber / Jonathan Swain

    Index Scriptorium Estoniae

    Swain, Jonathan

    1990-01-01

    Uuest heliplaadist "Hindemith: Symphonic Metamorphosis on Themes of Carl Maria von Weber, Mathis der Maler - Symphony, Nobilissima visione - suite. Atlanta Symphony Orchestra, Yoel Levi" Telarc/ Conifer CD 80 195

  3. Genetics Home Reference: myotonic dystrophy

    Science.gov (United States)

    ... SJ. Myotonic dystrophy: emerging mechanisms for DM1 and DM2. Biochim Biophys Acta. 2007 Feb;1772(2):195- ... Moxley R. 140th ENMC International Workshop: Myotonic Dystrophy DM2/PROMM and other myotonic dystrophies with guidelines on ...

  4. CERN'S Fire and Rescue Group Gets New Ambulance

    CERN Multimedia

    2000-01-01

    The ambulance is to replace another based on the off-road vehicle design which was originally acquired for the civil engineering phase of LEP construction. Just one figure, in 1999, the CERN ambulance was called out 195 times.

  5. AUTHOR INDEX

    Indian Academy of Sciences (India)

    Wintec

    acetamido-2-deoxy-α-D- galactopyranoside antigen–lectin interaction. 195. Murugadoss A see Das S. 547. Murugavel R. Facile one-pot synthesis of functionalized organo- phosphonate esters via ketone insertion into bulky arylphosphites.

  6. Age-dependent increase in green autofluorescence of blood ...

    Indian Academy of Sciences (India)

    PRAKASH KUMAR

    267. Bratosin D, Mazurier J, Tissier J P, Estaquier J, Huart J J, Ameisen. J C, Aminoff D and Montreuil J 1998 Cellular and molecular mechanisms of senescent erythrocyte phagocytosis by macrophages. A review; Biochimie 80 173–195.

  7. Gclust Server: 96889 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Cluster Sequences Related Sequences(195) 339 iron compounds ABC transporter, permease protein 1 9.98e-01 0...Sequence length 339 Representative annotation iron compounds ABC transporter, permease protein Number of Sequences

  8. A Profile of Deaf-Blind Children within Various Types of Educational Facilities.

    Science.gov (United States)

    Jensema, Corinne Klein

    1980-01-01

    The author cites findings from a study of the educational placement of 195 deaf blind children. Results indicate that placement seems to be based on several factors, including level of intelligence and additional physical disabilities. (Author/CL)

  9. Prevalence and risk factors for Cysticercus tenuicollis in goats and sheep in Paraíba, northeastern Brazil

    Directory of Open Access Journals (Sweden)

    Dayana Firmino de Morais

    Full Text Available Abstract This study aimed to determine the prevalence and risk factors for C. tenuicollis among goats and sheep in slaughterhouses in Paraíba. 390 animals (195 goats and 195 sheep in the municipalities of Patos and Esperança, Paraíba, Brazil, were inspected between February and May 2014. The prevalence of C. tenuicollis was 39% (76/195 in goats and 17.4% (34/195 in sheep. In both species, most of the cysticerci vesicles were located at the omentum and mesentery. The only risk factor found was extensive sheep farming. It can be concluded that C. tenuicollis is highly prevalent in small ruminants in Paraíba, being more prevalent in goats than in sheep. Extensively-reared sheep were twice as likely to develop infection by this parasite.

  10. Challenges to obtaining parental permission for child participation in a school-based waterpipe tobacco smoking prevention intervention in Qatar

    National Research Council Canada - National Science Library

    Nakkash, Rima T; Al Mulla, Ahmad; Torossian, Lena; Karhily, Roubina; Shuayb, Lama; Mahfoud, Ziyad R; Janahi, Ibrahim; Al Ansari, Al Anoud; Afifi, Rema A

    2014-01-01

    .... Fifty three percent (2308/4314) of the parents returned permission forms; of those 19.5% of the total (840/4314) granted permission. This paper describes the challenges to obtaining parental permission...

  11. notes on the salient features of tax liens

    African Journals Online (AJOL)

    MLR

    Encyclopedia. Britannica Inc), 15th edition, at 195. 46. World Tax Series: Taxation in USA (1963), Harvard Program on Taxation,. (Commerce Clearing House Inc), p. 1266. 47 Evan Hayned (1929), Chattel Mortgage: Right of Creditors When Recordation ...

  12. Experimental determination of activation cross section of alpha-induced nuclear reactions on natPt

    Science.gov (United States)

    Hermanne, A.; Tárkányi, F.; Takács, S.; Shubin, Yu. N.; Kovalev, S.

    2006-10-01

    Alpha-particle induced nuclear reactions that result in the generation of several Hg (mass numbers 192, 193m, 193g, 195m, 195g, 197m, 197g, 199m) and Au (mass numbers 194, 195m, 195g, 196n, 196g, 198m, 198g, 199, 200m) radionuclides were investigated. The stacked-foil activation technique on natural platinum targets was used. Excitation functions are reported for Eα from threshold up to 37 MeV. Cross sections are reported for the first time for reactions of the type natPt(α, xn) ∗Hg ( x = 1-5) and natPd(α,p xn) ∗Au ( x = 1-5). The experimental results are compared with literature values and with model calculations performed with the ALICE-IPPE code. Use of the data for possible applications in comparison with our earlier results for proton and deuteron induced reactions is discussed.

  13. Early pregnancy plasminogen activator inhibitor-1 levels in Nigerian ...

    African Journals Online (AJOL)

    1 (PAI‑1) in normal pregnancy and preeclampsia and determined its relationship with disease severity. Subjects and Methods: This was a prospective cohort study of 195 normotensive, aproteinuric pregnant women without prior history of ...

  14. Influencia de la lactancia materna en la aparicion de habitos parafuncionales y maloclusiones. estudio transversal.(PRACTICA CLINICA)

    National Research Council Canada - National Science Library

    Morales-Chavez, Mariana Carolina; Stable-Del Vechio, Rosa M

    2014-01-01

    ..., y del sistema estomatognatico. Metodos: se realizo un estudio transversal en el cual se evaluaron 195 historia clinicas de pacientes con edades comprendidas entre 3 y 16 anos que acudieron al posgrado de odontopediatria de la Facultad...

  15. Promoting Awareness of Key Resources for Evidence-Informed Decision-making in Public Health: An Evaluation of a Webinar Series about Knowledge Translation Methods and Tools

    National Research Council Canada - National Science Library

    Yost, Jennifer; Mackintosh, Jeannie; Read, Kristin; Dobbins, Maureen

    2016-01-01

    ... - and knowledge translation, applying best evidence in practice. One such resource, the Registry of Methods and Tools, is a free online database of 195 methods and tools to support knowledge translation...

  16. Evolutionary signals of symbiotic persistence in the legume–rhizobia mutualism

    National Research Council Canada - National Science Library

    Gijsbert D. A. Werner; William K. Cornwell; Johannes H. C. Cornelissen; E. Toby Kiers

    2015-01-01

    ... ) and nitrogen-fixing bacteria, asking how labile is symbiosis across different host clades. We find that more than half of the 1,195 extant nodulating legumes analyzed have a high likelihood (>95...

  17. A novel and selective inhibitor of PKC ζ potently inhibits human breast cancer metastasis in vitro and in mice.

    Science.gov (United States)

    Wu, Jing; Liu, Shuye; Fan, Zhijuan; Zhang, Lei; Tian, Yaqiong; Yang, Rui

    2016-06-01

    Cell motility and chemotaxis play pivotal roles in the process of tumor development and metastasis. Protein kinase C ζ (PKC ζ) mediates epidermal growth factor (EGF)-stimulated chemotactic signaling pathway through regulating cytoskeleton rearrangement and cell adhesion. The purpose of this study was to develop anti-PKC ζ therapeutics for breast cancer metastasis. In this study, a novel and high-efficient PKC ζ inhibitor named PKCZI195.17 was screened out through a substrate-specific strategy. MTT assay was used to determine the cell viability of human breast cancer MDA-MB-231, MDA-MB-435, and MCF-7 cells while under PKCZI195.17 treatment. Wound-healing, chemotaxis, and Matrigel invasion assays were performed to detect the effects of PKCZI195.17 on breast cancer cells migration and invasion. Adhesion, actin polymerization, and Western blotting were performed to detect the effects of PKCZI195.17 on cells adhesion and actin polymerization, and explore the downsteam signaling mechanisms involved in PKC ζ inhibition. MDA-MB-231 xenograft was used to measure the in vivo anti-metastasis efficacy of PKCZI195.17. The compound PKCZI195.17 selectively inhibited PKC ζ kinase activity since it failed to inhibit PKC α, PKC β, PKC δ, PKC η, AKT2, as well as FGFR2 activity. PKCZI195.17 significantly impaired spontaneous migration, chemotaxis, and invasion of human breast cancer MDA-MB-231, MDA-MB-435, and MCF-7 cells, while PKCZI195.17 did not obviously inhibited cells viability. PKCZI195.17 also inhibited cells adhesion and actin polymerization through attenuating the phosphorylations of integrin β1, LIMK, and cofilin, which might be the downstream effectors of PKC ζ-mediated chemotaxis in MDA-MB-231 cells. Furthermore, PKCZI195.17 suppressed the breast cancer metastasis and increased the survival time of breast tumor-bearing mice. In summary, PKCZI195.17 was a PKC ζ-specific inhibitor which dampened cancer cell migration and metastasis and may serve as a novel

  18. Comparative evaluation of inhibitory activity of Epiphgram from ...

    African Journals Online (AJOL)

    Result showed that epiphgram from both albino and normal skinned snails had higher microbial activity for both Eschericia coli and Salmonella species as shown by minimum inhibitory concentration (MIC: 0.050 and 0.098 vs 0.098 and 0.049) compared to streptomycin (MIC: 78 and 1.95 vs 15.63 and 1.95) which is the ...

  19. Department of Defense Atlas/Data Abstract for the United States and Selected Areas. Fiscal Year 1992

    Science.gov (United States)

    1993-01-01

    3,601 2. EMPRESA DE VIACAO TERCEIRENSE 1,689 Passenger Motor Charter Service 1,689 3. OFFICIANAS GERGIS DE MATERIAL 1,410 Gas Turbines and Jet Engines...5. CELIKCILIX SAN VE TIC AS 10,195 Boxes, Cartons and Crates 10,195 Total of Above $186,036 ( 86.5% of total awards over $25,000) Prepared ty

  20. Influence of conductive electroactive polymer polyaniline on ...

    Indian Academy of Sciences (India)

    Conductive electroactive polymer polyaniline is utilized to substitute conductive additive acetylene black in the LiMn1.95Al0.05O4 cathode for lithium ion batteries. Results show that LiMn1.95Al0.05O4 possesses stable structure and good performance. Percolation theory is used to optimize the content of conductive additive ...

  1. Hormonal Resistance And Metastasis ER-Coregulartor-Src Signaling Targeted Therapy

    Science.gov (United States)

    2011-09-01

    receptor family. Curr Opin Obstet Gynecol 1999 Jun;11(3):249-54. [16] Curtis HS, Couse JF, Korach KS. Estrogen receptor transcription and...breast cancer. Curr Top Med Chem 2006;6:195-216. (2) Lewis-Wambi JS, Jordan VC. Treatment of Postmenopausal Breast Cancer with Selective Estrogen...Estrogen receptors as therapeutic targets in breast cancer. Curr Top Med Chem 6:195–216 2. Lewis-Wambi JS, Jordan VC (2005) Treatment of postmeno- pausal

  2. Browse Author Index

    African Journals Online (AJOL)

    Musa, TL · Mustapha, AF · Mustapha, AF · Mustapha, K · Mustapha, SK · Mustapha, SK · Mustapha, Z · Mutihir, J.T · Mutihir, JT · Mutihir, JT · Mutlu, LC · Mutluay, MM · Mwandri, MB · Mwita, JC 151 - 195 of 195 Items << < 1 2 3 4. ISSN: 1119-3077. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for ...

  3. The Airship’s Potential for Intertheater and Intratheater Airlift

    Science.gov (United States)

    1992-05-01

    went to France (who dismantled her in 1926). 15. See Deeson, 78 and Henry Beaubois , Airships: Yesterday, Today, and Tomorrow, (New York, NY: Two...Continents Publishing Group, 1976), 185. 16. See Deeson, 87; 126 and Beaubois , 195. NOTE: The actual cause of the Hindenburg’s fiery crash has been...A: "The 161 Rigid Airships Builtand Flown, 1897-1940: LZs 127 & 129), 339-340 43. Deeson, 20. 44. Beaubois , 185. 45. I bid, 195. 46. White

  4. Collaborative University Research on Corrosion OSD Education Initiative

    Science.gov (United States)

    2012-11-30

    Protection Mechanisms of Zinc-Rich Primers, Abstr Pap Am Chem S, 195 (1988), 58- Pmse . 17. D. Pereira, J. D. Scantlebury, M. G. S. Ferreira and M...About the Protection Mechanisms of Zinc-Rich Primers, Abstr Pap Am Chem S, 195 (1988), 58- Pmse . 23. D. Pereira, J. D. Scantlebury, M. G. S. Ferreira...Transition Point in Coatings Properties, Abstr Pap Am Chem S, 200 (1990), 41- Pmse . 43. G. P. Bierwagen, Critical Pigment Volume Concentration (Cpvc) as

  5. Prime Contract Awards by Service Category and Federal Supply Classification: Fiscal Year 1991, 1990, 1989 and 1988

    Science.gov (United States)

    1992-01-01

    Products 195,482 148,600 126,817 135,905 8925 Sugar, Confectionery and Nuts 79,179 56,626 64,232 48,107 8930 Jams, Jellies and Preserves 12,774 12,773...Fruits and Vegetables 193.712 0 2.577 500 190.635 0 0 8920 Bakery and Cereal Products 195.482 4.822 8.326 32 851 149,483 0 0 8925 Sugar. Confectionery

  6. Fuel Cells Using the Protic Ionic Liquid and Rotator Phase Solid Electrolyte Principles

    Science.gov (United States)

    2008-02-13

    Talk “High temperature Polymer Electrolyte Membrane Fuel Cells ( HT -PEMFCs) for Portable Power in Large-Scale Energy Storage Devices”, Paper Number 195...Protic ionic liquids and the PEM fuel cell , 2nd International Congress on Ionic Liquids, poster session, #3P07-081, Yokohama, Japan, August 5-10...Membrane Fuel Cells ( HT -PEMFCs) for Portable Power in Large-Scale Energy Storage Devices”, Paper Number 195, 212th Meeting of the Electrochemical

  7. New data on cross-sections of deuteron induced nuclear reactions on gold up to 50 MeV and comparison of production routes of medically relevant Au and Hg radioisotopes

    Energy Technology Data Exchange (ETDEWEB)

    Tárkányi, F. [Institute for Nuclear Research, Hungarian Academy of Sciences (ATOMKI), Debrecen (Hungary); Hermanne, A. [Cyclotron Laboratory, Vrije Universiteit Brussel (VUB), Brussels (Belgium); Ditrói, F., E-mail: ditroi@atomki.hu [Institute for Nuclear Research, Hungarian Academy of Sciences (ATOMKI), Debrecen (Hungary); Takács, S. [Institute for Nuclear Research, Hungarian Academy of Sciences (ATOMKI), Debrecen (Hungary); Adam Rebeles, R. [Cyclotron Laboratory, Vrije Universiteit Brussel (VUB), Brussels (Belgium); Ignatyuk, A.V. [Institute of Physics and Power Engineering (IPPE), Obninsk (Russian Federation)

    2015-11-01

    Highlights: • Deuteron induced nuclear reactions on natural gold up to 50 MeV. • Stacked foil irradiation technique. • Comparison of results with the ALICE, EMPIRE and TENDL-2014 calculations. • Medical radioisotope production. - Abstract: Investigations of cross-sections of deuteron induced nuclear reactions on gold were extended up to 50 MeV by using the standard stacked foil irradiation technique and high resolution gamma-ray spectrometry. New cross-sections are reported for the {sup 197}Au(d,xn){sup 197m,197g,195m,195g,193m,193g}Hg and {sup 197}Au(d,x){sup 198m,198g,196m,196g,195,194}Au nuclear reactions. The application for production of the medically relevant isotopes {sup 198}Au and {sup 195m,195g,197m,197g}Hg is discussed, including the comparison with other charged particle induced production routes. The possible use of the {sup 197}Au(d,x){sup 197m,197g,195m,193m}Hg and {sup 196m,196g}Au reactions for monitoring deuteron beam parameters is also investigated.

  8. Medial patellofemoral ligament injury patterns and associated pathology in lateral patella dislocation: an MRI study

    Directory of Open Access Journals (Sweden)

    Guerrero Patrick

    2009-07-01

    Full Text Available Abstract Background Lateral Patella dislocations are common injuries seen in the active and young adult populations. Our study focus was to evaluate medial patellofemoral ligament (MPFL injury patterns and associated knee pathology using Magnetic Resonance Imaging studies. Methods MRI studies taken at one imaging site between January, 2007 to January, 2008 with the final diagnosis of patella dislocation were screened for this study. Of the 324 cases that were found, 195 patients with lateral patellar dislocation traumatic enough to cause bone bruises on the lateral femoral trochlea and the medial facet of the patella were selected for this study. The MRI images were reviewed by three independent observers for location and type of MPFL injury, osteochondral defects, loose bodies, MCL and meniscus tears. The data was analyzed as a single cohort and by gender. Results This study consisted of 127 males and 68 females; mean age of 23 yrs. Tear of the MPFL at the patellar attachment occurred in 93/195 knees (47%, at the femoral attachment in 50/195 knees (26%, and at both the femoral and patella attachment sites in 26/195 knees (13%. Attenuation of the MPFL without rupture occurred in 26/195 knees (13%. Associated findings included loose bodies in 23/195 (13%, meniscus tears 41/195 (21%, patella avulsion/fracture in 14/195 (7%, medial collateral ligament sprains/tears in 37/195 (19% and osteochondral lesions in 96/195 knees (49%. Statistical analysis showed females had significantly more associated meniscus tears than the males (27% vs. 17%, p = 0.04. Although not statistically significant, osteochondral lesions were seen more in male patients with acute patella dislocation (52% vs. 42%, p = 0.08. Conclusion Patients who present with lateral patella dislocation with the classic bone bruise pattern seen on MRI will likely rupture the MPFL at the patellar side. Females are more likely to have an associated meniscal tear than males; however, more males

  9. Spectrum and features of congenital heart disease in Xi'an, China as detected using fetal echocardiography.

    Science.gov (United States)

    Wei, Y J; Liu, B M; Zhou, Y H; Jia, X H; Mu, S G; Gao, X R; Yang, M L; Zhang, Y

    2014-11-11

    This study aimed to investigate the spectrum and features of congenital heart disease (CHD) in Xi'an, China using fetal echocardiography. All pregnant women referred for fetal echocardiography underwent a systematic fetal echocardiographic examination. Each case of complex defects was diagnosed according to the predominant pathophysiology, and the overall frequency of each defect was recorded and classified according to its location in the fetal heart. CHD was diagnosed in 195 fetuses. The top 5 types of CHD were, in order, single ventricle (15.9%, 31/195), atrioventricular septal defect (12.3%, 24/195), ventricular septal defect (VSD) (11.8%, 23/195), tetralogy of Fallot (10.8%, 21/195), and double-outlet right ventricle (8.2%, 16/195). The 195 cases of CHD comprised 316 defects in total. The most common defect was ventricular malformation (40.5%, 128/316), followed by great artery anomalies (38.0%, 120/316), endocardial cushion abnormalities (11.7%, 37/316), atrial abnormalities (6.6%, 21/316), and semilunar valve abnormalities (3.2%, 10/316). VSD accounted for the largest proportion (24.4%, 77/316) of the ventricular malformations. The total proportion of obstructive lesions in this group was much higher for the right than for the left side of the heart (18.4% (58/316) vs 9.5% (30/316), respectively). The spectrum of fetal CHD detected by echocardiography was much different compared to that accepted in the past. Complex defects were more common prenatally. Ventricular malformations were the largest constituent of all of the defects associated with fetal CHD, and VSD was the most common component of complex defects. Chinese fetal CHD encompassed more right-sided than left-sided obstructive lesions.

  10. Benign proliferative breast diseases among female patients at a sub-Saharan Africa tertiary hospital: a cross sectional study.

    Science.gov (United States)

    Okoth, Christopher; Galukande, Moses; Jombwe, Josephat; Wamala, Dan

    2013-04-01

    Non-cancerous diseases of the breast have assumed increasing importance because of the public awareness of breast cancer. These benign diseases are a recognized important risk factor for later breast cancer which can develop in either breast. The risk estimate of these benign breast diseases has not been well established in sub Saharan Africa. Women with benign proliferative or atypical breast lesions have a two- fold risk of developing breast cancer in western populations. The purpose of this study therefore was to determine the prevalence of proliferative disease ( BPBD) with and without atypia among Ugandan Black women. A cross-sectional descriptive study conducted at Mulago Hospital Breast Clinic between January 2012 and June 2012; 208 women aged 12 years and above with palpable breast lumps were screened. Fine needle aspiration biopsies were taken for cytological examination. Of the 208 women with benign breast lumps screened, 195 were recruited in the study. The prevalence of BPBD was 18% (35/195). BPBD with atypia was 5.6% (11/195). The mean age and body mass index (BMI) were 28.4 years and 23.26 kg/m2 respectively. The commonest lesions were fibroadenomas for 57%, (111/195), and fibrocystic change were 21% (40/195). Most BPBD with atypia lesions were in the fibrocystic category. Benign proliferative breast diseases are common, found mostly among premenopausal women. A significant proportion of BPBD had atypical proliferation. An accurate breast cancer risk estimate study for BPBD is recommended.

  11. Quantitative Single-Particle Digital Autoradiography with α-Particle Emitters for Targeted Radionuclide Therapy using the iQID Camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W.; Frost, Sophia; Frayo, Shani; Kenoyer, Aimee L.; Santos, E. B.; Jones, Jon C.; Green, Damian J.; Hamlin, Donald K.; Wilbur, D. Scott; Fisher, Darrell R.; Orozco, Johnnie J.; Press, Oliver W.; Pagel, John M.; Sandmaier, B. M.

    2015-07-01

    Abstract Alpha emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm) causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with alpha emitters may inactivate targeted cells with minimal radiation damage to surrounding tissues. For accurate dosimetry in alpha-RIT, tools are needed to visualize and quantify the radioactivity distribution and absorbed dose to targeted and non-targeted cells, especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, iQID (ionizing-radiation Quantum Imaging Detector), for use in alpha-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection technology that images and identifies charged-particle and gamma-ray/X-ray emissions spatially and temporally on an event-by-event basis. It employs recent advances in CCD/CMOS cameras and computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, we evaluated this system’s characteristics for alpha particle imaging including measurements of spatial resolution and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 (211At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ~20 μm full width at half maximum (FWHM) and the alpha particle background was measured at a rate of (2.6 ± 0.5) × 10–4 cpm/cm2 (40 mm diameter detector area). Simultaneous imaging of multiple tissue sections was performed using a large-area iQID configuration (ø 11.5 cm

  12. Quantitative single-particle digital autoradiography with α-particle emitters for targeted radionuclide therapy using the iQID camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W., E-mail: brian.miller@pnnl.gov [Pacific Northwest National Laboratory, Richland, Washington 99354 and College of Optical Sciences, The University of Arizona, Tucson, Arizona 85719 (United States); Frost, Sofia H. L.; Frayo, Shani L.; Kenoyer, Aimee L.; Santos, Erlinda; Jones, Jon C.; Orozco, Johnnie J. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 (United States); Green, Damian J.; Press, Oliver W.; Pagel, John M.; Sandmaier, Brenda M. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 and Department of Medicine, University of Washington, Seattle, Washington 98195 (United States); Hamlin, Donald K.; Wilbur, D. Scott [Department of Radiation Oncology, University of Washington, Seattle, Washington 98195 (United States); Fisher, Darrell R. [Dade Moeller Health Group, Richland, Washington 99354 (United States)

    2015-07-15

    Purpose: Alpha-emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm), causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with α emitters may thus inactivate targeted cells with minimal radiation damage to surrounding tissues. Tools are needed to visualize and quantify the radioactivity distribution and absorbed doses to targeted and nontargeted cells for accurate dosimetry of all treatment regimens utilizing α particles, including RIT and others (e.g., Ra-223), especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, the ionizing-radiation quantum imaging detector (iQID) camera, for use in α-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection system that images and identifies charged-particle and gamma-ray/x-ray emissions spatially and temporally on an event-by-event basis. It employs CCD-CMOS cameras and high-performance computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, the authors evaluated its characteristics for α-particle imaging, including measurements of intrinsic detector spatial resolutions and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 ({sup 211}At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ∼20 μm full width at half maximum and the α-particle background was measured at a rate as low as (2.6 ± 0.5) × 10{sup −4} cpm/cm{sup 2} (40 mm diameter detector area

  13. α-Imaging Confirmed Efficient Targeting of CD₄₅-Positive Cells After ²¹¹At-Radioimmunotherapy for Hematopoietic Cell Transplantation

    Energy Technology Data Exchange (ETDEWEB)

    Frost, Sophia; Miller, Brian W.; Back, Tom; Santos, E. B.; Hamlin, Donald K.; Knoblaugh, E.; Frayo, Shani; Kenoyer, Aimee L.; Storb, Rainer; Press, O. W.; Wilbur, D. Scott; Pagel, John M.; Sandmaier, B. M.

    2015-09-03

    Alpha-radioimmunotherapy (α-RIT) targeting CD45 may substitute for total body irradiation in hematopoietic cell transplantation (HCT) preparative regimens for lymphoma. Our goal was to optimize the anti-CD45 monoclonal antibody (MAb; CA12.10C12) protein dose for astatine-²¹¹(²¹¹At)-RIT, extending the analysis to include intra-organ ²¹¹At activity distribution and α-imaging-based small-scale dosimetry, along with imunohistochemical staining. Methods: Eight normal dogs were injected with either 0.75 (n=5) or 1.00 mg/kg (n=3) of ²¹¹At-B10-CA12.10C12 (11.5–27.6 MBq/kg). Two were euthanized and necropsied 19–22 hours postinjection (p.i.), and six received autologous HCT three days after ²¹¹At-RIT, following lymph node and bone marrow biopsies at 2–4 and/or 19 hours p.i. Blood was sampled to study toxicity and clearance; CD45 targeting was evaluated by flow cytometry. ²¹¹At localization and small scale dosimetry were assessed using two α-imaging : α-camera and iQID. Results: Uptake of ²¹¹At was highest in spleen (0.31–0.61 %IA/g), lymph nodes (0.02–0.16 %IA/g), liver (0.11–0.12 %IA/g), and marrow (0.06–0.08 %IA/g). Lymphocytes in blood and marrow were efficiently targeted using either MAb dose. Lymph nodes remained unsaturated, but displayed targeted ²¹¹At localization in T lymphocyte-rich areas. Absorbed doses to blood, marrow, and lymph nodes were estimated at 3.9, 3.0, and 4.2 Gy/210 MBq, respectively. All transplanted dogs experienced transient hepatic toxicity. Liver enzyme levels were temporarily elevated in 5 of 6 dogs; 1 treated with 1.00 mg MAb/kg developed ascites and was euthanized 136 days after HCT. Conclusion: ²¹¹At-anti-CD45 RIT with 0.75 mg MAb/kg efficiently targeted blood and marrow without severe toxicity. Dosimetry calculations and observed radiation-induced effects indicated that sufficient ²¹¹At-B10-CA12.10C12 localization was achieved for efficient conditioning for HCT.

  14. The role of alpha therapy for local and systemic treatment of cancer

    Energy Technology Data Exchange (ETDEWEB)

    Allen, B.J. [St George Hospital, Kogarah, NSW (Australia)

    1998-03-01

    Major problems in the management of cancer relate to the inability to control some primary lesions, e.g. glioblastoma multiforme (GBM), and the inability to deal with metastatic cancer arising from malignant cancers such as melanoma, breast and other cancers. Binary alpha therapy using neutron capture in boron-10 offers the potential for improved prognosis for high grade brain tumours such as GBM and melanoma metastases to the brain. Metastatic cancer proceeds through a number of quite separate stages in the development of lethal disease, i e. cells in transit, preangiogenic lesions, subclinical and clinical lesions. Early stages offer the potential for control if targeted alpha therapy is applied. However, the dose must be localised to the cancer cell and this requirement rules out beta-emitting radionuclides, which are more suited for clinical lesions. Alpha-emitting radionuclides are the most appropriate toxins, as their efficacy depends on the linear energy transfer (LET) and range of the alpha particles. After matching the cancer stage, radiolabel and carrier, we find that {sup 149}Tb is the radionuclide of choice for systemic therapy in all aspects except production. The production of {sup 149}Tb in {mu}Ci (kBq) quantities has been achieved using the heavy ion reaction at the ANU tandem accelerator at Canberra and in multi-mCi (MBq) quantities using the spallation reaction in combination with on-line isotope separation technology of ISOLDE at CERN. Terbium is ideally suited for chelation to monoclonal antibodies to produce stable radio-immunoconjugates (RIC). Astatine-211 is a halide and has potential for the elimination of early stage melanoma metastases as At-MTB. However, the availability of the alpha generators {sup 228}Th-{sup 212}Bi and {sup 225}Ac-{sup 213}Bi facilitates the use of Bi-RIC in clinical trials for acute myeloid leukaemia and cystic glioma. Alpha therapy has the potential to control refractory cancers when treated at the minimum residual

  15. Systematics of Alpha-Radioactivity

    Energy Technology Data Exchange (ETDEWEB)

    Perlman, I.; Ghiorso, A.; Seaborg, G.T.

    1949-09-12

    Correlations of alpha-decay energies in terms of mass number and atomic number have been made for all of the alpha-emitting species now numbering over 100. For each element isotopes show increase in alpha-energy with decrease in mass number except in the region of 126 neutrons where there is an explainable reversal. This reversal has the effect of creating a region of relatively low alpha-energy and long half-life at low mass numbers for such elements as astatine, emanation, francium, and possibly higher elements as had been noted already for bismuth and polonium. Methods and examples of using alpha-decay data to define the energy surface in the heavy element region are discussed. The regularities in alpha-decay are used for predictions of nuclear properties including prediction of the beta-stable nuclides among the heavy elements. The half-life vs. energy correlations show that the even-even nuclides conform well with existing alpha-decay theory, but all nuclear types with odd nucleons show prohibited decay. The reason for this prohibition is not found in spin changes in the alpha-emission but in the assembly of the components of the alpha particle, and this theory is discussed further in terms of observations made on nuclides having two or more alpha-groups. Using most of the even-even nuclei to define 'normal nuclear radius' calculations are now able to show the shrinkage in the regions of lead and of 126 neutrons to amount to about 10%. The much greater change in 'effective radius' for bismuth isotopes can be dissociated into the effects of odd nucleons superimposed on the actual decrease in nuclear radius. The simple expression r = 1.48 A{sup 1/3} {center_dot} 10{sup -13} cm seems to fit the data for the even-even nuclei outside of the region of 126 neutrons better than more complex functions.

  16. AcEST: BP915515 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000072_E07 195 Adiantum capillus-veneris mRNA. clone: YMU001_000072_E07. BP915515... CL3248Contig1 Show BP915515 Clone id YMU001_000072_E07 Library YMU01 Length 195 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000072_E07. Accession BP915515 Tissue type prothallium Developmental stag...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915...515|Adiantum capillus-veneris mRNA, clone: YMU001_000072_E07. (195 letters) Database

  17. NCBI nr-aa BLAST: CBRC-TTRU-01-0183 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0183 sp|P61755|CCR5_LOPAT RecName: Full=C-C chemokine receptor type 5; Short=C-C CKR-5; Short...=CC-CKR-5; Short=CCR-5; Short=CCR5; AltName: CD_antigen=CD195 sp|P68269|CCR5_PAPAN Re...cName: Full=C-C chemokine receptor type 5; Short=C-C CKR-5; Short=CC-CKR-5; Short=CCR-5; Short=CCR5; AltName...: CD_antigen=CD195 sp|P68270|CCR5_PAPHA RecName: Full=C-C chemokine receptor type 5; Short=C-C CKR-5; Shor...t=CC-CKR-5; Short=CCR-5; Short=CCR5; AltName: CD_antigen=CD195 sp|Q71UI8|CCR5_CERAR

  18. NCBI nr-aa BLAST: CBRC-PCAP-01-0571 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-0571 sp|P61755|CCR5_LOPAT RecName: Full=C-C chemokine receptor type 5; Short=C-C CKR-5; Short...=CC-CKR-5; Short=CCR-5; Short=CCR5; AltName: CD_antigen=CD195 sp|P68269|CCR5_PAPAN Re...cName: Full=C-C chemokine receptor type 5; Short=C-C CKR-5; Short=CC-CKR-5; Short=CCR-5; Short=CCR5; AltName...: CD_antigen=CD195 sp|P68270|CCR5_PAPHA RecName: Full=C-C chemokine receptor type 5; Short=C-C CKR-5; Shor...t=CC-CKR-5; Short=CCR-5; Short=CCR5; AltName: CD_antigen=CD195 sp|Q71UI8|CCR5_CERAR

  19. NCBI nr-aa BLAST: CBRC-PHAM-01-0934 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-0934 sp|P61755|CCR5_LOPAT RecName: Full=C-C chemokine receptor type 5; Short=C-C CKR-5; Short...=CC-CKR-5; Short=CCR-5; Short=CCR5; AltName: CD_antigen=CD195 sp|P68269|CCR5_PAPAN Re...cName: Full=C-C chemokine receptor type 5; Short=C-C CKR-5; Short=CC-CKR-5; Short=CCR-5; Short=CCR5; AltName...: CD_antigen=CD195 sp|P68270|CCR5_PAPHA RecName: Full=C-C chemokine receptor type 5; Short=C-C CKR-5; Shor...t=CC-CKR-5; Short=CCR-5; Short=CCR5; AltName: CD_antigen=CD195 sp|Q71UI8|CCR5_CERAR

  20. Exogenous proline relieves growth inhibition caused by NaCl in petunia cells: Metabolism of L-( sup 15 M)-proline followed by sup 15 N NMR

    Energy Technology Data Exchange (ETDEWEB)

    Heyser, J.W.; Chacon, M.J. (Los Alamos National Lab., NM (USA))

    1989-04-01

    Exogenous proline stimulated the growth of Petunia hybrida cells on 195 mM NaCl 10-fold as compared with cells grown on 195 mM CaCl medium minus proline. L-({sup 15}N)-proline was fed to cells growing on 0 and 195 mM CaCl, and its metabolism was followed by {sup 15}N NMR analysis of cell extracts. Total proline and amino acids were determined by ninhydrin assay. Proline and primary amino acids were easily resolved in NMR spectra and the amount of {sup 15}N-label which remained in proline was determined. Reduced catabolism of proline in cells grown on NaCl was evident. The role of exogenous proline in conferring increased NaCl tolerance in this nonhalophyte will be discussed.

  1. Nuclear medicine technology progress report for quarter ending March 31, 1978

    Energy Technology Data Exchange (ETDEWEB)

    Knapp, F.F. Jr.

    1978-07-01

    Progress is reported for the applications of /sup 11/C, /sup 195m/Pt, and /sup 75/Se. Further human clinical trials with /sup 11/C-1-aminocyclobutane carboxylic acid and /sup 11/C-DL-tryptophan are reported, and batch production of the /sup 11/C-DL-tryptophan has increased twofold to 300 mCi. Detailed studies of the effect of the method of administration of /sup 195m/Pt-labeled cis-dichlorodiammine platinum (II) on the tissue distribution and retention of /sup 195m/Pt are reported. Selenium-75-labeled ..beta..-aminoethyl selenosulfate has been prepared as a potential myocardial imaging agent. The ORIS-11 version 01 has been tested successfully on a clinical Gamma-11 nuclear medical imaging system at Vanderbilt University.

  2. Activation cross-sections of deuteron induced nuclear reactions on gold up to 40 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Tarkanyi, F. [Institute of Nuclear Research of the Hungarian Academy of Sciences (ATOMKI), Debrecen (Hungary); Ditroi, F., E-mail: ditroi@atomki.hu [Institute of Nuclear Research of the Hungarian Academy of Sciences (ATOMKI), Debrecen (Hungary); Hermanne, A. [Cyclotron Laboratory, Vrije Universiteit Brussel (VUB), Brussels (Belgium); Takacs, S.; Kiraly, B. [Institute of Nuclear Research of the Hungarian Academy of Sciences (ATOMKI), Debrecen (Hungary); Yamazaki, H.; Baba, M.; Mohammadi, A. [Cyclotron and Radioisotope Center (CYRIC), Tohoku University, Sendai (Japan); Ignatyuk, A.V. [Institute of Physics and Power Engineering (IPPE), Obninsk (Russian Federation)

    2011-06-15

    Cross-sections of deuteron induced nuclear reactions on gold were measured up to 40 MeV by using the standard stacked foil irradiation technique and high resolution gamma-ray spectroscopy. Experimental cross-sections and derived integral yields are reported for the {sup 197}Au(d,xn){sup 197m,197g,195m,195g}Hg and {sup 197}Au(d,x){sup 198g,196m,196g,195,194}Au nuclear reactions. The experimental data are analyzed and compared to literature and predictions of the ALICE-IPPE, EMPIRE and TALYS theoretical model codes. The application of the new cross-sections for accelerator technology, medical radioisotope production, thin layer activation and dose calculation is discussed.

  3. Why Ser and not Thr brokers catalysis in the trypsin fold.

    Science.gov (United States)

    Pelc, Leslie A; Chen, Zhiwei; Gohara, David W; Vogt, Austin D; Pozzi, Nicola; Di Cera, Enrico

    2015-02-24

    Although Thr is equally represented as Ser in the human genome and as a nucleophile is as good as Ser, it is never found in the active site of the large family of trypsin-like proteases that utilize the Asp/His/Ser triad. The molecular basis of the preference of Ser over Thr in the trypsin fold was investigated with X-ray structures of the thrombin mutant S195T free and bound to an irreversible active site inhibitor. In the free form, the methyl group of T195 is oriented toward the incoming substrate in a conformation seemingly incompatible with productive binding. In the bound form, the side chain of T195 is reoriented for efficient substrate acylation without causing steric clash within the active site. Rapid kinetics prove that this change is due to selection of an active conformation from a preexisting ensemble of reactive and unreactive rotamers whose relative distribution determines the level of activity of the protease. Consistent with these observations, the S195T substitution is associated with a weak yet finite activity that allows identification of an unanticipated important role for S195 as the end point of allosteric transduction in the trypsin fold. The S195T mutation abrogates the Na(+)-dependent enhancement of catalytic activity in thrombin, activated protein C, and factor Xa and significantly weakens the physiologically important allosteric effects of thrombomodulin on thrombin and of cofactor Va on factor Xa. The evolutionary selection of Ser over Thr in trypsin-like proteases was therefore driven by the need for high catalytic activity and efficient allosteric regulation.

  4. From the UV to the static-field limit: Rates and scaling laws for intense-field ionization of helium

    Energy Technology Data Exchange (ETDEWEB)

    Armstrong, G S J; Parker, J S; Taylor, K T [Department of Applied Mathematics and Theoretical Physics, Queen' s University Belfast, Belfast BT7 1NN (United Kingdom); Boca, M, E-mail: gregory.armstrong@qub.ac.u [Faculty of Physics, University of Bucharest, 70709 Bucharest (Romania)

    2009-11-01

    We present high-accuracy calculations of ionization rates of helium at UV (195 nm) wavelengths. The numerical results are obtained from full-dimensional numerical integration of the two-electron time-dependent Schroedinger equation. Comparison is made between ionization rates at 195 nm with previously obtained data at 390 nm and 780 nm. In addition, we have obtained quantitatively accurate solutions of the full-dimensional time-dependent Schroedinger equation for static-field ionization of helium. We compare our numerically integrated rates with those of time-independent calculations, and obtain good agreement over a wide range of intensities.

  5. NOx Conversion of Porous LSF15-CGO10 Cell Stacks

    DEFF Research Database (Denmark)

    Friedberg, Anja Zarah; Kammer Hansen, Kent

    2015-01-01

    A porous electrochemical reactor, made of La0.85Sr0.15FeO3 as electrode and Ce0.9Gd0.1O1.95 as electrolyte, was studied for the electrochemical reduction of NO with Propene. In order to enhance the effect of polarization, the reactor was impregnated with Ce0.9Gd0.1O1.95, CeO2 or Ce0.8Pr0.2O2-d...

  6. Dicty_cDB: AFK493 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available elim): 0 length of query: 195 length of database: 80,480,566 effective HSP length: 17 effective... length of query: 178 effective length of database: 78,821,179 effective search space: 14030169862 effective... Number of sequences better than 10.0: 0 length of query: 195 length of database: Z,213,015,108 effective HSP length: 22 effective... length of query: 173 effective length of database: Y,388,266,194 effective... search space: 7160170051562 effective search space used: 7160170051562 T: 0 A: 0 X1: 6 (11.

  7. Pretreatment on Corn Stover with Low Concentration of Formic Acid

    DEFF Research Database (Denmark)

    Xu, Jian; Thomsen, Mette Hedegaard; Thomsen, Anne Belinda

    2009-01-01

    the cellulose easily degraded into sugars and further fermented to ethanol. In this work, hydrothermal pretreatment on corn stover at 195 degrees for 15 min with and without lower concentration of formic acid was compared in terms of sugar recoveries and ethanol fermentation. For pretreatment with formic acid...... pretreatment without formic acid. Toxicity tests of liquor parts showed that there were no inhibitions found for both pretreatment conditions. After simultaneous saccharification and fermentation (SSF) of the pretreated corn stover with Baker's yeast, the highest ethanol yield of 76.5% of the theoretical...... was observed from corn stover pretreated at 195 degrees for 15min with formic acid....

  8. Book Review Society and the object. Views from the identity, design and information / Reseña La sociedad y el objeto. Miradas desde la identidad, diseño e información

    Directory of Open Access Journals (Sweden)

    Jesús Manuel Fitch Osuna

    2014-03-01

    Full Text Available Book Review: Mercedes Mercado; Álvaro Ríos; Liliana Sosa; and Gerardo Vázquez (2012 Identity, design, information. Publisher: University of Nuevo León, Monterrey (Mexico. Pages: 195. ISBN: 978-607-27-0016-1. Reseña del libro: Mercedes Mercado; Álvaro Ríos; Liliana Sosa; y Gerardo Vázquez (2012: Identidad, diseño, información. Editorial: Universidad Autónoma de Nuevo León, Monterrey (México. Páginas: 195. ISBN: 978-607-27-0016-1.

  9. Nuclear medicine technology progress report for quarter ending June 30, 1977

    Energy Technology Data Exchange (ETDEWEB)

    Poggenburg, J. K

    1977-09-01

    Formation of the Nuclear Medicine Technology Group within the new Health and Safety Research Division is announced. Progress is reported for the applications of /sup 11/C, /sup 195m/Pt, /sup 33/P, and /sup 123m/Te. Of note in this report is the progress in the microscale synthesis of cis dichlorodiammine-/sup 195m/Pt(II), a direct exchange method for labeling POCL/sub 3/ with /sup 33/P, and the successful synthesis of a /sup 123m/Te-labeled amino acid, DL-..cap alpha..-amino-..gamma..(phenyl telluro ethyl) butyric acid.

  10. NOx Conversion of Porous LSF15-CGO10 Cell Stacks

    DEFF Research Database (Denmark)

    Friedberg, Anja Zarah; Kammer Hansen, Kent

    2015-01-01

    A porous electrochemical reactor, made of La0.85Sr0.15FeO3 as electrode and Ce0.9Gd0.1O1.95 as electrolyte, was studied for the electrochemical reduction of NO with Propene. In order to enhance the effect of polarization, the reactor was impregnated with Ce0.9Gd0.1O1.95, CeO2 or Ce0.8Pr0.2O2-d na...

  11. Multiple Versus Single Scattering of Terrestrial Infrared Longwave Radiation in an Aerosol-Laden Planetary Boundary Layer

    Science.gov (United States)

    1989-01-01

    Schwarzschild , K., 1906: On the Equilibrium of the Sun’s Atmo- sphere. Nachr. Gesell. Wiss. Gottingen, Math.-Phys. KI., 195, 41-53. Shettle, E.P., and J.A...Ap. J. Optics, 21, 1-22. Schwarzschild , K., 1906: On the Equilibrium of the Sun’s Atmo- sphere. Nachr. Gesell. Wiss. Gottingen, Math.-Phys. Ki., 195...52 Figure 5.1 An aerosol particle model which shows an increase in radius (r) and change in the fraction of water soluble and water insoluble

  12. Role of cysteine amino acid residues on the RNA binding activity of human thymidylate synthase

    OpenAIRE

    Lin, Xiukun; Liu, Jun; Maley, Frank; Chu, Edward

    2003-01-01

    The role of cysteine sulfhydryl residues on the RNA binding activity of human thymidylate synthase (TS) was investigated by mutating each cysteine residue on human TS to a corresponding alanine residue. Enzymatic activities of TS:C43A and TS:C210A mutant proteins were nearly identical to wild-type TS, while TS:C180A and TS:C199A mutants expressed >80% of wild-type enzyme activity. In contrast, TS:C195A was completely inactive. Mutant proteins, TS:C195A, TS:C199A and TS:C210A, retained RNA bin...

  13. Interaction among two subpopulations of Ehrlich ascites tumor in vivo: evidence of a contact mediated immune response

    DEFF Research Database (Denmark)

    Aabo, K; Vindeløv, L L; Skovsgaard, T

    1987-01-01

    .15) on a fast growing subpopulation (E1.95) was demonstrated only when the cells had contact during solid tumor growth. The effect was dependent on the relative proportion of the suppressing cell line. An identical effect was exerted by radiation killed inhibitor cells. The inhibition was only transient....... If the tumor cell lines were grown intraperitoneally as ascites tumors without cellular contact, no interaction was found using flow cytometric DNA analysis to determine alterations in the relative proportions of the cell lines. Ascites from the inhibitor cell line E1.15 had no inhibitory effect on E1.95. Pre...

  14. Physical Activity

    DEFF Research Database (Denmark)

    Andersen, Lars Bo; Anderssen, Sigmund Alfred; Wisløff, Ulrik

    2014-01-01

    Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers.......Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers....

  15. Influence of exercise contraction mode and protein supplementation on human skeletal muscle satellite cell content and muscle fiber growth

    DEFF Research Database (Denmark)

    Farup, Jean; Rahbek, Stine Klejs; Riis, Simon

    2014-01-01

    Skeletal muscle satellite cells (SCs) are involved in remodeling and hypertrophy processes of skeletal muscle. However, little knowledge exists on extrinsic factors that influence the content of SCs in skeletal muscle. In a comparative human study, we investigated the muscle fiber type...... CSA increased exclusively with Whey-Conc (P hypertrophy correlated with whole muscle hypertrophy exclusively following Conc training (P ...-specific association between emergence of satellite cells (SCs), muscle growth, and remodeling in response to 12 wk unilateral resistance training performed as eccentric (Ecc) or concentric (Conc) resistance training ± whey protein (Whey, 19.5 g protein + 19.5 g glucose) or placebo (Placebo, 39 g glucose...

  16. EST Table: CK533832 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK533832 rswgb0_001886.y1 10/09/29 44 %/195 aa ref|XP_974065.1| PREDICTED: similar to Outer dense fiber... protein 2 (Outer dense fiber of sperm tails protein 2) (84 kDa outer dense fiber protei.../168 aa gnl|Amel|GB14311-PA 10/09/10 44 %/195 aa gi|91078946|ref|XP_974065.1| PREDICTED: similar to Outer dense fiber... protein 2 (Outer dense fiber of sperm tails protein 2) (84 kDa outer dense fiber protein) (Cenexin) [Tribolium castaneum] CK536834 swg ...

  17. EST Table: FS758989 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS758989 E_FL_fcaL_09P10_F_0 10/09/28 34 %/195 aa ref|XP_001842174.1| sensitized chromosome inheritance... modifier 19 [Culex quinquefasciatus] gb|EDS39679.1| sensitized chromosome inheritance m

  18. EST Table: FS758854 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS758854 E_FL_fcaL_09I20_F_0 10/09/28 35 %/195 aa ref|XP_001842174.1| sensitized chromosome inheritance... modifier 19 [Culex quinquefasciatus] gb|EDS39679.1| sensitized chromosome inheritance m

  19. Typhoid outbreak investigation in Dzivaresekwa, suburb of Harare

    African Journals Online (AJOL)

    abp

    2014-08-18

    Aug 18, 2014 ... Harare City Engineer must invest in repairing water and sewage reticulation systems in the city. Pan African Medical .... 29% male and 30%female cases. Figure 1shows the epidemic curve which ... Females were 19.5 times more likely to contract typhoid if there was a typhoid contact at home while males ...

  20. Regulatory Self-efficacy as a Moderator of Peer Socialization Relating to Italian Adolescents' Alcohol Intoxication

    NARCIS (Netherlands)

    Rabaglietti, E.; Burk, W.J.; Giletta, M.

    2012-01-01

    The present study investigated regulatory self-efficacy (RSE) as a predictor of friendship and adolescent alcohol intoxication and as a moderator of peer socialization processes related to alcohol intoxication. The longitudinal sample included 457 Italian adolescents (262 females and 195 males)

  1. Checklist of the marine bivalves from Peru

    Directory of Open Access Journals (Sweden)

    Carlos Paredes

    2016-08-01

    Full Text Available A checklist of the marine bivalve species from Peru is presented, this list has 401 species which are distributed in 65 families and 195 genera. The taxonomical classification and nomenclature is based on classical and current bibliography including Bernard (1983 and Coan & Valentich-Scott (2012. We give distribution and hábitat information about every species.

  2. Risk factors for Buruli ulcer in Côte d'Ivoire: Results of a case-control ...

    African Journals Online (AJOL)

    Controls were selected from the general population by a two stage cluster sampling method. A total of 116 cases and 116 controls were included. For the cases, the male/female sex ratio was 0.84, the median age was 19.5 years and 40.5% were children 15 years. Biological results were obtained for 86 (74%) cases using ...

  3. Eating Attitudes, Perfectionism and Body-esteem of Elite Male Judoists and Cyclists

    National Research Council Canada - National Science Library

    Filaire, Edith; Rouveix, Matthieu; Pannafieux, Christelle; Ferrand, Claude

    2007-01-01

    This study tested the hypothesis that male athletes who feel pressured to maintain a specific body weight present an elevated risk of subclinical eating disorders. Twelve judoists (19.5 ± 0.5 yr), fifteen cyclists (21.2 ± 2.8 yr...

  4. Checklist of Reef Fishes of Diani and Galu, Kenya | Bock | Journal of ...

    African Journals Online (AJOL)

    This paper provides a checklist of the 195 species of coral reef fish observed in Diani Lagoon between April 1990 and November 1991, and the 203 species observed in Galu Lagoon between October 1991 and March 1994. Community structure, species richness and relative abundances were similar between Diani and ...

  5. Ocular effects of chronic exposure to welding light on calabar welders

    African Journals Online (AJOL)

    It was generally observed that welders in Calabar, Nigeria did not always wear their protective goggles during welding. Since chronic exposure to welding light can impair vision this study was done to assess the effect of exposure to welding light on ocular function of welders in Calabar, Nigeria. There were 195 subjects ...

  6. 78 FR 49996 - Pipeline Safety: Periodic Updates of Regulatory References to Technical Standards and...

    Science.gov (United States)

    2013-08-16

    ... Welding Fittings,'' (2009 edition). Replaces IBR: MSS SP-75-2004, ``Specification for High Test Wrought Butt Welding Fittings,'' (2004 edition); Referenced in 49 CFR 195.118. NACE International (NACE) --NACE... the product could affect the physical environment as well as the health and safety of the public. The...

  7. Avoiding acidic region streaking in two-dimensional gel ...

    Indian Academy of Sciences (India)

    biosynthesis, sliding motility, and biofilm formation by a membrane-anchored nucleoid-associated protein of My- cobacterium tuberculosis. J. Bacteriol. 195 1769-1778. Gupta S, Pandit SB, Srinivasan N and Chatterji D 2002. Proteomics analysis of carbon-starved Mycobacterium smegmatis: induction of Dps-like protein.

  8. AcEST: DK963190 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ein OS=Anaer... 36 1.3 tr|B4U7B8|B4U7B8_HYDS0 Hydroxylamine reductase OS=Hydrogen...AYERNKPTKKYSANQMS 195 Query: 47 PGQ 39 G+ Sbjct: 196 DGE 198 >tr|B4U7B8|B4U7B8_HYDS0 Hydroxylamine

  9. Domain Modeling: NP_689714.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_689714.2 chr1 Solution structure of the Pyrin (PAAD-DAPIN) domain in human Myelo...id cell nuclear differentiation antigen p2dbga_ chr1/NP_689714.2/NP_689714.2_apo_1-95.pdb psi-blast 0 ...

  10. Student Leadership in Selected Public Universities in Kenya ...

    African Journals Online (AJOL)

    ... rates by female students and tribalism/regionalism. This study observed the transformative nature of student leadership compared to what it was two decades ago and encouraged that student leadership is an integral component of modern university management. African Research Review Vol. 2 (3) 2008: pp. 195-221 ...

  11. Calcium regulates the expression of a Dictyostelium discoideum ...

    Indian Academy of Sciences (India)

    Unknown

    Blots were exposed to a Fuji phosphoimager screen and quantified with the Fuji Science(tm) software (Fuji Labo- ratories, Japan). To control for loading differences, mRNA ..... 66 195–. 204. Motomura S, Fukushima K, Nishitani H, Nawata H and. Nishimoto T 1996 A hamster temperature-sensitive G1 mutant,. tsBN250 has a ...

  12. Induced Stress, Artificial Environment, Simulated Tactical Operations Center Model

    Science.gov (United States)

    1973-06-01

    Harriet . On the Relation Between Similarity and Transfer of Training in the Learn- ing of Discriminative Motor Tasks, TR SDC 316-1-5, OR, Special...Social Research, Ann Arbor, Univwrsicy of Michigan Prusm, 195t,. Jacobs , T. 0. Leadership in Small Military Units, Alexandria, Virginia. Human

  13. Disease: H00568 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 10: G71.1 MeSH: D009223 OMIM: 160900 602668 PMID:16876389 (description, gene) Cho DH, Tapscott SJ Myotonic dystrophy: emerging mechan...isms for DM1 and DM2. Biochim Biophys Acta 1772:195-204 (2007) PMID:21496635 (gene)

  14. Effect of Toloposogo Creativity Technique in the Reduction of ...

    African Journals Online (AJOL)

    This study examined the effects of TO-LO-PO-SO-GO creativity technique in the reduction of psychopathological behaviours of some adolescents in Nigerian Prisons. Sixty adolescent prisoners randomly selected from Ikoyi Lagos and Abeokuta prisons whose ages ranged from 18-21 with a mean of 19.5 were randomly ...

  15. Untitled

    Indian Academy of Sciences (India)

    It was then cooled, treated with ice-water, allowed to stand for 10 hours and the resulting solid was filtered. When the product was crystallised from alcohol-ether mixture, it melted at 195-96. This substance was then repeatedly crystallised from ethyl acetate when it was obtained in two fractions. The top fraction melted at ...

  16. 2015 Utilization of Electronic Information Resources in Ramat

    African Journals Online (AJOL)

    Utilization of Electronic Information Resources in Ramat Library, University of Maiduguri, Nigeria. 195 ... Information Impact Vol. 6 (2) 2015. Introduction. The concept of "e-resources" which stands for electronic resources has become a global phenomenon which emerged as a ... Science, Delta State University Abaraka,.

  17. 77 FR 43337 - Drugs for Human Use; Drug Efficacy Study Implementation; Certain Prescription Drugs Offered for...

    Science.gov (United States)

    2012-07-24

    ..., regarding Bentyl Capsules (NDA 7-409), Bentyl Injection (NDA 8-370), Bentyl Syrup (NDA 7-961), and Dactil... Second St., Boston, MA 02127, regarding a topical aerosol foam hydrocortisone and pramoxine HCl product... topical aerosol foam hydrocortisone and pramoxine HCl products (ANDAs 86-195 and 86-457). In November 2010...

  18. Comparing and Combining Traditional Teaching Approaches and the Use of Video Clips for Learning How to Identify Species in an Aquarium

    Science.gov (United States)

    Pfeiffer, Vanessa D. I.; Scheiter, Katharina; Gemballa, Sven

    2012-01-01

    This study investigated the effectiveness of three different instructional materials for learning how to identify fish at the species level in a blended classroom and out-of-classroom scenario. A sample of 195 first-year students of biology or geoecology at the University of Tuebingen participated in a course on identification of European…

  19. Sintering of Multilayered Porous Structures: Part II – Experiments and Model Applications

    DEFF Research Database (Denmark)

    Ni, De Wei; Olevsky, Eugene; Esposito, Vincenzo

    2013-01-01

    Experimental analyses of shrinkage and distortion kinetics during sintering of bilayered porous and dense gadolinium-doped ceria Ce0.9Gd0.1O1.95d structures are carried out, and compared with the theoretical models developed in Part I of this work. A novel approach is developed for the determinat...

  20. Camber Evolution and Stress Development of Porous Ceramic Bilayers During Co-Firing

    DEFF Research Database (Denmark)

    Ni, De Wei; Esposito, Vincenzo; Schmidt, Cristine Grings

    2013-01-01

    Camber evolution and stress development during co-firing of asymmetric bilayer laminates, consisting of porous Ce0.9Gd0.1O1.95 gadolinium-doped cerium oxide (CGO) and La0.85Sr0.15MnO3 lanthanum strontium manganate (LSM)-CGO were investigated. Individual layer shrinkage was measured by optical dil...

  1. Down-regulation of acetolactate synthase compromises OI-1- mediated resistance to powdery mildew in tomato

    NARCIS (Netherlands)

    Gao, D.; Huibers, R.P.; Loonen, A.E.H.M.; Visser, R.G.F.; Wolters, A.M.A.; Bai, Y.

    2014-01-01

    Background - In a cDNA-AFLP analysis comparing transcript levels between powdery mildew (Oidium neolycopersici)-susceptible tomato cultivar Moneymaker (MM) and near isogenic lines (NILs) carrying resistance gene Ol-1 or Ol-4, a transcript-derived fragment (TDF) M11E69-195 was found to be present in

  2. Diplostomum von Nordmann, 1832 (Digenea: Diplostomidae) in the sub-Arctic: descriptions of the larval stages of six species discovered recently in Iceland

    Czech Academy of Sciences Publication Activity Database

    Faltýnková, Anna; Georgieva, Simona; Kostadinova, Aneta; Blasco-Costa, Maria Isabel; Scholz, Tomáš; Skirnisson, K.

    2014-01-01

    Roč. 89, č. 3 (2014), s. 195-213 ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : life cycle * cryptic diversity * molecular data * fish * DNA * Trematoda * Strigeida * snails Subject RIV: EG - Zoology Impact factor: 1.336, year: 2014

  3. Index to the Shock and Vibration Bulletins

    Science.gov (United States)

    1968-02-01

    See Welmers , E, TJ. 24(14) S SAIN, W. H. Mechanical properties of special tubes under high acceleration, 24(195) SANDERS, S. P. Pneumatic...resistance strain gages. 8(1) WELLER, R. K. Methods of achieving missile reliability. 18(9) WELMERS , E. T, Missile vibrations and instrumentation. 18

  4. 32 CFR 518.5 - Authority.

    Science.gov (United States)

    2010-07-01

    ... property); (6) AR 36-2 (Government Accounting Office audits); (7) AR 40-66, AR 40-68, and AR 40-400... accident investigations); (10) AR 195-2 (criminal investigation activities); (11) AR 190-45 (Military... (U.S. Army Intelligence and Security Command investigation files); (17) AR 385-40 (safety reports and...

  5. Income inequality and subjective well-being: : A cross-national study on the conditional effects of individual and national characteristics

    NARCIS (Netherlands)

    Rözer, J.J.|info:eu-repo/dai/nl/338041494; Kraaykamp, G.

    In this study we raise the question how a nation’s income inequality affects subjective well-being. Using information on 195,091 individuals from 85 different countries from the World Value Surveys and the European Value Surveys, we established that in general, people living in more unequal

  6. Income inequality and subjective well-being: A cross-national study on the conditional effects of individual and national characteristics

    NARCIS (Netherlands)

    Rözer, J.; Kraaykamp, G.L.M.

    2013-01-01

    In this study we raise the question how a nation's income inequality affects subjective well-being. Using information on 195,091 individuals from 85 different countries from the World Value Surveys and the European Value Surveys, we established that in general, people living in more unequal

  7. Building the Bridge from War to Peace: Defining Interagency Roles in Rebuilding a Nation

    Science.gov (United States)

    2009-11-01

    Christopher J. After War: The Political Economy of Exporting Democracy. Stanford: Stanford Economics and Finance, 2008. (HB 195 .C697 2008) DeGrasse...34 Maclean’s 116.13 (31 Mar. 2003): 28-30. Riphenburg, Carol. "Afghanistan: Out of the Globalisation Mainstream?" Third World Quarterly 27 .3 (Apr. 2006

  8. levels of heavy metals in gubi dam water bauchi, nigeria

    African Journals Online (AJOL)

    Ada

    constituents or pollutants in natural waters are the particles. All substances that ... rivers to the ocean is in the form of particulate matter (Martin and ..... pollution. Water Research, 9: pp. 189-. 195. Aston S.R. and Thornton, I., 1977. Regional geochemical data in relation to seasonal variations in water quality. Science of the.

  9. Time to enhancement derived from ultrafast breast MRI as a novel parameter to discriminate benign from malignant breast lesions

    NARCIS (Netherlands)

    Mus, R.D.M.; Borelli, C.; Bult, P.; Weiland, E.; Karssemeijer, N.; Barentsz, J.O.; Gubern-Merida, A.; Platel, B.; Mann, R.M.

    2017-01-01

    OBJECTIVES: To investigate time to enhancement (TTE) as novel dynamic parameter for lesion classification in breast magnetic resonance imaging (MRI). METHODS: In this retrospective study, 157 women with 195 enhancing abnormalities (99 malignant and 96 benign) were included. All patients underwent a

  10. Development of rapid PCR-RFLP technique for identification of ...

    African Journals Online (AJOL)

    Species differentiation was realized by digestion of the amplified ~195 bp fragments with Sse9I restriction enzyme. The results indicate that 7/7 of Kebab loghmeh, 9/10 of minced meat, 4/8 of beef burger and 2/5 samples of canned stew samples, were contaminated with one of prohibited ruminant species residual.

  11. Revisiting the “Art Bias” in Lay Conceptions of Creativity

    DEFF Research Database (Denmark)

    Glaveanu, Vlad Petre

    2014-01-01

    This article explores the art bias—the pervasive association between creativity and art in implicit theories of creativity. It also attempts to connect creativity research in this area with literature on the theory of social representations. The data comes from an online survey completed by 195...

  12. Investigation of the Genetic Basis of Tetracycline Resistance in ...

    African Journals Online (AJOL)

    Chopra I, Roberts M. Tetracycline antibiotics: mode of action, applications, molecular biology, and epidemiology of bacterial resistance. Microbiol. Mol Biol Rev 2001; 65(2): 232-260. 2. Roberts MC. Update on acquired tetracycline resistance genes. FEMS Microbiol Lett 2005;. 245(2): 195-203. 3. Speer BS, Shoemaker NB, ...

  13. Journal of Genetics, Volume 84, 2005

    Indian Academy of Sciences (India)

    (Review article). 195 bioinformatics. Exact Tandem Repeats Analyzer (E-TRA): A new program for DNA sequence mining. 49. Comparative studies on codon usage pattern of chloroplasts and their host nuclear genes in four plant species. 55 bivariate phenotype. Dissecting the correlation structure of a bivariate phenotype:.

  14. Prevalence and correlates of aggression among psychiatric in ...

    African Journals Online (AJOL)

    The prevalence of aggression in this study was 19.5%. Of the 58 aggressive patients, 35 (21.7%) and 23 (16.8%) were male and female, respectively. Schizophrenic patients (31%) exhibited aggression more than any other diagnostic category. Most of the aggressive behavior occurred without provocation (63.3%).

  15. Declines of seagrasses in a tropical harbour, North Queensland ...

    Indian Academy of Sciences (India)

    2015-04-17

    Apr 17, 2015 ... governance of port and shipping impacts in the Great Barrier. Reef. Mar. Pollut. Bull. 75 8–20. Grice AM, Loneragan NR and Dennison WC 1996 Light intensity and the interactions between physiology, morphology and stable isotope ratios in five species of seagrass. J. Exp. Mar. Biol. Ecol. 195 91–110.

  16. In their review, Fogarty et al. (1991) concluded that “Recruitment ...

    African Journals Online (AJOL)

    spamer

    Do they require a special kind of management? Risk- spreading can occur in several dimensions, including time, space and phenotype. Survival in fluctuating environments .... O'Dor: Squid Management and Understanding of Squid Life History Strategies. 1998. 195 ..... changes in gene frequency to track changes in climate.

  17. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Volume 31 Issue 2 April 2008 pp 193-195 Nanomaterials. Mesoscale organization of CuO nanoslices: Formation of sphere · Jun Wang Shunxiao Zhang ... Volume 31 Issue 4 August 2008 pp 597-601 Nanomaterials. ZnO nanostructured microspheres and grown structures by thermal treatment · Jun Wang Shunxiao Zhang ...

  18. EST Table: FS904069 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS904069 E_FL_ftes_53L19_R_0 10/09/28 42 %/195 aa ref|NP_001036933.1| molting fluid... carboxypeptidase A [Bombyx mori] dbj|BAD60916.1| molting fluid carboxypeptidase A [Bombyx mori] 10/09/12 38

  19. SAFE DISPOSAL OF MUNICIPAL WASTES IN NIGERIA ...

    African Journals Online (AJOL)

    of modern scientific methods of waste management, treatment and disposal, the non-enforcement cum .... 13 Damilola Olawuyi, The Principles of Nigerian Environmental Law (Business Perspectives. 2013) 195. ... 17 B. Abila and J. Kantola 'Municipal Solid Waste Management Problems in Nigeria: Evolving. Knowledge ...

  20. Oxygen transport membranes for biomass gasification and cement industry

    DEFF Research Database (Denmark)

    Cheng, Shiyang

    Oxygen transport membranes (OTMs) are of particular interest for their potential applications in high purity oxygen separation, biomass gasification and carbon capture and storage in cement production. Gd0.1Ce0.9O1.95-δ (GCO) is one of the interesting materials of OTMs because of its high ionic...