WorldWideScience

Sample records for astatine 194

  1. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  2. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-09-15

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Discovery of the astatine, radon, francium, and radium isotopes

    Science.gov (United States)

    Fry, C.; Thoennessen, M.

    2013-09-01

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration

    2011-11-30

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  6. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Science.gov (United States)

    Uusitalo, J.; Jakobsson, U.

    2011-11-01

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  7. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy.

    Science.gov (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  9. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others

    2015-10-15

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  10. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Science.gov (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.

    2015-10-01

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  11. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  12. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  13. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  14. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  15. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  16. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  17. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  18. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study

    Science.gov (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi

    2018-01-01

    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).

  19. 40 CFR 194.27 - Peer review.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Peer review. 194.27 Section 194.27... § 194.27 Peer review. (a) Any compliance application shall include documentation of peer review that has... barrier evaluation as required in § 194.44. (b) Peer review processes required in paragraph (a) of this...

  20. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  1. 21 CFR 211.194 - Laboratory records.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Laboratory records. 211.194 Section 211.194 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Records and Reports § 211.194...

  2. 46 CFR 194.15-9 - Storage.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Storage. 194.15-9 Section 194.15-9 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS HANDLING, USE, AND CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Chemistry Laboratory and Scientific Laboratory § 194.15-9 Storage...

  3. 46 CFR 194.15-5 - Ventilation.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Ventilation. 194.15-5 Section 194.15-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS HANDLING, USE, AND CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Chemistry Laboratory and Scientific Laboratory § 194...

  4. 46 CFR 194.15-3 - Responsibility.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Responsibility. 194.15-3 Section 194.15-3 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS HANDLING, USE, AND CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Chemistry Laboratory and Scientific Laboratory § 194...

  5. 46 CFR 194.15-1 - General.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false General. 194.15-1 Section 194.15-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS HANDLING, USE, AND CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Chemistry Laboratory and Scientific Laboratory § 194.15-1 General...

  6. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  7. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  8. 10 CFR 19.4 - Interpretations.

    Science.gov (United States)

    2010-01-01

    ... Interpretations. Except as specifically authorized by the Commission in writing, no interpretation of the meaning... 10 Energy 1 2010-01-01 2010-01-01 false Interpretations. 19.4 Section 19.4 Energy NUCLEAR... interpretation by the General Counsel will be recognized to be binding upon the Commission. ...

  9. 40 CFR 194.21 - Inspections.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Inspections. 194.21 Section 194.21 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) RADIATION PROTECTION PROGRAMS CRITERIA... authorized representative(s) shall comply with applicable access control measures for security, radiological...

  10. 46 CFR 194.10-25 - Ventilation.

    Science.gov (United States)

    2010-10-01

    ... magazines. (1) All integral magazines shall be provided with natural or mechanical ventilation. Design... vans shall be provided with natural ventilation sufficient to maintain the inside air temperature below... 46 Shipping 7 2010-10-01 2010-10-01 false Ventilation. 194.10-25 Section 194.10-25 Shipping COAST...

  11. 46 CFR 194.15-19 - Electrical.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Electrical. 194.15-19 Section 194.15-19 Shipping COAST....15-19 Electrical. (a) All electrical equipment located within 18 inches of the deck of the chemical laboratory shall be in accordance with the applicable requirements of Subchapter J (Electrical Engineering...

  12. 46 CFR 194.90-1 - Requirements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Requirements. 194.90-1 Section 194.90-1 Shipping COAST...-1 Requirements. (a) Vessels contracted for prior to March 1, 1968, shall meet the following requirements: (1) Existing arrangements, materials, and facilities previously approved but not meeting the...

  13. Linear clusters of galaxies - A194

    Science.gov (United States)

    Chapman, G. N. F.; Geller, M. J.; Huchra, J. P.

    1988-01-01

    New measurements for 160 redshifts and previous measurements for 108 other redshifts are presented for galaxies within 5 deg of A194. The galaxy distribution in A194 is shown to be inconsistent with a spherically symmetric King model. A mass-to-light ratio is derived using the virial theorem which is lower than the mean for the groups in the CfA redshift survey (Huchra and Geller, 1982; Geller, 1984). A nonparametric test for galaxy-cluster alignment and a Chi-squared test are used to search for alignment of galaxy major axes with the axis of A194. Evidence for neither luminosity segregation nor significant differences in the velocity or surface distributions of galaxies as a function of morphological type is found.

  14. Dicty_cDB: VSF194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available crfrlqkitsysipkhqfnqn*rcclt*rfnflfr*kslfsqqsfqis qkpnwsqnfmg*dlqnpr*FRCCPSSFRQKPP...spetshqklwvpqselcythqtsk*xlkrk kk Frame C: ltt*ngkdllkrcrfrlqkitsysipkhqfnqn*rcclt*rfnflfr*kslfsqqsfqis qkpnwsqnfmg*dlqnpr*FRCCPSSF...VS (Link to library) VSF194 (Link to dictyBase) - - - - VSF194P (Link to Original site) VSF194F 376 VSF...194Z 358 VSF194P 734 - - Show VSF194 Library VS (Link to library) Clone ID VSF194 (Link ...to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSF

  15. 46 CFR 194.10-35 - Labeling.

    Science.gov (United States)

    2010-10-01

    ... CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Magazines § 194.10-35 Labeling. (a) Labeling shall be... door to magazines and magazine vans shall bear the inscription: MAGAZINE KEEP OPEN LIGHTS AND FIRE AWAY... conspicuous location, preferably the top, with the inscription: MAGAZINE CHEST KEEP OPEN LIGHTS AND FIRE AWAY...

  16. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  17. 40 CFR 194.15 - certification application(s).

    Science.gov (United States)

    1996-07-01

    ... 40 PROTECTION OF ENVIRONMENT 12 1996-07-01 1996-07-01 false certification application(s). 194.15 Sec. 194.15 Content of compliance re PROTECTION OF ENVIRONMENT ENVIRONMENTAL PROTECTION AGENCY... and Re-certification Applications Sec. 194.15 Content of compliance re-certification application(s...

  18. 46 CFR 194.05-3 - Chemical stores.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Chemical stores. 194.05-3 Section 194.05-3 Shipping..., AND CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Stowage and Marking § 194.05-3 Chemical stores. (a) Chemical stores are those chemicals which possess one or more of the following properties and...

  19. 46 CFR 194.20-7 - Fire protection.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Fire protection. 194.20-7 Section 194.20-7 Shipping..., AND CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Chemical Stores and/or Storerooms § 194.20-7 Fire protection. (a) Each chemical storeroom shall be protected by a fixed automatic carbon dioxide...

  20. 46 CFR 194.15-7 - Fire protection.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Fire protection. 194.15-7 Section 194.15-7 Shipping..., AND CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Chemistry Laboratory and Scientific Laboratory § 194.15-7 Fire protection. (a) If a fixed or semiportable fire-fighting system is installed, it shall...

  1. 46 CFR 194.15-11 - Flushing systems.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Flushing systems. 194.15-11 Section 194.15-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS HANDLING, USE... § 194.15-11 Flushing systems. (a) Working spaces in which chemical stores are used shall be equipped...

  2. 46 CFR 194.10-30 - Magazine sprinklers.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Magazine sprinklers. 194.10-30 Section 194.10-30..., USE, AND CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Magazines § 194.10-30 Magazine sprinklers... shall be installed in each magazine or magazine group. The control valve shall generally be in...

  3. 46 CFR 194.10-10 - Integral magazine construction.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Integral magazine construction. 194.10-10 Section 194.10... HANDLING, USE, AND CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Magazines § 194.10-10 Integral magazine construction. (a) Magazines shall be of permanent watertight construction. Bulkheads and decks...

  4. 13 CFR 120.194 - Use of computer forms.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Use of computer forms. 120.194... Applying to All Business Loans Computerized Sba Forms § 120.194 Use of computer forms. Any Applicant or Participant may use computer generated SBA application forms, closing forms, and other forms designated by SBA...

  5. 40 CFR 194.46 - Removal of waste.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Removal of waste. 194.46 Section 194.46 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) RADIATION PROTECTION... time after disposal. Such documentation shall include an analysis of the technological feasibility of...

  6. 46 CFR 194.10-15 - Magazine van construction.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Magazine van construction. 194.10-15 Section 194.10-15... construction. (a) Vans shall be of substantial metal construction. Their interior shall be insulated with an... (Electrical Engineering) of this chapter. The electrical terminals for connections to the ship's electrical...

  7. 40 CFR 194.32 - Scope of performance assessments.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Scope of performance assessments. 194... Containment Requirements § 194.32 Scope of performance assessments. (a) Performance assessments shall consider... of the regulatory time frame. Performance assessments shall assume that mineral deposits of those...

  8. 40 CFR 194.5 - Publications incorporated by reference.

    Science.gov (United States)

    2010-07-01

    ...) American Society of Mechanical Engineers (ASME) Nuclear Quality Assurance (NQA) Standard, NQA-1-1989...) ASME NQA-2a-1990 addenda, part 2.7, to ASME NQA-2-1989 edition “Quality Assurance Requirements for Nuclear Facility Applications;” IBR approved for § 194.22 and § 194.23. (4) ASME NQA-3-1989 edition...

  9. 46 CFR 194.20-11 - Flushing systems.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Flushing systems. 194.20-11 Section 194.20-11 Shipping... Flushing systems. (a) Provision shall be made for flushing away chemical spills. (b) If a drainage system is installed, it shall be separate from any other drainage system. ...

  10. 34 CFR 403.194 - What are the comparability requirements?

    Science.gov (United States)

    2010-07-01

    ... children of limited English proficiency. (C) Special education for children with disabilities. (D) State... 34 Education 3 2010-07-01 2010-07-01 false What are the comparability requirements? 403.194 Section 403.194 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF...

  11. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.

    2017-04-01

    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  12. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination.

    Science.gov (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick

    2007-01-01

    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  13. Phenotype abnormality: 194 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 194 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u700i decreased number... of seed in organ named whole plant ... whole plant ... present in fewer numbers in organism ... seed ...

  14. 46 CFR 194.10-5 - Type and location.

    Science.gov (United States)

    2010-10-01

    ..., AND CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Magazines § 194.10-5 Type and location. (a... in bearing with a bulkhead forming the boilerroom, engineroom, gallery, or other high fire hazard... stowage of other explosives or oxidizing materials in the same hold is permitted in accordance with the...

  15. 40 CFR 194.34 - Results of performance assessments.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Results of performance assessments... Containment Requirements § 194.34 Results of performance assessments. (a) The results of performance... performance assessments shall be developed and documented in any compliance application. (c) Computational...

  16. Phenotype-gene: 194 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available uence of brassinosteroid for AT1G12840 ... decreased sensitivity toward under influence... 194 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1192i decreased sensitivity toward under infl

  17. Clean Intermittent Catheterization: Overview of Results in 194 ...

    African Journals Online (AJOL)

    Background: Clean intermittent catheterization (CIC) is a life-saving procedure in children with spina bifida, but its effectiveness in Kenya has not been previously documented. Patients and Methods: The current study analyzed the application of CIC in a series of 194 patients with spina bifida who fulfilled set criteria for ...

  18. 27 CFR 41.194 - Articles of partnership or association.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Articles of partnership or... AND TUBES, AND PROCESSED TOBACCO Tobacco Products Importers § 41.194 Articles of partnership or..., must furnish with its application for permit required by § 41.191 a true copy of the articles of...

  19. 38 CFR 17.194 - Aid for domiciliary care.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Aid for domiciliary care... Aid to States for Care of Veterans in State Homes § 17.194 Aid for domiciliary care. Aid may be paid to the designated State official for domiciliary care furnished in a recognized State home for any...

  20. INTEGRAL Observations of MAXI J1836-194

    DEFF Research Database (Denmark)

    Del Santo, M.; Kuulkers, E.; Rodriguez, J.

    2011-01-01

    MAXI J1836-194 (ATEL #3611) was in the INTEGRAL/IBIS FOV on September 13th from UT 09:15 till 12:56, during the Galactic Bulge monitoring observations (See http://integral.esac.esa.int/BULGE ). It was detected at about 55 mCrab and 50 mCrab (in 18-40 keV) in revolutions 1088 and 1090, respectivel...

  1. [[Italian 194 Law, Conscientious Objection and the European Disapproval].

    Science.gov (United States)

    D'Amico, Marilisa

    This essay aims at delving into the issues raised by the application of the Law No. 194/1978 in the matter of the voluntary termination of pregnancy, taking into account the constitutional principles, the judgments of the Italian Constitutional Court and the recent decision on the merit of the Collective Complaint No. 87/2012 (International Planned Parenthood Federation European Network v. Italy) adopted by the European Committee of Social Rights.

  2. 46 CFR 194.05-13 - Corrosive liquids as chemical stores-Detail requirements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Corrosive liquids as chemical stores-Detail requirements... and Marking § 194.05-13 Corrosive liquids as chemical stores—Detail requirements. (a) Corrosive liquids as chemical stores and reagents are governed by subparts 194.15 and 194.20. (b) Other corrosive...

  3. 46 CFR 194.05-19 - Combustible liquids as chemical stores-Detail requirements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Combustible liquids as chemical stores-Detail... and Marking § 194.05-19 Combustible liquids as chemical stores—Detail requirements. (a) Combustible liquid chemical stores and reagents shall be governed by subparts 194.15 and 194.20. (b) Other...

  4. 46 CFR 194.05-9 - Flammable liquid chemical stores-Detail requirements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Flammable liquid chemical stores-Detail requirements... and Marking § 194.05-9 Flammable liquid chemical stores—Detail requirements. (a) Flammable liquids as chemical stores and reagents are governed by subparts 194.15 and 194.20. (b) Other flammable liquids are...

  5. 46 CFR 194.05-17 - Poisonous articles as chemical stores-Detail requirements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Poisonous articles as chemical stores-Detail... and Marking § 194.05-17 Poisonous articles as chemical stores—Detail requirements. (a) Poisonous articles as chemical stores and reagents shall be governed by subparts 194.15 and 194.20. (b) Other...

  6. 46 CFR 194.05-15 - Compressed gases as chemical stores-Detail requirements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Compressed gases as chemical stores-Detail requirements... and Marking § 194.05-15 Compressed gases as chemical stores—Detail requirements. (a) Compressed gases as chemical stores and reagents are governed by subparts 194.15 and 194.20. (b) Other compressed...

  7. 46 CFR 194.05-11 - Flammable solids and oxidizing materials-Detail requirements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Flammable solids and oxidizing materials-Detail requirements. 194.05-11 Section 194.05-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED... and Marking § 194.05-11 Flammable solids and oxidizing materials—Detail requirements. (a) Flammable...

  8. 49 CFR 176.194 - Stowage of Class 1 (explosive) materials on magazine vessels.

    Science.gov (United States)

    2010-10-01

    ... magazine vessels. 176.194 Section 176.194 Transportation Other Regulations Relating to Transportation... REGULATIONS CARRIAGE BY VESSEL Detailed Requirements for Class 1 (Explosive) Materials Magazine Vessels § 176.194 Stowage of Class 1 (explosive) materials on magazine vessels. (a) General. The requirements of...

  9. Ghaffari et al., Afr J Tradit Complement Altern Med. (2016) 13(6):194 ...

    African Journals Online (AJOL)

    Ghaffari et al., Afr J Tradit Complement Altern Med. (2016) 13(6):194-198. 10.21010/ajtcam. v13i6.28. 194. CYTOTOXIC, α-CHYMOTRYPSIN AND UREASE INHIBITION ACTIVITIES OF THE PLANT. Heliotropium dasycarpum L. Muhammad Abuzar Ghaffari٭, Bashir Ahmed Chaudhary, Muhammad Uzair, Khuram Ashfaq.

  10. 46 CFR 194.20-15 - Chemical stores other than compressed gases.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Chemical stores other than compressed gases. 194.20-15... VESSELS HANDLING, USE, AND CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Chemical Stores and/or Storerooms § 194.20-15 Chemical stores other than compressed gases. (a) Flammable liquids are excluded from...

  11. 40 CFR 194.33 - Consideration of drilling events in performance assessments.

    Science.gov (United States)

    2010-07-01

    ... performance assessments. 194.33 Section 194.33 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... assessments. (a) Performance assessments shall examine deep drilling and shallow drilling that may potentially... performance assessments, drilling events shall be assumed to occur in the Delaware Basin at random intervals...

  12. 33 CFR 110.194a - Mobile Bay, Ala., and Mississippi Sound, Miss.

    Science.gov (United States)

    2010-07-01

    ... Sound, Miss. 110.194a Section 110.194a Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Mississippi Sound, Miss. (a) The anchorage grounds. (1) The waters of lower Mobile Bay, near Cedar Point... south by latitude 30°20′00″, and on the west by longitude 88°06′00″. (2) The waters of Mississippi Sound...

  13. 46 CFR 194.05-5 - Chemicals in the chemistry laboratory.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Chemicals in the chemistry laboratory. 194.05-5 Section... VESSELS HANDLING, USE, AND CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Stowage and Marking § 194.05-5 Chemicals in the chemistry laboratory. (a) Small working quantities of chemical stores in the...

  14. 46 CFR 194.15-17 - Compressed gases other than inert gases.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Compressed gases other than inert gases. 194.15-17 Section 194.15-17 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS HANDLING, USE, AND CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Chemistry Laboratory and...

  15. 46 CFR 194.15-15 - Chemicals other than compressed gases.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Chemicals other than compressed gases. 194.15-15 Section 194.15-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS HANDLING, USE, AND CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Chemistry Laboratory and...

  16. Rational Design of Cyclic Antimicrobial Peptides Based on BPC194 and BPC198

    OpenAIRE

    Cirac, Anna D.; Maria Torné; Esther Badosa; Emilio Montesinos; Pedro Salvador; Lidia Feliu; Marta Planas

    2017-01-01

    A strategy for the design of antimicrobial cyclic peptides derived from the lead compounds c(KKLKKFKKLQ) (BPC194) and c(KLKKKFKKLQ) (BPC198) is reported. First, the secondary β-structure of BPC194 and BPC198 was analyzed by carrying out molecular dynamics (MD) simulations. Then, based on the sequence pattern and the β-structure of BPC194 or BPC198, fifteen analogues were designed and synthesized on solid-phase. The best peptides (BPC490, BPC918, and BPC924) showed minimum inhibitory concentra...

  17. The Contribution of Serine 194 Phosphorylation to Steroidogenic Acute Regulatory Protein Function

    OpenAIRE

    Sasaki, Goro; Zubair, Mohamad; Ishii, Tomohiro; Mitsui, Toshikatsu; Hasegawa, Tomonobu; Auchus, Richard J.

    2014-01-01

    The steroidogenic acute regulatory protein (StAR) facilitates the delivery of cholesterol to the inner mitochondrial membrane, where the cholesterol side-chain cleavage enzyme catalyzes the initial step of steroid hormone biosynthesis. StAR was initially identified in adrenocortical cells as a phosphoprotein, the expression and phosphorylation of which were stimulated by corticotropin. A number of in vitro studies have implicated cAMP-dependent phosphorylation at serine 194 (S194, S195 in hum...

  18. Removal of Acid Black 194 dye from water by electrocoagulation with aluminum anode.

    Science.gov (United States)

    Vidal, Jorge; Villegas, Loreto; Peralta-Hernández, Juan M; Salazar González, Ricardo

    2016-01-01

    Application of an electrocoagulation process (EC) for the elimination of AB194 textile dye from synthetic and textile wastewater (effluent) contaminated with AB194 dye, was carried out using aluminum anodes at two different initial pH values. Tafel studies in the presence and absence of the dye were performed. The aluminum species formed during the electrolysis were quantified by atomic absorption, and the flocs formed in the process were analyzed by HPLC-MS. Complete removal of AB194 from 1.0 L of solution was achieved applying low densities current at initial pH values of 4.0 and 8.0. The removal of AB194 by EC was possible with a short electrolysis time, removing practically 100% of the total organic carbon content and chemical oxygen demand. The final result was completely discolored water lacking dye and organic matter. An effluent contaminated with 126 mg L(-1) AB194 dye from a Chilean textile industry was also treated by EC under optimized experimental conditions, yielding discolored water and considerably decreasing the presence of organic compounds (dye + dyeing additives), with very low concentrations of dissolved Al(3+). Analysis of flocs showed the presence of the original dye without changes in its chemical structure.

  19. [Causes, diagnostics and course of disease in 194 cats with anemia].

    Science.gov (United States)

    Merten, Nina; Weingart, Christiane; Kohn, Barbara

    2015-01-01

    Anemia is a common hematological alteration in cats. The objective of this study was to evaluate the frequency of different types of anemia and the course of disease in cats with a hematocrit (hct) anemia groups based on history, physical examination and laboratory parameters. Most cats had acute blood loss anemia (BA; 75/194; 38.7%). Frequent causes were trauma (39/75), hematuria (13/75) and hemostatic disorders (9/75). Anemia of inflammatory and neoplastic disease (AID) occurred in 22.2% (43/194) and hemolytic anemia (HA) in 18% (35/194). Half of those were presumptively immune-mediated (IHA). Four cats were diagnosed with hemotropic mycoplasma infection. Rare causes of anemia included anemia of renal disease (ARD; 18/194; 9.3%) and intramedullary non-regenerative anemia (INR; 13/194; 6.7%). The latter either had retroviral infection (6/13) or neoplasia (6/13). In cats with HA and INR anemia was often severe and very severe (Hct anemia was detected for the first time. Cats with HA had the highest survival rate.

  20. RDDS lifetime measurements of low-lying superdeformed states in {sup 194}Hg

    Energy Technology Data Exchange (ETDEWEB)

    Kuehn, R.; Dewald, A.; Kruecken, R. [Universitaet Koeln (Germany)] [and others

    1996-12-31

    The lifetimes of three low-lying states in the superdeformed (SD) yrast band of {sup 194}Hg were measured by the recoil-distance Doppler-shift method. The deduced transition quadrupole moments, Q{sub t}, equal those extracted from a DSAM measurement for the high-lying states of the band corroborate the assumption that the decay out of SD bands does not strongly affect the structure of the corresponding states. By a simple mixing-model the decay can be described assuming a very small admixture of normal-deformed (ND) states to the decaying SD states. The deduced ND mixing amplitudes for the yrast SD bands in {sup 192,194}Hg and {sup 194}Pb are presented along with average transition quadrupole moments for the lower parts of the excited SD bands.

  1. MicroRNA-194 regulates keratinocyte proliferation and differentiation by targeting Grainyhead-like 2 in psoriasis.

    Science.gov (United States)

    Yu, Xiaoyun; An, Jingang; Hua, Yunhui; Li, Zihai; Yan, Ning; Fan, Weixin; Su, Chuan

    2017-02-01

    MicroRNAs (miRNAs) are currently emerged as important regulators in psoriasis. Psoriasis is characterized by hyperproliferation and impaired differentiation of keratinocytes in skin lesions. miR-194 is a well-known regulator of cell proliferation and differentiation. However, the role of miR-194 in psoriasis pathogenesis remains unclear. In this study we aimed to investigate the role of miR-194 in keratinocyte hyperproliferation and differentiation. We found that miR-194 was significantly downregulated in psoriasis lesional skin. Overexpression of miR-194 inhibited the proliferation and promoted the differentiation of primary human keratinocytes, whereas miR-194 suppression promoted the proliferation and inhibited their differentiation. Bioinformatic analysis predicted that the Grainyhead-like 2 (GRHL2) was a target gene of miR-194, which we further validated with a dual-luciferase reporter assay, real-time quantitative polymerase chain reaction (RT-qPCR), and Western blot analysis. The effect of miR-194 on cell proliferation and differentiation was significantly reversed by overexpression of GRHL2. Moreover, the expression of miR-194 and GRHL2 was inversely correlated in psoriasis lesional skin. Taken together, our results suggest that miR-194 inhibits the proliferation and promotes the differentiation of keratinocytes through targeting GRHL2. The downregulation of miR-194 expression may contribute to the pathogenesis of psoriasis and targeting miR-194 may represent a novel and potential therapeutic strategy for psoriasis. Copyright © 2016 Elsevier GmbH. All rights reserved.

  2. miR-194 Inhibits Innate Antiviral Immunity by Targeting FGF2 in Influenza H1N1 Virus Infection

    Directory of Open Access Journals (Sweden)

    Keyu Wang

    2017-11-01

    Full Text Available Fibroblast growth factor 2 (FGF2 or basic FGF regulates a wide range of cell biological functions including proliferation, angiogenesis, migration, differentiation, and injury repair. However, the roles of FGF2 and the underlying mechanisms of action in influenza A virus (IAV-induced lung injury remain largely unexplored. In this study, we report that microRNA-194-5p (miR-194 expression is significantly decreased in A549 alveolar epithelial cells (AECs following infection with IAV/Beijing/501/2009 (BJ501. We found that miR-194 can directly target FGF2, a novel antiviral regulator, to suppress FGF2 expression at the mRNA and protein levels. Overexpression of miR-194 facilitated IAV replication by negatively regulating type I interferon (IFN production, whereas reintroduction of FGF2 abrogated the miR-194-induced effects on IAV replication. Conversely, inhibition of miR-194 alleviated IAV-induced lung injury by promoting type I IFN antiviral activities in vivo. Importantly, FGF2 activated the retinoic acid-inducible gene I signaling pathway, whereas miR-194 suppressed the phosphorylation of tank binding kinase 1 and IFN regulatory factor 3. Our findings suggest that the miR-194-FGF2 axis plays a vital role in IAV-induced lung injury, and miR-194 antagonism might be a potential therapeutic target during IAV infection.

  3. OsDi19-4 acts downstream of OsCDPK14 to positively regulate ABA response in rice.

    Science.gov (United States)

    Wang, Lili; Yu, Changchun; Xu, Shanglin; Zhu, Yingguo; Huang, Wenchao

    2016-12-01

    The drought-induced 19 protein family consists of several atypical Cys2/His2-type zinc finger proteins in plants and plays an important role in abiotic stress. In this study, we found that overexpressing OsDi19-4 in rice altered the expression of a series of abscisic acid (ABA)-responsive genes, resulting in strong ABA-hypersensitive phenotypes including ABA-induced seed germination inhibition, early seedling growth inhibition and stomatal closure. On the contrary, OsDi19-4 knockdown lines were less sensitive to ABA. Additionally, OsCDPK14 was identified to interact with OsDi19-4 and be responsible for the phosphorylation of OsDi19-4, and the phosphorylation of OsDi19-4 was further enhanced after the treatment of ABA. Apart from these, OsDi19-4 was shown to directly bind to the promoters of OsASPG1 and OsNAC18 genes, two ABA-responsive genes, and regulate their expression. Transient expression assays confirmed the direct regulation role of OsDi19-4, and the regulation was further enhanced by the increased phosphorylation of OsDi19-4 after the treatment of ABA. Taken together, these data demonstrate that OsDi19-4 acts downstream of OsCDPK14 to positively regulate ABA response by modulating the expression of ABA-responsive genes in rice. © 2016 John Wiley & Sons Ltd.

  4. 36 CFR 223.194 - Procedures for reporting the acquisition and disposition of unprocessed private timber.

    Science.gov (United States)

    2010-07-01

    ... Forest Resources Conservation and Shortage Relief Act of 1990 Program § 223.194 Procedures for reporting... domestic manufacturing by a spot of highway yellow paint on each log end that must be retained on the... to maintain yellow paint markings on each log end until the timber is domestically processed or...

  5. Yeast Interacting Proteins Database: YER081W, YDR194C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YDR194C MSS116 DEAD-box protein required for efficient splicing of mitochondrial Group I and II introns; non...e name MSS116 Prey description DEAD-box protein required for efficient splicing of mitochondrial Group I and

  6. 12 CFR 19.194 - Eligibility of attorneys and accountants to practice.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Eligibility of attorneys and accountants to... Conduct § 19.194 Eligibility of attorneys and accountants to practice. (a) Attorneys. Any attorney who is... subpart may practice before the OCC. (b) Accountants. Any accountant who is qualified to practice as a...

  7. Notes on LCW Activation Calculation for Neutron Imaging Operations in the North Cave of Building 194

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, S. G. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-09-20

    This note estimates the amount of activation that could be produced in the Facilities-provided Low Conductivity Water (LCW) that is proposed to be used for cooling of electromagnets and beam stops in the Neutron Imaging (NI) accelerator project in the North Cave of Building 194.

  8. 37 CFR 2.194 - Identification of trademark application or registration.

    Science.gov (United States)

    2010-07-01

    ... TRADEMARK OFFICE, DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES General Information and Correspondence in Trademark Cases § 2.194 Identification of trademark application or registration. (a) No... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Identification of trademark...

  9. 49 CFR 194.121 - Response plan review and update procedures.

    Science.gov (United States)

    2010-10-01

    ... as a change from crude oil to gasoline; (4) The name of the oil spill removal organization; (5... SAFETY RESPONSE PLANS FOR ONSHORE OIL PIPELINES Response Plans § 194.121 Response plan review and update... address such a change and, within 30 days of making such a change, submit the change to PHMSA. Examples of...

  10. Identification of miR-194-5p as a potential biomarker for postmenopausal osteoporosis

    Directory of Open Access Journals (Sweden)

    Jia Meng

    2015-05-01

    Full Text Available The incidence of osteoporosis is high in postmenopausal women due to altered estrogen levels and continuous calcium loss that occurs with aging. Recent studies have shown that microRNAs (miRNAs are involved in the development of osteoporosis. These miRNAs may be used as potential biomarkers to identify women at a high risk for developing the disease. In this study, whole blood samples were collected from 48 postmenopausal Chinese women with osteopenia or osteoporosis and pooled into six groups according to individual T-scores. A miRNA microarray analysis was performed on pooled blood samples to identify potential miRNA biomarkers for postmenopausal osteoporosis. Five miRNAs (miR-130b-3p, -151a-3p, -151b, -194-5p, and -590-5p were identified in the microarray analysis. These dysregulated miRNAs were subjected to a pathway analysis investigating whether they were involved in regulating osteoporosis-related pathways. Among them, only miR-194-5p was enriched in multiple osteoporosis-related pathways. Enhanced miR-194-5p expression in women with osteoporosis was confirmed by quantitative reverse transcription–polymerase chain reaction analysis. For external validation, a significant correlation between the expression of miR-194-5p and T-scores was found in an independent patient collection comprised of 24 postmenopausal women with normal bone mineral density, 30 postmenopausal women with osteopenia, and 32 postmenopausal women with osteoporosis (p < 0.05. Taken together, the present findings suggest that miR-194-5p may be a viable miRNA biomarker for postmenopausal osteoporosis.

  11. MiR-194 regulates chondrogenic differentiation of human adipose-derived stem cells by targeting Sox5.

    Directory of Open Access Journals (Sweden)

    Jun Xu

    Full Text Available Osteoarthritis, also known as degenerative arthritis or degenerative joint disease, causes pain and disability worldwide. Cartilage regeneration is key to finding a cure for this disease. Adipose-derived stem cells (ASCs are capable of differentiating into cartilage lineages in vitro and they have shown promise in the field of regenerative medicine. However, the underlying mechanisms remain unclear. In this study, we demonstrated that miR-194 levels gradually decreased during the chondrogenic differentiation of human ASCs (hASCs. After predicting the target of miR-194 using Pictar and Targetscan, we hypothesized that Sox5 is potentially the key link between miR-194 and the chondrogenesis of ASCs. Initially, we demonstrated that Sox5 is a target of miR194 according to luciferase assay analysis. We further demonstrated that the differentiation of ASCs can be controlled by miR-194 through gain or loss of function experiments, and we observed that the down-regulation of miR-194 increases its direct target gene, Sox5, and results in enhanced chondrogenic differentiation of hASCs, whereas up-regulation decreases Sox5 and inhibits chondrogenesis. We also found that miR-194 correlates with Sox5 in osteoarthritis. These findings, taken together, are the first to illustrate the critical role of miR-194 in hASC chondrogenesis, and may provide novel insight beneficial to cell manipulation methods during cartilage regeneration.

  12. 41 CFR 102-194.30 - What role does my agency play in the Standard and Optional Forms Management Program?

    Science.gov (United States)

    2010-07-01

    ... What role does my agency play in the Standard and Optional Forms Management Program? Your agency head... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What role does my agency play in the Standard and Optional Forms Management Program? 102-194.30 Section 102-194.30 Public...

  13. POLONIUM-194 and the Onset of Collectivity in the Polonium Isotopes.

    Science.gov (United States)

    Younes, Walid

    This dissertation presents the results of the experimental measurement of ^{194}Po , the lightest Polonium isotope studied to date. The systematical behavior of even-A Polonium isotopes down to A = 194 is interpreted within both phenomenological and theoretical frameworks. The heavy-ion reaction ^{28 }Si + ^{170}Yb, was used to form ^{194}Po. The experiment was carried out at the Argonne Tandem-Linac System (ATLAS), which provided a 142 MeV ^ {28}Si ion beam. The Fragment Mass Analyzer (FMA) was used to identify A = 194 recoils. An array of ten Compton-suppressed Ge detectors was used to measure the prompt, in-beam gamma rays. Drawing on a combination of FMA-gamma and FMA-gamma-gamma coincidence data, eight gamma rays were assigned to ^{194}Po and placed in a decay scheme consisting of a six-transition yrast cascade and two non-yrast states. Spin and parity assignments were made based on the systematics of heavier Polonium isotopes. Comparison with the systematics of other nuclei with two valence protons suggests that the onset of collective behavior in these isotopes occurs when both types of valence nucleons occupy high-j orbitals. The underlying mechanism which favors high-j orbitals was explained using naive semiclassical angular overlap arguments. The Particle -Core Model (PCM) was then applied to the Polonium isotopes to isolate the single-particle and vibrational degrees of freedom, and provide a quantitative description of the transition between these extremes. The PCM wavefunctions of low-lying states were found to be pure for A > 198, and increasingly mixed between states with different number of phonons for the lighter isotopes. The Quasiparticle Random Phase Approximation (QRPA) was used to extract the neutron configuration of the PCM phonons. The rapid onset of collectivity for A < 200 could then be explained in terms of the opening of the neutron i_{13/2} orbital and the resulting enhanced overlap with the proton (h _{9/2})^2 configuration. The

  14. Sardinia Radio Telescope observations of Abell 194. The intra-cluster magnetic field power spectrum

    Science.gov (United States)

    Govoni, F.; Murgia, M.; Vacca, V.; Loi, F.; Girardi, M.; Gastaldello, F.; Giovannini, G.; Feretti, L.; Paladino, R.; Carretti, E.; Concu, R.; Melis, A.; Poppi, S.; Valente, G.; Bernardi, G.; Bonafede, A.; Boschin, W.; Brienza, M.; Clarke, T. E.; Colafrancesco, S.; de Gasperin, F.; Eckert, D.; Enßlin, T. A.; Ferrari, C.; Gregorini, L.; Johnston-Hollitt, M.; Junklewitz, H.; Orrù, E.; Parma, P.; Perley, R.; Rossetti, M.; B Taylor, G.; Vazza, F.

    2017-07-01

    Aims: We study the intra-cluster magnetic field in the poor galaxy cluster Abell 194 by complementing radio data, at different frequencies, with data in the optical and X-ray bands. Methods: We analyzed new total intensity and polarization observations of Abell 194 obtained with the Sardinia Radio Telescope (SRT). We used the SRT data in combination with archival Very Large Array observations to derive both the spectral aging and rotation measure (RM) images of the radio galaxies 3C 40A and 3C 40B embedded in Abell 194. To obtain new additional insights into the cluster structure, we investigated the redshifts of 1893 galaxies, resulting in a sample of 143 fiducial cluster members. We analyzed the available ROSAT and Chandra observations to measure the electron density profile of the galaxy cluster. Results: The optical analysis indicates that Abell 194 does not show a major and recent cluster merger, but rather agrees with a scenario of accretion of small groups, mainly along the NE-SW direction. Under the minimum energy assumption, the lifetimes of synchrotron electrons in 3C 40 B measured from the spectral break are found to be 157 ± 11 Myr. The break frequency image and the electron density profile inferred from the X-ray emission are used in combination with the RM data to constrain the intra-cluster magnetic field power spectrum. By assuming a Kolmogorov power-law power spectrum with a minimum scale of fluctuations of Λmin = 1 kpc, we find that the RM data in Abell 194 are well described by a magnetic field with a maximum scale of fluctuations of Λmax = (64 ± 24) kpc. We find a central magnetic field strength of ⟨ B0 ⟩ = (1.5 ± 0.2) μG, which is the lowest ever measured so far in galaxy clusters based on Faraday rotation analysis. Further out, the field decreases with the radius following the gas density to the power of η = 1.1 ± 0.2. Comparing Abell 194 with a small sample of galaxy clusters, there is a hint of a trend between central electron

  15. Identification of miR-194-5p as a potential biomarker for postmenopausal osteoporosis.

    Science.gov (United States)

    Meng, Jia; Zhang, Dapeng; Pan, Nanan; Sun, Ning; Wang, Qiujun; Fan, Jingxue; Zhou, Ping; Zhu, Wenliang; Jiang, Lihong

    2015-01-01

    The incidence of osteoporosis is high in postmenopausal women due to altered estrogen levels and continuous calcium loss that occurs with aging. Recent studies have shown that microRNAs (miRNAs) are involved in the development of osteoporosis. These miRNAs may be used as potential biomarkers to identify women at a high risk for developing the disease. In this study, whole blood samples were collected from 48 postmenopausal Chinese women with osteopenia or osteoporosis and pooled into six groups according to individual T-scores. A miRNA microarray analysis was performed on pooled blood samples to identify potential miRNA biomarkers for postmenopausal osteoporosis. Five miRNAs (miR-130b-3p, -151a-3p, -151b, -194-5p, and -590-5p) were identified in the microarray analysis. These dysregulated miRNAs were subjected to a pathway analysis investigating whether they were involved in regulating osteoporosis-related pathways. Among them, only miR-194-5p was enriched in multiple osteoporosis-related pathways. Enhanced miR-194-5p expression in women with osteoporosis was confirmed by quantitative reverse transcription-polymerase chain reaction analysis. For external validation, a significant correlation between the expression of miR-194-5p and T-scores was found in an independent patient collection comprised of 24 postmenopausal women with normal bone mineral density, 30 postmenopausal women with osteopenia, and 32 postmenopausal women with osteoporosis (p osteoporosis.

  16. Identification of miR-194-5p as a potential biomarker for postmenopausal osteoporosis

    Science.gov (United States)

    Pan, Nanan; Sun, Ning; Wang, Qiujun; Fan, Jingxue; Zhou, Ping

    2015-01-01

    The incidence of osteoporosis is high in postmenopausal women due to altered estrogen levels and continuous calcium loss that occurs with aging. Recent studies have shown that microRNAs (miRNAs) are involved in the development of osteoporosis. These miRNAs may be used as potential biomarkers to identify women at a high risk for developing the disease. In this study, whole blood samples were collected from 48 postmenopausal Chinese women with osteopenia or osteoporosis and pooled into six groups according to individual T-scores. A miRNA microarray analysis was performed on pooled blood samples to identify potential miRNA biomarkers for postmenopausal osteoporosis. Five miRNAs (miR-130b-3p, -151a-3p, -151b, -194-5p, and -590-5p) were identified in the microarray analysis. These dysregulated miRNAs were subjected to a pathway analysis investigating whether they were involved in regulating osteoporosis-related pathways. Among them, only miR-194-5p was enriched in multiple osteoporosis-related pathways. Enhanced miR-194-5p expression in women with osteoporosis was confirmed by quantitative reverse transcription–polymerase chain reaction analysis. For external validation, a significant correlation between the expression of miR-194-5p and T-scores was found in an independent patient collection comprised of 24 postmenopausal women with normal bone mineral density, 30 postmenopausal women with osteopenia, and 32 postmenopausal women with osteoporosis (p osteoporosis. PMID:26038726

  17. 40 CFR Appendix A to Part 194 - Certification of the Waste Isolation Pilot Plant's Compliance With the 40 CFR Part 191 Disposal...

    Science.gov (United States)

    2010-07-01

    ... Pilot Plant's Compliance With the 40 CFR Part 191 Disposal Regulations and the 40 CFR Part 194... ISOLATION PILOT PLANT'S COMPLIANCE WITH THE 40 CFR PART 191 DISPOSAL REGULATIONS Pt. 194, App. A Appendix A to Part 194—Certification of the Waste Isolation Pilot Plant's Compliance With the 40 CFR Part 191...

  18. MicroRNA-194 Regulates Lipopolysaccharide-Induced Cell Viability by Inactivation of Nuclear Factor-κ B Pathway

    Directory of Open Access Journals (Sweden)

    Fei  Xie

    2017-10-01

    Full Text Available The present study explored the functional role of microRNA (miR-194 in lipopolysaccharide (LPS induced lung cell injury, along with the underlying mechanisms and to reveal the potential role in infantile pneumonia. Human fibroblasts WI38 cells were transfected with miR-194 mimic or miR-194 inhibitor, and the transfection efficiency was confirmed by quantitative real-time polymerase chain reaction (qRT-PCR. Thereafter, the cells were treated with or without LPS, and then cell viability, cell apoptosis and mRNA and protein expressions of key proteins of nuclear factor kappa B (NF-κB pathway including inhibitor of NF-κB (IκB α, p-65, and B-cell CLL/lymphoma (Bcl 3 were analyzed. Results showed that overexpression and suppression of miR-194 was effective. Administration of LPS significantly decreased the cell viability and statistically promoted the percentages of apoptotic cells and increased the mRNA and protein expressions of p-65 and Bcl-3 but downregulated IκBα compared to the control group (P < 0.05 or P < 0.01. LPS in combination with miR-194 suppression further enhanced the effects of LPS on cell viability and cell apoptosis compared to the LPS group (P < 0.05. In contrast, LPS in combination with miR-194 overexpression observably reversed the effects of LPS on cell viability, cell apoptosis and mRNA and protein expressions of the key proteins (P < 0.05 or P < 0.01. In conclusion, miR-194 increases the LPS-induced the inhibition of cell viability and increasing of the cell apoptosis by inhibition of NF-κB pathway in WI38 cells. MiR-194 might be a potential targeted therapy for treatment of infantile pneumonia.

  19. Putative use of a Bacillus subtilis L194 strain for biocontrol of Phoma medicaginis in Medicago truncatula seedlings.

    Science.gov (United States)

    Ben Slimene, Imen; Tabbene, Olfa; Djebali, Naceur; Cosette, Pascal; Schmitter, Jean Marie; Jouenne, Thierry; Urdaci, Maria-Camino; Limam, Ferid

    2012-06-01

    An antagonist L194 strain against Phoma medicaginis pathogenic fungi was isolated from Tunisian soil (vicinity of Tunis) and identified as Bacillus subtilis based on biochemical characteristics and partial 16S rDNA sequence. When cells were grown in a minimal medium for 24 h, spore culture supernatant exhibited 2-fold higher antifungal activity than vegetative cells. MALDI-TOF mass spectrometry analysis showed that L194 spores produced mainly iturins, surfactins and fengycins with long-chain fatty acids, and other not yet identified compounds. Both vegetative cells and spores of L194 efficiently reduced germination of P. medicaginis conidia. As revealed by atomic force microscopy, L194 spores modified conidia morphology from a regular to a deflated shape. Data suggest that lipopeptides interacted with the cytoplasmic membrane, causing pore formation. In vivo, L194 spores were highly protective against P. medicaginis by reducing disease symptoms and alleviating growth disturbance of Medicago truncatula seedlings. As a whole, the lipopeptide-producing L194 strain may be successfully used in biocontrol of plant diseases induced by phytopathogenic fungi such as P. medicaginis. Copyright © 2012 Institut Pasteur. Published by Elsevier Masson SAS. All rights reserved.

  20. Alternatives to argon for gas stopping volumes in the B194 neutron imager

    Energy Technology Data Exchange (ETDEWEB)

    Bleuel, D. L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Anderson, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Caggiano, J. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Hall, J. M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Johnson, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ratkiewicz, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Rusnak, B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-05-17

    In a recent experiment at Lawrence Berkeley National Laboratory, the 40Ar(d,p)41Ar excitation function between 3-7 MeV was measured, confirming a previous estimation that there may be an intolerable radiation dose from 41Ar production by slowing to rest 6.74 MeV deuterons in the gas cell of the neutron imaging facility being constructed in B194. Gas alternatives to argon are considered, including helium, nitrogen (N2), neon, sulfur hexafluoride (SF6), krypton, and xenon, as well as high atomic number solid backings such as tantalum.

  1. Modulation of MicroRNA-194 and Cell Migration by HER2-Targeting Trastuzumab in Breast Cancer

    Science.gov (United States)

    Le, Xiao-Feng; Almeida, Maria I.; Mao, Weiqun; Spizzo, Riccardo; Rossi, Simona; Nicoloso, Milena S.; Zhang, Shu; Wu, Yun; Calin, George A.; Bast, Robert C.

    2012-01-01

    Trastuzumab, a humanized monoclonal antibody directed against the extracellular domain of the HER2 oncoprotein, can effectively target HER2-positive breast cancer through several mechanisms. Although the effects of trastuzumab on cancer cell proliferation, angiogenesis and apoptosis have been investigated in depth, the effect of trastuzumab on microRNA (miRNA) has not been extensively studied. We have performed miRNA microarray profiling before and after trastuzumab treatment in SKBr3 and BT474 human breast cancer cells that overexpress HER2. We found that trastuzumab treatment of SKBr3 cells significantly decreased five miRNAs and increased three others, whereas treatment of BT474 cells significantly decreased two miRNAs and increased nine. The only change in miRNA expression observed in both cell lines following trastuzumab treatment was upregulation of miRNA-194 (miR-194) that was further validated in vitro and in vivo. Forced expression of miR-194 in breast cancer cells that overexpress HER2 produced no effect on apoptosis, modest inhibition of proliferation, significant inhibition of cell migration/invasion in vitro and significant inhibition of xenograft growth in vivo. Conversely, knockdown of miR-194 promoted cell migration. Increased miR-194 expression markedly reduced levels of the cytoskeletal protein talin2 and specifically inhibited luciferase reporter activity of a talin2 wild-type 3′-untranslated region, but not that of a mutant reporter, indicating that talin2 is a direct downstream target of miR-194. Trastuzumab treatment inhibited breast cancer cell migration and reduced talin2 expression in vitro and in vivo. Knockdown of talin2 inhibited cell migration/invasion. Knockdown of trastuzumab-induced miR-194 expression with a miR-194 inhibitor compromised trastuzumab-inhibited cell migration in HER2-overexpressing breast cancer cells. Consequently, trastuzumab treatment upregulates miR-194 expression and may exert its cell migration

  2. Effect of Growth Medium on Bacteriocin Production by Lactobacillus plantarum ST194BZ, a Strain Isolated from Boza

    Directory of Open Access Journals (Sweden)

    Svetoslav Dimitrov Todorov

    2005-01-01

    Full Text Available The cell-free supernatant containing bacteriocin ST194BZ, produced by Lactobacillus plantarum ST194BZ, inhibits the growth of Lactobacillus casei, Lactobacillus sakei, Lactobacillus delbrueckii subsp. bulgaricus, Enterococcus faecalis, Escherichia coli, Enterobacter cloacae and Pseudomonas aeruginosa. Strain ST194BZ produces two bacteriocins, viz. ST194BZ(a of 3.3 kDa and ST194BZ(b of 14.0 kDa, based on tricine-SDS-PAGE. Reduction in bacteriocin activity was observed after treatment with proteinase K, trypsin and pronase, but not with catalase and a-amylase. A maximum total bacteriocin activity of 12 800 AU/mL was recorded after 14 h in MRS broth. In MRS broth adjusted to pH=5.5, 6.0 or 6.5, an equal level of bacteriocin production of 12 800 AU/mL was recorded. Optimal production (12 800 AU/ mL was recorded in the presence of tryptone (20 g/L, a combination of tryptone and meat extract (1:0.6, or tryptone and yeast extract (1:0.6. Growth of strain ST194BZ in the presence of 10 or 20 g/L of D-mannose yielded bacteriocin levels of 12 800 AU/mL. In the presence of 30 or 40 g/L of mannose the activity levels doubled to 25 600 AU/mL. No difference in antibacterial activity was recorded when strain ST194BZ was grown in the presence of 2 g/L of K2HPO4 and 2 g/L of KH2PO4. Concentrations of 10, 20 and 50 g/L of KH2PO4 yielded double activity (25 600 AU/mL. Supplementing MRS with 1 g/L or more glycerol inhibited the production of bacteriocin. Growth in the presence of vitamins did not stimulate bacteriocin production. No plasmids were recorded for strain ST194BZ, suggesting that the genes encoding bacteriocin production are located on the genome.

  3. Imunogenicidade da cepa avirulenta RV194-2 do vírus rábico em camundongos

    Directory of Open Access Journals (Sweden)

    Rugimar Marcovistz

    1996-12-01

    Full Text Available O vírus rábico RV194-2, uma variante avirulenta da cepa CVS (Challenge Vírus Standard, produz uma infecção inaparente quando inoculado intracerebralmente em camundongos adultos. Sugerindo que a resposta imunológica do hospedeiro permite a eliminação do vírus do sistema nervoso central. Por esta razão foram estudadas a indução de interferon e a resposta imune humoral em camundongos BALB/c inoculados com vírus RV194-2. Durante a infecção, estes camundongos apresentaram elevados níveis de interferon no plasma e no cérebro com altos títulos de anticorpos neutralizantes anti-rábicos. A 2-5A sintetase. um marcador da ação dos interferons,foi também analisada no cérebro destes animais. Sua atividade, aumentou, paralelamente, á produção de interferon, demonstrando que este interferon é bioquímicamente ativo. O vírus RV194-2 também induziu, 45 dias após sua inoculação, proteção aos animais quando desafiados com a cepa virulenta CVS. Estes resultados demonstram que a cepa RV194-2possui um alto nível imunogênico.RV194-2 rabies virus, an avirulent mutant of CVS strain, induces an inapparent infection limited to the central nervous system (CNS in adult mice inoculated intracerebrally. This fact suggest that immune response of the host is able to eliminate the virus in CNS. For this reason, we have studied the induction of interferon and the humoral immune responses in BALB/c mice after RV194-2 inoculation. These mice presented high levels of interferon in the plasma and in the brain, with elevated levels of neutralizing antirabies antibodies. The 2-5A synthetase, an enzyme marker of interferon action, was analyzed in the brain of inoculated animals. Its enhancement in parallel to the interferon production in the brain, showed biochemical evidence that this interferon is active. Forty five days after RV194-2 virus inoculation, mice were protected against a challenge with the CVS virulent strain. The results presented

  4. 20 CFR 1002.194 - Can the application of the escalator principle result in adverse consequences when the employee...

    Science.gov (United States)

    2010-04-01

    ... or lower position, laid off, or even terminated. For example, if an employee's seniority or job... Reemployment Rights and Benefits Reemployment Position § 1002.194 Can the application of the escalator... lawful adverse job consequences that result from the employee's restoration on the seniority ladder...

  5. Primary transitions between the yrast superdeformed band and low-lying normal deformed states in {sup 194}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Hauschild, K.; Bernstein, L.A.; Becker, J.A. [Lawrence Livermore National Lab., CA (United States)] [and others

    1996-12-31

    The observation of one-step `primary` gamma-ray transitions directly linking the superdeformed (SD) states to the normal deformed (ND) low-lying states of known excitation energies (E{sub x}), spins and parities (J{sup {pi}}) is crucial to determining the E{sub x} and J{sup {pi}} of the SD states. With this knowledge one can begin to address some of the outstanding problems associated with SD nuclei, such as the identical band issue, and one can also place more stringent restrictions on theoretical calculations which predict SD states and their properties. Brinkman, et al., used the early implementation of the GAMMASPHERE spectrometer array (32 detectors) and proposed a single, candidate {gamma} ray linking the {sup 194}Pb yrast SD band to the low-lying ND states in {sup 194}Pb. Using 55 detectors in the GAMMASPHERE array Khoo, et al., observed multiple links between the yrast SD band in {sup 194}Hg and the low-lying level scheme and conclusively determined E{sub x} and J of the yrast SD states. Here the authors report on an experiment in which Gammasphere with 88 detectors was used and the E{sub x} and J{sup {pi}} values of the yrast SD states in {sup 194}Pb were uniquely determined. Twelve one-step linking transitions between the yrast SD band and low-lying states in {sup 194}Pb have been identified, including the transition proposed by Brinkman. These transitions have been placed in the level scheme of {sup 194}Pb using coincidence relationships and agreements between the energies of the primary transitions and the energy differences in level spacings. Furthermore, measurements of angular asymmetries have yielded the multipolarities of the primaries which have allowed J{sup {pi}} assignments of the {sup 194}Pb SD states to be unambiguously determined for the first time without a priori assumptions about the character of SD bands. A study performed in parallel to this work using the EUROGAM-II array reports similar, but somewhat less extensive, results.

  6. About the nature of competing interactions in cerium based 1-9-4 compounds; Ueber die Natur konkurrierender Wechselwirkungen in Cer-basierten 1-9-4 Verbindungen

    Energy Technology Data Exchange (ETDEWEB)

    Gold, Christian

    2014-02-04

    In addition to the high-temperature superconductors, the so-called heavy fermion systems are among the most fascinating representatives of strongly correlated electron systems. Caused by the competition of Kondo effect, RKKY interaction and electrostatic crystal field effects these compounds reveal a wide variety of different ground state properties. For example, many of these systems are located in the vicinity of a magnetic instability. At such a quantum critical point a continuous transition between two states with different symmetry occurs at absolute zero temperature. Apart from the three classic tuning parameters (i) chemical substitution, (ii) hydrostatic pressure, and (iii) external magnetic field also the reduction of the effective spin degeneracy N, i.e. the reduction of the number of crystal field levels which are shielded by the Kondo effect seems to induce quantum critical behavior. The proximity to a quantum critical point together with an unusually high effective spin degeneracy of N=4 make the ternary 1-9-4 compound CeNi{sub 9}Ge{sub 4} the perfect starting system for experimental studies of this new parameter. For the first and so far only time such a scenario could be observed in the substitution series CeNi{sub 9-x}Cu{sub x}Ge{sub 4} (0≤x≤1). Extensive studies show that in this system quantum criticality is not only caused by the balance between Kondo effect and RKKY interaction but also by a reduction of the effective spin degeneracy. The results on the copper series provided the incentive to synthesize and analyze related systems with regard to quantum criticality in the scope of this work. The focus here was on the systems CeNi{sub 9}Ge{sub 4-x}Si{sub x}, CeNi{sub 9}Ge{sub 4-x}Ga{sub x}, CeNi{sub 9-x}Fe{sub x}Ge{sub 4} and CeNi{sub 9-x}Co{sub x}Ge{sub 4}. This thesis was methodologically supported by X-ray studies, theoretical LDA+U calculations and extensive thermodynamic and magnetic investigations on the macroscopic and microscopic

  7. p194ar.m77t and p194ar.h77t: MGD77T data and header files for single-beam bathymetry data for field activity P-1-94-AR in Arctic Ocean from 07/25/1994 to 08/30/1994

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with SINS navigation data was collected as part of the U.S. Geological Survey cruise P-1-94-AR. The cruise was conducted in...

  8. a194yb.m77t and a194yb.h77t: MGD77T data and header files for single-beam bathymetry for field activity A-1-94-YB in Yakutat Bay and Yakutat Sea Valley, Alaska from 08/05/1994 to 08/08/1994

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with GPS navigation data was collected as part of the U.S. Geological Survey cruise A-1-94-YB. The cruise was conducted in Yakutat...

  9. k194hw.m77t and k194hw.h77t: MGD77T data and header files for single-beam bathymetry data for field activity K-1-94-HW in Mamala Bay, Offshore Honolulu, Oahu, Hawaii from 05/10/1994 to 05/16/1994

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of the U.S. Geological Survey cruise K-1-94-HW. The cruise was conducted in Oahu,...

  10. a194gb.m77t and a194gb.h77t: MGD77T data and header files for single-beam bathymetry data for field activity A-1-94-GB in Prince William Sound, Yakutat Bay, Glacier Bay and Icy Strait, Alaska from 08/08/1994 to 08/17/1994

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with GPS navigation data was collected as part of the U.S. Geological Survey cruise A-1-94-GB. The cruise was conducted in Prince...

  11. Extrapulmonary tuberculosis: a retrospective review of 194 cases at a tertiary care hospital in Karachi, Pakistan.

    Science.gov (United States)

    Chandir, Subhash; Chandir, Subash; Hussain, Hamidah; Salahuddin, Naseem; Amir, Mohammad; Ali, Farheen; Lotia, Ismat; Khan, Amir Javed

    2010-02-01

    To describe the types and treatment outcomes of the extra-pulmonary tuberculosis (EPTB) cases in a tertiary care hospital in a high burden tuberculosis country. A retrospective case series study was conducted at Liaquat National Hospital (LNH), the largest private tertiary care hospital in Karachi, Pakistan. All cases diagnosed and treated as EPTB between November 2005 and February 2007 were included. Data was retrieved from medical records on demographics, clinical, laboratory, and outcome status. A total of 194 patients treated for EPTB were identified. Mean age of patients was 34 +/- 16.4 years, and 75% of patients were female. Lymph nodes and spine were the most common sites involved (60%). The cure rate was 40.7%. There was no difference in cure rate of males and females (p=0.99). EPTB is an important clinical problem in Pakistan. Due to lack of guidelines for diagnosis and duration of treatment in EPTB most physicians in Pakistan treat patients based on clinical symptoms and for prolonged duration of 12, to even as long as 24 months. The National TB Program, and chest and infectious disease societies must develop standardized guidelines for the diagnosis and treatment of EPTB.

  12. Diterpenoids from Streptomyces sp. SN194 and Their Antifungal Activity against Botrytis cinerea.

    Science.gov (United States)

    Bi, Yuhui; Yu, Zhiguo

    2016-11-16

    Botrytis cinerea is a serious phytopathogen affecting a wide range of crops around the world. Many fungicides targeting Botrytis cinerea have failed due to the pathogen's genetic plasticity. In an effort to search for new fungicides from natural products, two new diterpenoids, named chloroxaloterpin A, 1, and B, 2, were isolated from culture broth of Streptomyces sp. SN194 along with four known diterpenoids, viguiepinol, 3, and oxaloterpins C-E, 4-6. Their structures were elucidated based on extensive MS, NMR, and X-ray crystallography analyses. Both the [(2-chlorophenyl)amino]carbonyl carbanic acyl group in 1 and the 2-[(2-chlorophenyl)amino]-2-oxo-acetyl group in 2 are discovered in natural products for the first time. All six compounds were tested against Botrytis cinerea, and chloroxaloterpin A, 1, and B, 2, demonstrated strong inhibitory activity against spore germination with EC50 of 4.40 and 4.96 μg/mL, respectively.

  13. Overexpression of OsCYP19-4 increases tolerance to cold stress and enhances grain yield in rice (Oryza sativa).

    Science.gov (United States)

    Yoon, Dae Hwa; Lee, Sang Sook; Park, Hyun Ji; Lyu, Jae Il; Chong, Won Seog; Liu, Jang Ryol; Kim, Beom-Gi; Ahn, Jun Cheul; Cho, Hye Sun

    2016-01-01

    AtCYP19-4 (also known as CYP5) was previously identified as interacting in vitro with GNOM, a member of a large family of ARF guanine nucleotide exchange factors that is required for proper polar localization of the auxin efflux carrier PIN1. The present study demonstrated that OsCYP19-4, a gene encoding a putative homologue of AtCYP19-4, was up-regulated by several stresses and showed over 10-fold up-regulation in response to cold. The study further demonstrated that the promoter of OsCYP19-4 was activated in response to cold stress. An OsCYP19-4-GFP fusion protein was targeted to the outside of the plasma membrane via the endoplasmic reticulum as determined using brefeldin A, a vesicle trafficking inhibitor. An in vitro assay with a synthetic substrate oligomer confirmed that OsCYP19-4 had peptidyl-prolyl cis-trans isomerase activity, as was previously reported for AtCYP19-4. Rice plants overexpressing OsCYP19-4 showed cold-resistance phenotypes with significantly increased tiller and spike numbers, and consequently enhanced grain weight, compared with wild-type plants. Based on these results, the authors suggest that OsCYP19-4 is required for developmental acclimation to environmental stresses, especially cold. Furthermore, the results point to the potential of manipulating OsCYP19-4 expression to enhance cold tolerance or to increase biomass. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  14. Accretion Flow Dynamics of MAXI J1836-194 During Its 2011 Outburst from TCAF Solution

    Science.gov (United States)

    Jana, Arghajit; Debnath, Dipak; Chakrabarti, Sandip K.; Mondal, Santanu; Molla, Aslam Ali

    2016-03-01

    The Galactic transient X-ray binary MAXI J1836-194 was discovered on 2011 August 29. Here we make a detailed study of the spectral and timing properties of its 2011 outburst using archival data from the RXTE Proportional Counter Array instrument. The evolution of accretion flow dynamics of the source during the outburst through spectral analysis with Chakrabarti-Titarchuk’s two-component advective flow (TCAF) solution as a local table model in XSPEC. We also fitted spectra with combined disk blackbody and power-law models and compared it with the TCAF model fitted results. The source is found to be in hard and hard-intermediate spectral states only during the entire phase of this outburst. No soft or soft-intermediate spectral states are observed. This could be due to the fact that this object belongs to a special class of sources (e.g., MAXI J1659-152, Swift J1753.5-0127, etc.) that have very short orbital periods and that the companion is profusely mass-losing or the disk is immersed inside an excretion disk. In these cases, flows in the accretion disk are primarily dominated by low viscous sub-Keplerian flow and the Keplerian rate is not high enough to initiate softer states. Low-frequency quasi-periodic oscillations (QPOs) are observed sporadically although as in normal outbursts of transient black holes, monotonic evolutions of QPO frequency during both rising and declining phases are observed. From the TCAF fits, we find the mass of the black hole in the range of 7.5-11 M⊙, and from time differences between peaks of the Keplerian and sub-Keplerian accretion rates we obtain a viscous timescale for this particular outburst, ˜10 days.

  15. XRCC1 Arg194Trp and Arg399Gln polymorphisms and arsenic methylation capacity are associated with urothelial carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Chiang, Chien-I [School of Public Health, College of Public Health and Nutrition, Taipei Medical University, Taipei, Taiwan (China); Huang, Ya-Li [Department of Public Health, School of Medicine, College of Medicine, Taipei Medical University, Taipei, Taiwan (China); Chen, Wei-Jen [School of Public Health, College of Public Health and Nutrition, Taipei Medical University, Taipei, Taiwan (China); Shiue, Horng-Sheng [Department of Chinese Medicine, Chang Gung Memorial Hospital and Chang Gung University College of Medicine, Taoyuan, Taiwan (China); Huang, Chao-Yuan; Pu, Yeong-Shiau [Department of Urology, National Taiwan University Hospital, College of Medicine National Taiwan University, Taipei, Taiwan (China); Lin, Ying-Chin [Department of Family Medicine, Shung Ho Hospital, Taipei Medical University, New Taipei, Taiwan (China); Department of Health Examination, Wan Fang Hospital, Taipei Medical University, Taipei, Taiwan (China); Division of Family Medicine, School of Medicine, Taipei Medical University, Taipei, Taiwan (China); Hsueh, Yu-Mei, E-mail: ymhsueh@tmu.edu.tw [School of Public Health, College of Public Health and Nutrition, Taipei Medical University, Taipei, Taiwan (China); Department of Public Health, School of Medicine, College of Medicine, Taipei Medical University, Taipei, Taiwan (China)

    2014-09-15

    The association between DNA repair gene polymorphisms and bladder cancer has been widely studied. However, few studies have examined the correlation between urothelial carcinoma (UC) and arsenic or its metabolites. The aim of this study was to examine the association between polymorphisms of the DNA repair genes, XRCC1 Arg194Trp, XRCC1 Arg399Gln, XRCC3 Thr241Met, and XPD Lys751Gln, with urinary arsenic profiles and UC. To this end, we conducted a hospital-based case–control study with 324 UC patients and 647 age- and gender-matched non-cancer controls. Genomic DNA was used to examine the genotype of XRCC1 Arg194Trp, XRCC1 Arg399Gln, XRCC3 Thr241Met, and XPD Lys751Gln by PCR-restriction fragment length polymorphism analysis (PCR-RFLP). Urinary arsenic profiles were measured by high performance liquid chromatography (HPLC) linked with hydride generator and atomic absorption spectrometry. The XRCC1 399 Gln/Gln and 194 Arg/Trp and Trp/Trp genotypes were significantly related to UC, and the odds ratio (OR) and 95% confidence interval (95%CI) were 1.68 (1.03–2.75) and 0.66 (0.48–0.90), respectively. Participants with higher total urinary arsenic levels, a higher percentage of inorganic arsenic (InAs%) and a lower percentage of dimethylarsinic acid (DMA%) had a higher OR of UC. Participants carrying XRCC1 risk diplotypes G-C/G-C, A-C/A-C, and A-T/G-T, and who had higher total arsenic levels, higher InAs%, or lower DMA% compared to those with other XRCC1 diplotypes had a higher OR of UC. Our results suggest that the XRCC1 399 Gln/Gln and 194 Arg/Arg DNA repair genes play an important role in poor arsenic methylation capacity, thereby increasing the risk of UC in non-obvious arsenic exposure areas. - Highlights: • The XRCC1 399Gln/Gln genotype was significantly associated with increased OR of UC. • The XRCC1 194 Arg/Trp and Trp/Trp genotype had a significantly decreased OR of UC. • Combined effect of the XRCC1 genotypes and poor arsenic methylation capacity on

  16. Sexual satisfaction assessment in 194 nonmetastatic cancer patients on treatment or in follow-up.

    Science.gov (United States)

    Maruelli, Alice; Ripamonti, Carla; Bandieri, Elena; Miccinesi, Guido; Pessi, Maria Adelaide; Buonaccorso, Loredana

    2014-01-01

    Sexuality is an important aspect of quality of life, but health care professionals still avoid discussing sexual issues with cancer patients. We present a secondary analysis of sexuality issues according to the results of a survey on 266 patients with early-stage cancer. The aim of the survey was to ascertain the feasibility and clinical usefulness of questionnaires (Patient Dignity Inventory, PDI; Hospital Anxiety and Depression Scale, HADS; Edmonton Symptom Assesssment Scale, ESAS; FACIT-spiritual well-being scale, FACIT-SP; System of Belief Inventory, SBI-15R) investigating aspects such as dignity, hope and research of meaning in life. The present study is an ancillary analysis of the full sample, and we have focused on the results of FACIT-SP about the correlation between sexual satisfaction and clinical characteristics in 108 patients having solid tumors and 86 having hematological malignancies with no metastases who were on active cancer treatment or in follow-up in four different cancer treatment settings during the first half of 2011. The median age of the 194 patients was 65 years, 112 were women, 155 were undergoing treatment and 39 were in follow-up. Eighty-three patients were above the cutoff score for HADS. Among the 171 believers, 80 were churchgoers and 91 were nonchurchgoers, whereas the nonbelievers among the patients were 23. Thirty-five percent of the patients did not respond to the sexuality item of the questionnaire. Among the responders (n = 126), 36% reported having no sexual satisfaction (score = 0). Sexual dissatisfaction was greater in older patients (47% vs 31%, not significant [NS]), women (43% vs 27%, NS), patients on treatment (38% vs 25%, NS), patients who requested psychological support (53% vs 25%, P = 0.001), patients with high levels of anxiety and depression, i.e., HADS scores >10 (44% vs 30%, NS), nonbelievers (61% vs 34% among churchgoers, 29% among believers but nonchurchgoers, P = 0.046). One out of 3 patients did not respond

  17. Criteria for the Certification and Recertification of the Waste Isolation Pilot Plant's Compliance with the 40 CFR Part 191 Disposal Regulations (40 CFR Part 194)

    Science.gov (United States)

    EPA is responsible for certifying that DOE’s Waste Isolation Pilot Plant (WIPP) remains in compliance with environmental standards for the disposal of transuranic waste. 40 CFR Part 194 specifies criteria for certification or recertification of WIPP.

  18. Spin manipulation of 1.94  GeV/c polarized protons stored in the COSY cooler synchrotron

    Directory of Open Access Journals (Sweden)

    V. S. Morozov

    2004-02-01

    Full Text Available We recently studied spin flipping of a 1.94  GeV/c vertically polarized proton beam at COSY in Jülich, Germany. We swept an rf-dipole’s frequency through an rf-induced spin resonance to flip the beam’s polarization direction. After determining the resonance’s frequency, we varied the dipole’s strength, frequency range, and frequency ramp time. At the rf-dipole’s maximum strength, and optimum frequency range and ramp time, we measured a spin-flip efficiency of 99.3%±0.1%. This result indicates that an rf dipole may allow efficient spin flipping in high energy proton rings.

  19. "O terque quaterque beati" ('Aen.' 1.94. Aperçu d’une lecture séculaire

    Directory of Open Access Journals (Sweden)

    Filippo Bognini

    2017-06-01

    Full Text Available After Birger Munk Olsen's great and precious work about the manuscripts of classical auctores from the eleventh and twelfth centuries, the bulk of the glosses on the classics from the age of the so-called 'twelfth-century Renaissance' remains unpublished and lacking proper surveys, thus deserving attention. A small but intriguing piece of this enormous puzzle can be seen in the different paths followed through the centuries by the glosses on Aen. 1.94, which includes the first words of Eneas in the poem: "O terque quaterque beati." From the twelfth century onwards these words began to receive an allegorical interpretation, tied to the numbers 3 and 4, which is probably connected with the gloss of Guillaume de Conches on Macrobius' quotation of the Virgilian verse itself (Comm. 1.6.44. Only in the fourteenth and fifteenth centuries did awareness about different roots of the Virgilian numbers begin (e.g. Hom. Od. 5.306.

  20. Determination of effective resonance energy for the 193Ir(n,γ)194Ir reaction by the cadmium ratio method

    Science.gov (United States)

    Budak, Mustafa Guray; Karadag, Mustafa; Yücel, Haluk

    2016-04-01

    In this work, the effective resonance energy, Ebarr -value for the 193Ir(n,γ)194Ir reaction was measured using cadmium ratio method. A dual monitor (197Au-98Mo), which has convenient resonance properties, was employed for characterization of the irradiation sites. Then analytical grade iridium oxide samples diluted with CaCO3 to lower neutron self-shielding effect stacked in small cylindrical Teflon boxes were irradiated once with a 1 mm thick Cd cylindrical box placed in a thermalized neutron field of an 241Am-Be neutron source then without it. The activities produced in samples during 193Ir(n,γ)194Ir reaction were measured using a p-type HPGe detector γ-ray spectrometer with a 44.8% relative efficiency. The correction factors for thermal, epithermal neutron self-shielding (Gth, Gepi), true coincidence summing (Fcoi) and gamma-ray self-absorption (Fs) effects were determined with appropriate approaches and programs. Thus, the experimental Ebarr -value was determined to be 2.65 ± 0.61 eV for 193Ir target nuclide. The recent data for Q0 and FCd values for Ebarr determination were based on k0-NAA online database. The present experimental Ebarr value was calculated and compared with more recent values for Q0 and FCd for 193Ir. Additionally, the Ebarr -values was theoretically calculated from the up-to-date resonance data obtained from ENDF/B VII library using two different approaches. Since there is no experimentally determined Ebarr -value for the 193Ir isotope, the results are compared with the calculated ones given in the literature.

  1. XRCC1 genetic polymorphism Arg339Gln, Arg194Trp, Arg280His and gastric cancer risk: an evidence based decision.

    Science.gov (United States)

    Zhao, Dong-Yu; Cheng, LiYa; Yu, Jian; Shen, Hong

    2014-01-01

    The purpose of this study is to investigate the associations of the x-ray repair cross-complementing 1 gene (XRCC1) single nucleotide polymorphisms (SNPs) Arg194Trp, Arg280His, and Arg399Gln with gastric cancer risk. The PubMed, Embase, Cochrane Central Register of Controlled Trials, Google Scholar, CINAHL, International Bibliography of the Social Sciences, and Social Sciences Citation Index were searched. Two authors independently searched for relevant studies in any language from 1966 to Jan 2013. Seventeen studies with a total population of 10427 participants were identified. The results showed there were no associations of Arg399Gln polymorphism with gastric cancer, no matter in the co-dominant model, dominant model or recessive model. For Arg194Trp and Arg280His polymorphism, still no significant differences were found between control groups and GC groups in samples regardless of race. However, significant associations between Arg194Trp polymorphism and gastric cancer were found in Asian. The Asia with mutant genotype (Trp/Trp+Arg/Trp) had a higher risk of GC compared with the Asian with wild genotype (Arg/Arg). Our meta-analysis indicates that genetic polymorphism of the XRCC1 Arg399Gln and Arg280His do not have an association with gastric cancer risk. However, for Arg194Trp polymorphism, mutant gene carriers had a higher GC risk in Asian.

  2. LncRNA NEAT1 contributes to paclitaxel resistance of ovarian cancer cells by regulating ZEB1 expression via miR-194

    Directory of Open Access Journals (Sweden)

    An J

    2017-11-01

    Full Text Available Jihong An,* Weiling Lv,* Yongzhou Zhang Department of Clinical Pharmacy, Huaihe Hospital of Henan University, Kaifeng, People’s Republic of China *These authors contributed equally to this work Background: Chemoresistance is one of the major obstacles for cancer therapy in the clinic. Nuclear paraspeckle assembly transcript 1 (NEAT1 has been reported as an oncogene in most malignancies such as lung cancer, esophageal cancer, and gastric cancer. This study is designed to investigate the function of NEAT1 in paclitaxel (PTX resistance of ovarian cancer and its potential molecular mechanism. Patients and methods: The expressions of NEAT1 and miR-194 in ovarian cancer tissues and cells were estimated by quantitative real-time polymerase chain reaction (qRT-PCR. MTT, flow cytometry, and Western blot assays were used to assess the effect of NEAT1 on PTX resistance in PTX-resistant ovarian cancer cells. Luciferase reporter assay was applied to examine the association between NEAT1, zinc finger E-box-binding homeobox 1 (ZEB1 and miR-194. Xenograft tumor model was established to confirm the biological role of NEAT1 in PTX resistance of ovarian cancer in vivo. Results: NEAT1 was upregulated, and miR-194 was downregulated in PTX-resistant ovarian cancer tissues and cells. Functionally, NEAT1 knockdown enhanced cell sensitivity to PTX via promoting PTX-induced apoptosis in vitro. NEAT1 was identified as a molecular sponge of miR-194 to upregulate ZEB1 expression. Mechanistically, NEAT1-knockdown-induced PTX sensitivity was mediated by miR-194/ZEB1 axis. Moreover, NEAT1 knockdown improved PTX sensitivity of ovarian cancer in vivo. Conclusion: NEAT1 contributed to PTX resistance of ovarian cancer cells at least partly through upregulating ZEB1 expression by sponging miR-194, elucidating a novel regulatory pathway of chemoresistance in PTX-resistant ovarian cancer cells and providing a possible long noncoding RNA (lncRNA-targeted therapy for ovarian cancer

  3. Mode-locked, 1.94-μm, all-fiberized laser using WS₂ based evanescent field interaction.

    Science.gov (United States)

    Jung, Minwan; Lee, Junsu; Park, June; Koo, Joonhoi; Jhon, Young Min; Lee, Ju Han

    2015-07-27

    We demonstrate the use of an all-fiberized, mode-locked 1.94 μm laser with a saturable absorption device based on a tungsten disulfide (WS2)-deposited side-polished fiber. The WS2 particles were prepared via liquid phase exfoliation (LPE) without centrifugation. A series of measurements including Raman spectroscopy, scanning electron microscopy (SEM), and atomic force microscopy (AFM) revealed that the prepared particles had thick nanostructures of more than 5 layers. The prepared saturable absorption device used the evanescent field interaction mechanism between the oscillating beam and WS2 particles and its modulation depth was measured to be ~10.9% at a wavelength of 1925 nm. Incorporating the WS2-based saturable absorption device into a thulium-holmium co-doped fiber ring cavity, stable mode-locked pulses with a temporal width of ~1.3 ps at a repetition rate of 34.8 MHz were readily obtained at a wavelength of 1941 nm. The results of this experiment confirm that WS2 can be used as an effective broadband saturable absorption material that is suitable to passively generate pulses at 2 μm wavelengths.

  4. Laser stimulation of the auditory system at 1.94 μm and microsecond pulse durations

    Science.gov (United States)

    Izzo, Agnella D.; Walsh, Joseph T., Jr.; Ralph, Heather; Webb, Jim; Wells, Jonathon; Bendett, Mark; Richter, Claus-Peter

    2008-02-01

    Light can artificially stimulate nerve activity in vivo. A significant advantage of optical neural stimulation is the potential for higher spatial selectivity when compared with electrical stimulation. An increased spatial selectivity of stimulation could improve significantly the function of neuroprosthetics, such as cochlear implants. Cochlear implants restore a sense of hearing and communication to deaf individuals by directly electrically stimulating the remaining neural cells in the cochlea. However, performance is limited by overlapping electric fields from neighboring electrodes. Here, we report on experiments with a new laser, offering a previously unavailable wavelength, 1.94μm, and pulse durations down to 5μs, to stimulate cochlear neurons. Compound action potentials (CAP) were evoked from the gerbil cochlea with pulse durations as short as 1μs. Data show that water absorption of light is a significant factor in optical stimulation, as evidenced by the required distance between the optical fiber and the neurons during stimulation. CAP threshold measurements indicate that there is an optimal range of pulse durations over which to deposit the laser energy, less than ~100μs. The implications of these data could direct further research and design of an optical cochlear implant.

  5. AN EVOLVING COMPACT JET IN THE BLACK HOLE X-RAY BINARY MAXI J1836-194

    Energy Technology Data Exchange (ETDEWEB)

    Russell, D. M. [Instituto de Astrofisica de Canarias (IAC), E-38200 La Laguna, Tenerife (Spain); Russell, T. D.; Miller-Jones, J. C. A.; Soria, R.; Slaven-Blair, T.; Curran, P. A. [International Centre for Radio Astronomy Research, Curtin University, GPO Box U1987, Perth, WA 6845 (Australia); O' Brien, K. [Department of Astrophysics, University of Oxford, Keble Road, Oxford OX1 3RH (United Kingdom); Sivakoff, G. R. [Department of Physics, University of Alberta, CCIS 4-181, Edmonton, AB T6G 2E1 (Canada); Lewis, F. [Faulkes Telescope Project, University of Glamorgan, Pontypridd CF37 1DL (United Kingdom); Markoff, S.; Altamirano, D. [Astronomical Institute ' ' Anton Pannekoek' ' , University of Amsterdam, P.O. Box 94249, 1090 GE Amsterdam (Netherlands); Homan, J. [MIT Kavli Institute for Astrophysics and Space Research, 70 Vassar Street, Cambridge, MA 02139 (United States); Rupen, M. P.; Dhawan, V. [NRAO Domenici Science Operations Center, 1003 Lopezville Road, Socorro, NM 87801 (United States); Belloni, T. M. [INAF - Osservatorio Astronomico di Brera, Via E. Bianchi 46, I-23807 Merate (Italy); Cadolle Bel, M. [European Space Agency, European Space Astronomy Centre, ISOC, Villanueva de la Canada, Madrid (Spain); Casella, P. [INAF - Osservatorio Astronomico di Roma, Via Frascati 33, I-00040 Monteporzio Catone, Roma (Italy); Corbel, S. [Laboratoire AIM, UMR 7158, CEA/DSM, CNRS, Universite Paris Diderot, IRFU/SAp, Gif-sur-Yvette (France); Fender, R. P. [School of Physics and Astronomy, University of Southampton, Southampton, Hampshire SO17 1BJ (United Kingdom); Gallo, E., E-mail: russell@iac.es [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48109 (United States); and others

    2013-05-10

    We report striking changes in the broadband spectrum of the compact jet of the black hole transient MAXI J1836-194 over state transitions during its discovery outburst in 2011. A fading of the optical-infrared (IR) flux occurred as the source entered the hard-intermediate state, followed by a brightening as it returned to the hard state. The optical-IR spectrum was consistent with a power law from optically thin synchrotron emission, except when the X-ray spectrum was softest. By fitting the radio to optical spectra with a broken power law, we constrain the frequency and flux of the optically thick/thin break in the jet synchrotron spectrum. The break gradually shifted to higher frequencies as the source hardened at X-ray energies, from {approx}10{sup 11} to {approx}4 Multiplication-Sign 10{sup 13} Hz. The radiative jet luminosity integrated over the spectrum appeared to be greatest when the source entered the hard state during the outburst decay (although this is dependent on the high-energy cooling break, which is not seen directly), even though the radio flux was fading at the time. The physical process responsible for suppressing and reactivating the jet (neither of which are instantaneous but occur on timescales of weeks) is uncertain, but could arise from the varying inner accretion disk radius regulating the fraction of accreting matter that is channeled into the jet. This provides an unprecedented insight into the connection between inflow and outflow, and has implications for the conditions required for jets to be produced, and hence their launching process.

  6. An Evolving Compact Jet in the Black Hole X-Ray Binary Maxi J1836-194

    Science.gov (United States)

    Russell, D. M.; Russell, T. D.; Miller-Jones, J. C. A.; O'Brien, K.; Soria, R.; Sivakoff, G. R.; Slaven-Blair, T.; Lewis, F.; Markoff, S.; Homan, J.; hide

    2013-01-01

    We report striking changes in the broadband spectrum of the compact jet of the black hole transient MAXI J1836-194 over state transitions during its discovery outburst in 2011. A fading of the optical-infrared (IR) flux occurred as the source entered the hard-intermediate state, followed by a brightening as it returned to the hard state. The optical-IR spectrum was consistent with a power law from optically thin synchrotron emission, except when the X-ray spectrum was softest. By fitting the radio to optical spectra with a broken power law, we constrain the frequency and flux of the optically thick/thin break in the jet synchrotron spectrum. The break gradually shifted to higher frequencies as the source hardened at X-ray energies, from approx 10(exp 11) to approx 4 × 10(exp 13) Hz. The radiative jet luminosity integrated over the spectrum appeared to be greatest when the source entered the hard state during the outburst decay (although this is dependent on the high-energy cooling break, which is not seen directly), even though the radio flux was fading at the time. The physical process responsible for suppressing and reactivating the jet (neither of which are instantaneous but occur on timescales of weeks) is uncertain, but could arise from the varying inner accretion disk radius regulating the fraction of accreting matter that is channeled into the jet. This provides an unprecedented insight into the connection between inflow and outflow, and has implications for the conditions required for jets to be produced, and hence their launching process.

  7. ACCRETION FLOW DYNAMICS OF MAXI J1836-194 DURING ITS 2011 OUTBURST FROM TCAF SOLUTION

    Energy Technology Data Exchange (ETDEWEB)

    Jana, Arghajit; Debnath, Dipak; Chakrabarti, Sandip K.; Mondal, Santanu; Molla, Aslam Ali, E-mail: argha@csp.res.in, E-mail: dipak@csp.res.in, E-mail: chakraba@bose.res.in, E-mail: santanu@csp.res.in, E-mail: aslam@csp.res.in [Indian Center for Space Physics, 43 Chalantika, Garia St. Rd., Kolkata, 700084 (India)

    2016-03-20

    The Galactic transient X-ray binary MAXI J1836-194 was discovered on 2011 August 29. Here we make a detailed study of the spectral and timing properties of its 2011 outburst using archival data from the RXTE Proportional Counter Array instrument. The evolution of accretion flow dynamics of the source during the outburst through spectral analysis with Chakrabarti–Titarchuk’s two-component advective flow (TCAF) solution as a local table model in XSPEC. We also fitted spectra with combined disk blackbody and power-law models and compared it with the TCAF model fitted results. The source is found to be in hard and hard-intermediate spectral states only during the entire phase of this outburst. No soft or soft-intermediate spectral states are observed. This could be due to the fact that this object belongs to a special class of sources (e.g., MAXI J1659-152, Swift J1753.5-0127, etc.) that have very short orbital periods and that the companion is profusely mass-losing or the disk is immersed inside an excretion disk. In these cases, flows in the accretion disk are primarily dominated by low viscous sub-Keplerian flow and the Keplerian rate is not high enough to initiate softer states. Low-frequency quasi-periodic oscillations (QPOs) are observed sporadically although as in normal outbursts of transient black holes, monotonic evolutions of QPO frequency during both rising and declining phases are observed. From the TCAF fits, we find the mass of the black hole in the range of 7.5–11 M{sub ⊙}, and from time differences between peaks of the Keplerian and sub-Keplerian accretion rates we obtain a viscous timescale for this particular outburst, ∼10 days.

  8. Asymmetry Measurement in the Elastic Pion-Proton Scattering at 1.94 and 2.07 GeV/c

    Science.gov (United States)

    Alekseev, I. G.; Bazhanov, N. A.; Beloglazov, Yu. A.; Budkovsky, P. E.; Bunyatova, E. I.; Filimonov, E. A.; Kanavets, V. P.; Koroleva, L. I.; Kovalev, A. I.; Kruglov, S. P.; Morozov, B. V.; Nesterov, V. M.; Novinsky, D. V.; Ryltsov, V. V.; Shchedrov, V. A.; Sulimov, A. D.; Sumachev, V. V.; Svirida, D. N.; Trautman, V. Yu.; Zhurkin, V. V.; Zolin, L. S.

    2007-06-01

    Latest results by the ITEP-PNPI collaboration on the asymmetry in the π+p elastic scattering are presented. The data were obtained for the first time in the region of backward angles with low cross section, where the predictions of the partial wave analyses are not reliable. The results at 1.94 GeV/c are in favor of the older KH80 analysis and show noticeable deviation from the latest FA06 solution by GWU group. At 2.07 GeV/c very low cross section did not allow to achieve good accuracy. Yet the data do not follow any of the PWA predictions and definitely disagree with SP06 analysis.

  9. Molecular Desorption of a NEG St 707 Irradiated at Room Temperature with Synchrotron Radiation of 194 eV Critical Photon Energy

    CERN Document Server

    Le Pimpec, F; Laurent, Jean Michel

    2002-01-01

    Photon stimulated molecular desorption from a NEG St 707 (SAES Getters$^{TM}$) surface after conditioning and after saturation with isotopic carbon monoxide, 13C18O, has been studied on a dedicated beam line at the EPA ring at CERN. The synchrotron radiation of 194 eV critical energy and with an average photon intensity of ~1 10**17 photons.s**-1 was impinging on the sample at perpendicular incidence. It is found that the desorption yields h molecules/photon) of the characteristic gases in an UHV system (hydrogen, methane, carbon monoxide and carbon dioxide) for a freshly activated NEG and for a NEG fully saturated with 13C18O are lower than that of 300 C baked stainless steel.

  10. Sequence of pNL194, a 79.3-kilobase IncN plasmid carrying the blaVIM-1 metallo-beta-lactamase gene in Klebsiella pneumoniae.

    Science.gov (United States)

    Miriagou, V; Papagiannitsis, C C; Kotsakis, S D; Loli, A; Tzelepi, E; Legakis, N J; Tzouvelekis, L S

    2010-10-01

    The nucleotide sequence of pNL194, a VIM-1-encoding plasmid, is described in this study. pNL194 (79,307 bp) comprised an IncN-characteristic segment (38,940 bp) and a mosaic structure (40,367 bp) including bla(VIM-1), aacA7, aadA1, aadA2, dfrA1, dfrA12, aphA1, strA, strB, and sul1. Tn1000 or Tn5501 insertion within fipA probably facilitated recruitment of additional mobile elements carrying resistance genes.

  11. Sequence of pNL194, a 79.3-Kilobase IncN Plasmid Carrying the blaVIM-1 Metallo-β-Lactamase Gene in Klebsiella pneumoniae▿

    Science.gov (United States)

    Miriagou, V.; Papagiannitsis, C. C.; Kotsakis, S. D.; Loli, A.; Tzelepi, E.; Legakis, N. J.; Tzouvelekis, L. S.

    2010-01-01

    The nucleotide sequence of pNL194, a VIM-1-encoding plasmid, is described in this study. pNL194 (79,307 bp) comprised an IncN-characteristic segment (38,940 bp) and a mosaic structure (40,367 bp) including blaVIM-1, aacA7, aadA1, aadA2, dfrA1, dfrA12, aphA1, strA, strB, and sul1. Tn1000 or Tn5501 insertion within fipA probably facilitated recruitment of additional mobile elements carrying resistance genes. PMID:20660690

  12. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  13. Superação da resistência qualitativa da cultivar de trigo "BRS 194" por uma nova raça de Puccinia triticina Breakdown of qualitative leaf rust resistance in the wheat cultivar 'BRS 194' by a new race of Puccinia triticina

    Directory of Open Access Journals (Sweden)

    Márcia Soares Chaves

    2009-02-01

    Full Text Available A população de Puccinia triticina, agente causal da ferrugem da folha do trigo, é extremamente dinâmica na região do Cone Sul da América do Sul, onde o surgimento de novas raças é freqüente. A cultivar de trigo "BRS 194" foi a segunda variedade com maior disponibilidade de sementes para plantio no Rio Grande do Sul e em Santa Catarina em 2005, por apresentar características como rusticidade, elevado rendimento de grãos e resistência qualitativa a todas as raças de P. triticina ocorrentes no Brasil e em outros países da América do Sul. Em 2005, pústulas de ferrugem da folha foram observadas sobre plantas desta cultivar, tanto em lavouras quanto em campos experimentais, indicando a possível superação de sua resistência. O objetivo deste trabalho foi identificar a raça de P. triticina presente em amostras oriundas de "BRS 194" e verificar se esta se tratava de uma nova virulência do patógeno, a qual teria superado sua resistência. Oito amostras de ferrugem provenientes da cultivar "BRS 194" foram enviadas em 2005 à Embrapa Trigo, Passo Fundo, Rio Grande do Sul, para isolamento e identificação por meio da Série Internacional de Hospedeiros Diferenciais específica para este patógeno. Todas as amostras apresentaram a mesma combinação de virulência, a qual correspondeu ao código MFP-CT, conforme o Sistema Norte-Americano de nomenclatura do patógeno. Esta foi a primeira vez que este código foi detectado no Brasil, caracterizando o surgimento de uma nova raça de P. triticina virulenta à "BRS 194". Outras cultivares de trigo, também amplamente semeadas, foram inoculadas com a nova raça, sendo que algumas foram suscetíveis e outras resistentes. Entre as cultivares resistentes estão "Fundacep 30" e "IPR 84", as quais permanecem também resistentes a todas as raças do patógeno ocorrentes no Brasil.The population of Puccinia triticina, the causal agent of wheat leaf rust, is extremely dynamic in the South Cone

  14. miR-30-HNF4γ and miR-194-NR2F2 regulatory networks contribute to the upregulation of metaplasia markers in the stomach.

    Science.gov (United States)

    Sousa, Josane F; Nam, Ki Taek; Petersen, Christine P; Lee, Hyuk-Joon; Yang, Han-Kwang; Kim, Woo Ho; Goldenring, James R

    2016-06-01

    Intestinal metaplasia and spasmolytic polypeptide-expressing metaplasia (SPEM) are considered neoplastic precursors of gastric adenocarcinoma and are both marked by gene expression alterations in comparison to normal stomach. Since miRNAs are important regulators of gene expression, we sought to investigate the role of miRNAs on the development of stomach metaplasias. We performed miRNA profiling using a quantitative reverse transcription-PCR approach on laser capture microdissected human intestinal metaplasia and SPEM. Data integration of the miRNA profile with a previous mRNA profile from the same samples was performed to detect potential miRNA-mRNA regulatory circuits. Transfection of gastric cancer cell lines with selected miRNA mimics and inhibitors was used to evaluate their effects on the expression of putative targets and additional metaplasia markers. We identified several genes as potential targets of miRNAs altered during metaplasia progression. We showed evidence that HNF4γ (upregulated in intestinal metaplasia) is targeted by miR-30 and that miR-194 targets a known co-regulator of HNF4 activity, NR2F2 (downregulated in intestinal metaplasia). Intestinal metaplasia markers such as VIL1, TFF2 and TFF3 were downregulated after overexpression of miR-30a in a HNF4γ-dependent manner. In addition, overexpression of HNF4γ was sufficient to induce the expression of VIL1 and this effect was potentiated by downregulation of NR2F2. The interplay of the two transcription factors HNF4γ and NR2F2 and their coordinate regulation by miR-30 and miR-194, respectively, represent a miRNA to transcription factor network responsible for the expression of intestinal transcripts in stomach cell lineages during the development of intestinal metaplasia. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/

  15. Evidenced Formal Coverage Index and universal healthcare enactment: A prospective longitudinal study of economic, social, and political predictors of 194 countries.

    Science.gov (United States)

    Feigl, Andrea B; Ding, Eric L

    2013-11-01

    Determinants of universal healthcare (UHC) are poorly empirically understood. We undertook a comprehensive study of UHC development using a novel Evidenced Formal Coverage (EFC) index that combines three key UHC elements: legal framework, population coverage, and accessibility. Applying the EFC index measures (legislation, ≥90% skilled birth attendance, ≥85% formal coverage) to 194 countries, aggregating time-varying data from 1880-2008, this study investigates which macro-economic, political, and social indicators are major longitudinal predictors of developing EFC globally, and in middle-income countries. Overall, 75 of 194 countries implemented legal-text UHC legislation, of which 51 achieved EFC. In a country-year prospective longitudinal analysis of EFC prediction, higher GDP-per-capita (per GDP-per-capita doubling, relative risk [RR]=1.77, 95% CI: 1.49-2.10), higher primary school completion (per +20% completion, RR=2.30, 1.65-3.21), and higher adult literacy were significantly associated with achieving EFC. Results also identify a GDP-per-capita of I$5000 as a minimum level for development of EFC. GDP-per-capita and education were each robust predictors in middle-income countries, and education remained significant even controlling for time-varying GDP growth. For income-inequality, the GINI coefficient was suggestive in its role in predicting EFC (p=0.024). For social and political indicators, a greater degree of ethnic fractionalization (per +25%, RR=0.51, 0.38-0.70), proportional electoral system (RR=2.80, 1.22-6.40), and dictatorships (RR=0.10, 0.05-0.27) were further associated with EFC. The novel EFC index and this longitudinal prospective study together indicate that investment in both economic growth and education should be seen of equal importance for development of UHC. Our findings help in understanding the social and political drivers of universal healthcare, especially for transitioning countries. Copyright © 2013 Elsevier Ireland Ltd. All

  16. [Relation of MBL ExonI 54 and NFκB1-94ins/del ATTG Polymorphism with Fever during Neutropenia in Patients with Acute Leukaemia after Chemotherapy].

    Science.gov (United States)

    Xu, Wen-Ning; Jiang, Zu-Jun; Li, Yong-Hua; Xiao, Hao-Wen; Gao, Yang; Pang, Yan; Ouyang, Lin; Liu, Zeng-Hui; Zhang, Le-Qing; Wang, Yang; Xiao, Yang

    2015-10-01

    To explore the correlation between MBL ExonI 54 and NFκB1-94ins/del ATTG polymorphism and fever during neutropenia in patients with acute leukaemia (AL) (except M3) after first chemotherapy in Chinese Han population. Blood samples obtained from 76 fever patients with AL during neutropenia episodes were detected to analyse single nucleotide polymorphism (SNP) in the MBL ExonI 54 and NFκB1-94ins/del ATTG gene, and analyse the correlation between above-mentioned 2 polymorphisms and fever during neutropenia of AL patients after chemotherapy. In 76 patients, no correlation were found between MBL ExonI 54 and NFκB1-94ins/del ATTG polymorphism and fever during neutropenia in patients with acute leukaemia after chemotherapy (P > 0.05). No significant relation were found in sex, age, underlying disease, disease status or degrees of neutropenia in febrile neutropenia between MBL ExonI 54 and NFκB1-94ins/del ATTG polymorphism (P > 0.05). However, patients with MBL ExonI 54 mutation presented longer febrile duration with a median of 5 days compared to 3 days of patients with wildtype MBL ExonI 54 genotype (P 54 and NFκB1-94ins/del ATTG polymorphism and fever during neutropenia in patients with acute leukaemia after chemotherapy. However, the patients with MBL ExonI 54 mutation have been observed to present a longer febrile duration.

  17. Photometric analysis of the structure evolution on the Pb-19.4%Sn melt surface in the S-L temperature range

    Directory of Open Access Journals (Sweden)

    Lyakhovitskii M.M.

    2011-05-01

    Full Text Available The structure evolution of alloys in solidification range is considered as the first-order phase transformation from the solid state to the liquid one, which occurs by the mechanism of nucleation and growth of more symmetrical phase to less symmetrical crystalline phase. The kinetic regularities of this transformation are studied by the method of the photometric analysis of structure images (PHASI, which makes it possible to establish the temperature dependence of the relationship between the solid and liquid phases and their distribution on the melt surface. The PHASI method is based on the combined analysis of the brightness spectra of the visible light reflections from the sample surface and of the distribution of its scattering centers in different intensity intervals. The data on the structure evolution of the Sn+19.4%Pb alloy upon melting and solidification were considered in parallel with the measured spectra of sound signals. It was revealed that a distinct maximum is observed in the temperature dependence of radiation energy in the temperature range of phase transformation from the liquid into the solid state and hot crack formation occurs near the transition zone in the region of the contact of the ingot with the crucible.

  18. Molecular desorption of a nonevaporable getter St 707 irradiated at room temperature with synchrotron radiation of 194 eV critical photon energy

    CERN Document Server

    Le Pimpec, F; Laurent, Jean Michel

    2003-01-01

    Photon stimulated molecular desorption from a nonevaporable getter (NEG) St 707(R) (SAES Getters TM ) surface after conditioning and after saturation with isotopic carbon monoxide Ýcf. nomenclature in Handbook of Chemistry and Physics, 74th edition, edited by D. R. Lide (CRC Press, Boca Raton, 1994)¿ /sup 13/C/sup 18/O, has been studied on a dedicated beamline at the EPA ring at CERN. The synchrotron radiation of 194 eV critical energy and with an average photon intensity of ~1 * 10/sup 17/ photons s/sup -1/ was impinging on the sample at perpendicular incidence. It is found that the desorption yields eta (molecules/photon) of the characteristic gases in an UHV system (hydrogen, methane, carbon monoxide, and carbon dioxide) for a freshly activated NEG and for a NEG fully saturated with /sup 13/C /sup 18/O are lower than that of 300 degrees C baked stainless steel. (22 refs). Fully activated NEG was studied and found to desorb less as compared to a 300 degree c baked stainless-steel surface. Furthermore, it ...

  19. A study of the influence of Hg(6(3)P2) population in a low-pressure discharge on mercury ion emission at 194.2 nm

    Science.gov (United States)

    Maleki, L.; Blasenheim, B. J.; Janik, G. R.

    1990-01-01

    A low-pressure mercury-argon discharge, similar to the type existing in the mercury lamp for the trapped-ion standard, is probed with a new technique of laser spectroscopy to determine the influence of the Hg(6 3P(sub 2)) population on discharge emission. The discharge is excited with inductively coupled rf power. Variations in the intensity of emission lines in the discharge were examined as lambda = 546.1 nm light from a continuous wave (CW) laser excited the Hg(6 3P(sub 2)) to (7 3S (sub 1)) transition. The spectrum of the discharge viewed in the region of laser irradiation showed increased emission in lambda = 546.1, 435.8, 404.7, 253.7, and 194.2 nm lines. Other lines in Hg I exhibited a decrease in emission. When the discharge was viewed outside the region of laser irradiation, all lines exhibited an increased emission. Based on these results, it is concluded that the dominant mechanism for the excitation of higher lying levels of mercury is the the electron-impact excitation via the 3P(sub 2) level. The depopulation of this metastable is also responsible for the observed increase in the electron temperature when the laser irradiates the discharge. It is also concluded that the 3P(sub 2) metastable level of mercury does not play a significant role in the excitation of the 3P(sub 1/2) level of mercury ion.

  20. Ranchero Armature Test LA-19.4-CT-3: PBX-9501 Explosive with no smoothing layer. Firing point 88, 9/16/13

    Energy Technology Data Exchange (ETDEWEB)

    Glover, Brian B. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Goforth, James H. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rae, Philip John [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Dickson, Peter [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Briggs, Matthew E. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Marr-Lyon, Mark [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Hare, Steven John [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Herrera, Dennis Harold [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Watt, Robert Gregory [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rousculp, Christopher L. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-11-13

    LA-19.4-CT-3 (CT-3) was the third camera test in a series beginning in 1/11, which diagnose the performance of 6 mm thick, 6061 T-0 Al Ranchero armatures. [The test LA-43-CT-2 (CT-2) is described in LA-UR-14-21983.] The goal of CT-3 was to verify that PBX-9501, with 18 mm point spacing and no smoothing layer, could be used for Ranchero generator armatures in place of PBXN-110, which had been used in all previous Ranchero applications. CT-1 and CT-2 both had 43 cm long slapper detonator systems imbedded in the cast PBXN-110 explosive, but manufacturing a charge for a similar 9501 test was not cost effective. Instead, a single cylinder of 9501, 19.368 cm long and 15.494 cm (6.100”)in diameter, had a groove machined to accommodate a row of 11 SE-1 detonators with 18 mm point spacing along the mid-plane of the cylinder. The expansion of the armature looks like a slapper assembly along almost ½ of the circumference, and provides adequate proof of concept. Removing the smoother from PBXN-110-driven armatures increased the armature velocity from 3.1 mm/μs to 3.3 mm/μs, as seen in CT-2, and the velocity measured on CT-3 increased to 3.8 mm/μs. In addition, the camera records show that the surface of the armature is smooth enough, and free from ruptures for an expansion of greater that 2X. The advantage of using 9501 is that it precludes concerns about blow-outs seen when bubbles are left in the cast material, and gives extra velocity. The disadvantage is that the machined explosives are more expensive.

  1. NS1 Protein Amino Acid Changes D189N and V194I Affect Interferon Responses, Thermosensitivity, and Virulence of Circulating H3N2 Human Influenza A Viruses.

    Science.gov (United States)

    Nogales, Aitor; Martinez-Sobrido, Luis; Topham, David J; DeDiego, Marta L

    2017-03-01

    Influenza virus NS1 protein is a nonstructural, multifunctional protein that counteracts host innate immune responses, modulating virus pathogenesis. NS1 protein variability in subjects infected with H3N2 influenza A viruses (IAVs) during the 2010/2011 season was analyzed, and amino acid changes in residues 86, 189, and 194 were found. The consequences of these mutations for the NS1-mediated inhibition of IFN responses and the pathogenesis of the virus were evaluated, showing that NS1 mutations D189N and V194I impaired the ability of the NS1 protein to inhibit general gene expression, most probably because these mutations decreased the binding of NS1 to the cleavage and polyadenylation specificity factor 30 (CPSF30). A recombinant A/Puerto Rico/8/34 (PR8) H1N1 virus encoding the H3N2 NS1-D189N protein was slightly attenuated, whereas the virus encoding the H3N2 NS1-V194I protein was further attenuated in mice. The higher attenuation of this virus could not be explained by differences in the ability of the two NS1 proteins to counteract host innate immune responses, indicating that another factor must be responsible. In fact, we showed that the virus encoding the H3N2 NS1-V194I protein demonstrated a temperature-sensitive (ts) phenotype, providing a most likely explanation for the stronger attenuation observed. As far as we know, this is the first description of a mutation in NS1 residue 194 conferring a ts phenotype. These studies are relevant in order to identify new residues important for NS1 functions and in human influenza virus surveillance to assess mutations affecting the pathogenicity of circulating viruses. IMPORTANCE Influenza viral infections represent a serious public health problem, with influenza virus causing a contagious respiratory disease that is most effectively prevented through vaccination. The multifunctional nonstructural protein 1 (NS1) is the main viral factor counteracting the host antiviral response. Therefore, influenza virus

  2. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  3. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  4. miR-30-HNF4γ and miR-194-NR2F2 regulatory networks contribute to the up-regulation of metaplasia markers in the stomach

    Science.gov (United States)

    Sousa, Josane F.; Nam, Ki Taek; Petersen, Christine P.; Lee, Hyuk-Joon; Yang, Han-Kwang; Kim, Woo Ho; Goldenring, James R.

    2016-01-01

    Objective Intestinal metaplasia and spasmolytic polypeptide-expressing metaplasia (SPEM) are considered neoplastic precursors of gastric adenocarcinoma and are both marked by gene expression alterations in comparison to normal stomach. Since miRNAs are important regulators of gene expression, we sought to investigate the role of miRNAs on the development of stomach metaplasias. Design We performed miRNA profiling using a qRT-PCR approach on laser capture microdissected human intestinal metaplasia and SPEM. Data integration of the miRNA profile with a previous mRNA profile from the same samples was performed to detect potential miRNA-mRNA regulatory circuits. Transfection of gastric cancer cell lines with selected miRNA mimics and inhibitors was used to evaluate their effects on the expression of putative targets and additional metaplasia markers. Results We identified several genes as potential targets of miRNAs altered during metaplasia progression. We showed evidence that HNF4γ (upregulated in intestinal metaplasia) is targeted by miR-30 and that miR-194 targets a known co-regulator of HNF4 activity, NR2F2 (downregulated in intestinal metaplasia). Intestinal metaplasia markers such as VIL1, TFF2 and TFF3 were down-regulated after overexpression of miR-30a in a HNF4γ-dependent manner. In addition, overexpression of HNF4γ was sufficient to induce the expression of VIL1 and this effect was potentiated by down-regulation of NR2F2. Conclusion The interplay of the two transcription factors HNF4γ and NR2F2 and their coordinate regulation by miR-30 and miR-194, respectively, represent a miRNA to transcription factor network responsible for the expression of intestinal transcripts in stomach cell lineages during the development of intestinal metaplasia. PMID:25800782

  5. Identification of the Peptide PyroQ-βCasein194-209as a Highly Specific and Sensitive Marker to Differentiate between Ultrahigh-Temperature Processed (UHT) Milk and Mildly Heated Milk.

    Science.gov (United States)

    Dalabasmaz, Sevim; Ebner, Jennifer; Pischetsrieder, Monika

    2017-12-13

    In this study, a new approach was introduced to identify marker peptides that reflect the thermal treatment of commercial milk samples and differentiate ultrahigh-temperature processed (UHT) milk from mildly heated milk. Peptide profiles of training set samples, pasteurized (n = 20), extended shelf life (n = 29), and UHT (n = 29) milk, were recorded by MALDI-TOF-MS after StageTip microextraction. As marker candidates, 13 peptides were selected, and their cutoff levels were defined. The quality of the cutoff levels was then tested with a blind test set. Thus, the peptide m/z 1701.0, which was identified as pyroQ-βcasein 194-209 , could ideally differentiate UHT milk from mildly heated milk with an accuracy of 100%. Due to its high reliability and sensitivity, this peptide may be applied in routine analysis to monitor thermal processing of milk. An additional heating experiment showed that the marker peptide candidates are formed during milk processing by endogenous enzymes and selective thermal cleavage.

  6. „Neue Leitbilder für den Fortschritt“ (LS 194. Ein Plädoyer für die Wiederentdeckung praktischer Weisheit als neues Leitbild in der Marktwirtschaft

    Directory of Open Access Journals (Sweden)

    Claudius Bachmann

    2016-07-01

    Full Text Available In the light of the far-reaching leadership failures and business scandals of the last decades, the question has often been raised of whether we are reaping the results of the practical application of abstract management theory which is actually counteracting a socially, environmentally, and economically sustainable market economy. In this sense, Pope Francis recently called for ‘new models of progress’ to reflect on ‘the meaning of the economy and its goals’ (LS 194. To answer these calls, I first provide an overview of the recent discourse in leadership and organizational studies that have critically scrutinized the established theories and models of mainstream business. Second, I draw on the Apostolic Exhortation Evangelii Gaudium and the Encyclical Laudato Si’ to derive the cornerstones of an ‘evangelizing approach’ to the guiding principles of management theory and practice suggested by Pope Francis. Third, to facilitate this renewal, I introduce the ancient idea of practical wisdom (prudence which has recently enjoyed a remarkable renaissance in the literature and is considered as a new transformative paradigm for management theory and practice.

  7. 100-MeV proton beam intensity measurement by Au activation analysis using {sup 197}Au(p, pn){sup 196}Au and {sup 197}Au(p, p3n){sup 194}Au reactions

    Energy Technology Data Exchange (ETDEWEB)

    Mokhtari Oranj, Leila [Division of Advanced Nuclear Engineering, POSTECH, Pohang 37673 (Korea, Republic of); Jung, Nam-Suk; Oh, Joo-Hee [Pohang Accelerator Laboratory, POSTECH, Pohang 37673 (Korea, Republic of); Lee, Hee-Seock, E-mail: lee@postech.ac.kr [Pohang Accelerator Laboratory, POSTECH, Pohang 37673 (Korea, Republic of)

    2016-05-15

    The proton beam intensity of a 100-MeV proton linac at the Korea Multi-purpose Accelerator Complex (KOMAC) was measured by an Au activation analysis using {sup 197}Au(p, pn){sup 196}Au and {sup 197}Au(p, p3n){sup 194}Au reactions to determine the accuracy and precision of beam intensity measurement using Gafchromic film dosimetry method. The target, irradiated by 100-MeV protons, was arranged in a stack consisting of Au, Al foils and Pb plates. The yields of produced radio-nuclei in Au foils were obtained by gamma-ray spectroscopy. The FLUKA code was employed to calculate the energy spectrum of protons onto the front surface of Au foils located at three different depth points of the target and also to investigate the condition of incident beam on the target. A good agreement was found between the beam intensity measurements using the activation analysis method at three different depth points of the target. An excellent agreement was also observed between the beam intensity measurements using the Au activation analysis method and the dosimetry method using Gafchromic film.

  8. General energy competence in the primary law of the European Union. An analysis of Article 194 of the Treaty on the Functioning of the European Union in the Lisbon version in consideration of the historical development of energy competence; Die allgemeine Energiekompetenz im Primaerrecht der Europaeischen Union. Eine Analyse des Artikels 194 des Vertrags ueber die Arbeitsweise der Europaeischen Union in der Fassung des Vertrags von Lissabon unter Beruecksichtigung der historischen Entwicklung der Energiekompetenz

    Energy Technology Data Exchange (ETDEWEB)

    Hacklaender, Daniel

    2010-07-01

    With the coming into force of the Lisbon treaty, the internal measures and policies of the European Union were supplemented by the independent title ''Energy''. While the need for supranational management of energy-political task was recognized at an early stage already, the legal instruments for this purpose were lacking. Article 194 of the Treaty on the Functioning of the European Union now provides a legal basis for a comprehensive, interdisciplinary energy policy on a European scale. The author investigates the content of the energy article. He shows that the modification of the treaty has brought about greater competences of the Union, especially in the field of energy supply assurance which is greatly influenced by the new regulations on energy solidarity. The book also discusses problems of competing legislation resulting from interdependences between the energy article on the one hand and competence standards with other goals on the other hand and also attempts to define the specific limits of energy competence. (orig.)

  9. 49 CFR 194.5 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... area of environmental importance which is in or adjacent to navigable waters. High volume area means an..., rivers, streams; waters which are used for recreation; and waters from which fish or shellfish are taken...

  10. 40 CFR 194.26 - Expert judgment.

    Science.gov (United States)

    2010-07-01

    ... FOR THE CERTIFICATION AND RE-CERTIFICATION OF THE WASTE ISOLATION PILOT PLANT'S COMPLIANCE WITH THE 40... judgment elicitation processes and the reasoning behind those results. Documentation of interviews used to... and technical views to expert panels as input to any expert elicitation process. ...

  11. Publications | Page 194 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2009-06-01

    As the project progressed there was an emergent focus on building research capacity of participant nurses. The team combined researchers from the... Alternative Water Systems Project : final technical report (June 1, 2009 - July 31, 2012) (restricted access). Pipe distribution networks in the developing world are constantly ...

  12. Reference: 194 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available d SUVH4 (KRYPTONITE) represent distinct subgroups of SUVH genes. Loss of SUVH1 and SUVH4 causes...s SUVH2 displays strong dosage-dependent effects. Loss of function suppresses, whereas overexpression enhances, gene silencing, cause

  13. 40 CFR 194.22 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... Department shall adhere to a quality assurance program that implements the requirements of ASME NQA-1-1989 edition, ASME NQA-2a-1990 addenda, part 2.7, to ASME NQA-2-1989 edition, and ASME NQA-3-1989 edition...); corroborating data; confirmatory testing; or a quality assurance program that is equivalent in effect to ASME...

  14. 21 CFR 155.194 - Catsup.

    Science.gov (United States)

    2010-04-01

    ... adjust to 20±1 °C. The trough must also be at a temperature close to 20 °C. Adjust end-to-end level of Bostwick Consistometer by means of the spirit level placed in trough of instrument. Side-to-side level may be adjusted by means of the built-in spirit level. Transfer sample to the dry sample chamber of the...

  15. 40 CFR 194.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    .... Certification means any action taken by the Administrator pursuant to section 8(d)(1) of the WIPP LWA. Compliance application(s) means the compliance certification application submitted to the Administrator... requirements. Re-certification means any action taken by the Administrator pursuant to section 8(f) of the WIPP...

  16. Publications | Page 194 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Enhancing the adaptive capacity of communities to climate change induced water challenges using ICT in Uganda : project design and anticipated policy ... the staggered rollout of Vietnam''s hospital autonomization policy to estimate its impacts on several key health sector outcomes including hospital efficiency, use of ...

  17. Publications | Page 194 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... Sciences Graduate Training Program (India-Waterloo) : final report (open access). Actuaries assess risks involved in insurance and pensions, through proper product design, pricing, development of underwriting standards, determination of asset management strategies, claims analysis, and enterprise risk management.

  18. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  19. Flow measurements in ONKALO at Olkiluoto probe holes, ONK-PVA3, -PVA6, -PP187, -PP190, -PP194, -PP196, -PP223, -PP226 and -PP227

    Energy Technology Data Exchange (ETDEWEB)

    Pekkanen, J. (PRG-Tec Oy, Espoo (Finland))

    2010-06-15

    The Posiva Flow Log, Difference Flow Method (PFL DIFF) uses a flowmeter that incorporates a flow guide and can be used for relatively quick determinations of hydraulic conductivity and hydraulic head in fractures/fractured zones in cored drillholes. This report presents the principles of the method and the results of measurements carried out during the excavation of the underground access tunnel ONKALO at Olkiluoto. Phase 1, phase 2 and phase 3 of the probe hole measurements in the access tunnel started when the tunnel was 15 m long and finished at the tunnel length of 3288 m. The results of phases 1, 2 and 3 are presented in reports 2006-65 (Phase 1) /Reiman, M., Vaeisaesvaara, J and Poellaenen, J. 2006/, 2008-37 (Phase 2) /Pekkanen, J., 2008/ and 2010- 02 /Pekkanen, J and Vaeisaesvaara, J., 2010/. Probe hole measurements were continued normally in phase 4. The phase 4 results are presented in this report. Flow measurements started on April 15, 2009 when tunnel length was 3528 m and ended on November 25, 2009, tunnel length 3976 m. Probe hole measurements will continue normally below 3976 m. In addition to probe holes, shallow core-drilled drillholes were also measured in ONKALO. The drillholes discussed in this report are ONK-PVA3, ONK-PVA6, ONKPP187, ONK-PP190, ONK-PP194, ONK-PP196, ONK-PP223, ONK-PP226 and ONKPP227. The PFL DIFF probe was used to detect flow within single fractures in the drillhole or probe hole. The method utilizes rubber disks to isolate the flow in a test section from that in the rest of the probe hole or to measure the flow along the probe hole. The flow along the probe hole was measured in probe holes from ONK-TR3528 to ONK-TR3976 using 0.1 m and 0.2 m point interval. Core-drilled drillholes were measured using a 0.5 m section length (the distance isolated with the rubber disks) with a 0.1 m point interval. The device used includes a sensor for single point resistance (SPR). SPR was measured in connection with flow measurements. The flow

  20. A new unstable variant of the fetal hemoglobin HBG2 gene: Hb F-Turritana [(G) γ64(E8)Gly→Asp, HBG2:c.194G>A] found in cis to the Hb F-Sardinia gene [(A) γ(E19)Ile→Thr, HBG1:c.227T>C].

    Science.gov (United States)

    Pirastru, Monica; Mereu, Paolo; Trova, Sandro; Manca, Laura; Masala, Bruno

    2014-06-01

    A new variant of the fetal hemoglobin (Hb) was observed in a newborn baby subjected to phototherapy due to jaundice, by means of electrophoretic and chromatographic techniques. The variant Hb resulted unstable by the isopropanol stability test. After HBG2 gene sequencing, the G to A transversion at codon 64, position eight of the E helix, was found, which corresponds to the Asp for Gly amino acid substitution. The new variant was called Hb F-Turritana [(G) γ64(E8)Gly→Asp, HBG2:c.194G>A]. Incoming aspartic acid residue, bulky and negatively charged, may be responsible for alteration of the heme pocket steric configuration and for instability. The new abnormal HBG2 gene was found to be associated in cis with the mutated HBG1 gene, which characterizes the Hb F-Sardinia [(A) γ (E19)Ile→Thr, HBG1:c.227T>C] variant. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  1. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  2. 0+-levels and E0-transitions in 194Pt

    Directory of Open Access Journals (Sweden)

    V. T. Kupryashkin

    2017-08-01

    Full Text Available Conversion spectrum of the K- and L-lines of E0-transitions was studied with high-resolution magnetic spectrometer π√2. The intensity of the E0-transitions (in relation to the most intense transition of 328 keV is: 1479 keV, Ik = 2.00(5; 1547 keV, Ik = 6.1(5⋅10-2; 2085 keV, Ik = 1.10(5⋅10-1. For the first time, measurements of the L-peaks of the E0-transition in the region of more than 1 MeV have been made and the relation L1 / L2 = 26(7 for 1479 keV has been established. Based on the measurements, the values of parameters q2 and X were calculated for: 1479 keV - q2 = 11.5(9, X = 0.44(6; 1547 keV - q2 = 0.47(6, X = 0.020(4; 2085 keV - q2 = 61(2, X = 5.6(3. Comparison was made with existing nuclear models.

  3. 40 CFR 19.4 - Penalty adjustment and table.

    Science.gov (United States)

    2010-07-01

    ...) RESIDENTIAL LEAD-BASED PAINT HAZARD REDUCTION ACT OF 1992 10,000 11,000 11,000 16,000 42 U.S.C. 4910(a)(2) NOISE CONTROL ACT OF 1972 10,000 11,000 11,000 16,000 42 U.S.C. 6928(a)(3) RESOURCE CONSERVATION AND...

  4. Dicty_cDB: SHB194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ered pieces. 50 0.050 1 BH336507 |BH336507.1 CH230-169E2.TJ CHORI-230 Segment 1 Rattus norvegicus genomic cl...one CH230-169E2, DNA sequence. 38 0.063 3 BZ164233 |BZ164233.1 CH230-246O13.TJB CHORI-230 Segment 2 Rattus n

  5. Dicty_cDB: CHI194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GEGYHNFHHEFPYDYRNGIHMSAYDPGKWLINFL SWFGFAYELKRFPSELFAKGKIQMQEKTIKKLRDQLYWGKPLDQLPSFTRAQVKEKCQKE KKQL...GEGYHNFHHEFPYDYRNGIHMSAYDPGKWLINFL SWFGFAYELKRFPSELFAKGKIQMQEKTIKKLRDQLYWGKPLDQLPSFTRAQVKEKCQKE KKQL

  6. 40 CFR 194.14 - Content of compliance certification application.

    Science.gov (United States)

    2010-07-01

    ..., such as interbeds. (4) The projected geophysical, hydrogeologic and geochemical conditions of the..., engineered barriers, general arrangement, and approximate dimensions; and (2) Computer codes and standards...

  7. Dicty_cDB: SFF194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 124-6045772 strain AX4, complete sequence. 34 0.50 7 BE317387 |BE317387.2 NF068C10LF1F1070 Developing leaf M...249770 |BE249770.2 NF022C10LF1F1081 Developing leaf Medicago truncatula cDNA clone NF022C10LF 5', mRNA seque

  8. 49 CFR 194.105 - Worst case discharge.

    Science.gov (United States)

    2010-10-01

    ...: Prevention measure Standard Credit(percent) Secondary containment > 100% NFPA 30 50 Built/repaired to API standards API STD 620/650/653 10 Overfill protection standards API RP 2350 5 Testing/cathodic protection API STD 650/651/653 5 Tertiary containment/drainage/treatment NFPA 30 5 Maximum allowable credit 75 [58 FR...

  9. (194-IJBCS-Article-Dr Hervé Bisseleua)

    African Journals Online (AJOL)

    RHUMSIKI

    The constant growth of the world's population and the soaring of food prices require substantial resources for the production of food. Post-harvest protection has an important role to play in ... high cost of synthetic insecticides, together with the growing ..... active ingredient present in Z. xanthoxyloides plant parts acts more by ...

  10. 46 CFR 194.05-21 - Other regulated materials.

    Science.gov (United States)

    2010-10-01

    ... regulated materials. (a) Other Regulated Materials (DOT Hazard Class “ORM”) as chemical stores and reagents... Regulated Materials (DOT Hazard Class “ORM”) which are not chemical stores and reagents shall be regulated...

  11. 46 CFR 194.05-7 - Explosives-Detail requirements.

    Science.gov (United States)

    2010-10-01

    ... (explosive) materials (as defined in 49 CFR 173.50) and blasting-caps must be carried in magazines...) Compatibility of magazine stowage shall be in accordance with 49 CFR 176.144. (2) Magazine chests, magazine vans... spaces and to all parts of the deck required to be used in navigation and working of the vessel. Stowage...

  12. Dicty_cDB: CHQ194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4e-82 10 AY954892 |AY954892.1 Cryptosporidium andersoni strain HenanZhzhca heat shock protein 70 gene...123 3e-80 8 AY954893 |AY954893.1 Cryptosporidium andersoni strain changchunca heat shock protein 70 gene...129 4e-79 8 DQ060426 |DQ060426.1 Cryptosporidium andersoni strain zzca heat shock protein 70-like gene,...133 6e-78 5 AY954894 |AY954894.1 Cryptosporidium andersoni strain bjcm heat shock protein 70 gene, partial

  13. Dicty_cDB: SFE194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rqvsftlllsivcviva*fstrgtvmp dhwsvglfdkivtcryhpldng*tplsqnpf*krkpnalececcr*h*vvgggplstlnh minrcytavsfrllwwvak...ivhpltrnvswv*tvvrqvsftlllsivcviva*fstrgtvmp dhwsvglfdkivtcryhpldng*tplsqnpf*krkpnalececcr*h*vvgggplstlnh min

  14. Dicty_cDB: CFC194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available equences producing significant alignments: (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott...nts: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott

  15. Dicty_cDB: SLC194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VAA KISDSDKSTIESETESVLKWLESNQTAEKDEYEDKMKALEAVVNPIMSKLYQEGGMPQGG GMPGGMSNDSPKSSNNKVDELD*rnfseenisik*...VAA KISDSDKSTIESETESVLKWLESNQTAEKDEYEDKMKALEAVVNPIMSKLYQEGGMPQGG GMPGGMSNDSPKSSNNKVDELD*rnfseenisik*

  16. Dicty_cDB: SFC194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AIKARQVDEEHMIS LKLKVGAEAVKAKANEIDNNLHISESAAAIKGAVVERANALDERFQISGFFKSASDMISQ QASNLMKAAEENSTVSPIVNKVSSFGTFIKXEXQXI...AIKARQVDEEHMIS LKLKVGAEAVKAKANEIDNNLHISESAAAIKGAVVERANALDERFQISGFFKSASDMISQ QASNLMKAAEENSTVSPIVNKVSSFGTFIKXEXQXI

  17. Dicty_cDB: AHA194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YNLSKLQDPRIEKLPYSIRILLESA VRNCDNFEVHEKDVENILNWENTANKVEIPFKPARVLLQDFTGVPAVVDLAAMRDAMKRL GGDPAKINPLVPV...YNLSKLQDPRIEKLPYSIRILLESA VRNCDNFEVHEKDVENILNWENTANKVEIPFKPARVLLQDFTGVPAVVDLAAMRDAMKRL GGDPAKINPLVPV

  18. Southern Forests: a Journal of Forest Science - Vol 194 (2002)

    African Journals Online (AJOL)

    Early performance of Casuarina junghuhniana provenances / land races at Lushoto, Tanzania: scientific paper · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. ST Mwihomeke, AG Mugasha, SAO Chamshama, MA Mgangamundo, OC Kumburu, Z Lupala, 7-14 ...

  19. Dicty_cDB: SHC194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SGAATXGNIGGXFK WFQFFRR**rxg*qeallevivavllevivavllevivavllevivevllevivevxlvv ivvlqleqivvlqllqvvemvqvv...SGAATXGNIGGXFK WFQFFRR**rxg*qeallevivavllevivavllevivavllevivevllevivevxlvv ivvlqleqivvlqllqvvemvqvv

  20. Dicty_cDB: AFF194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IKTCLL KKI Frame B: qqqqieettsqptsnddeyerqvqialqkqqekqrqmeleiqreyerlaaegqgveenid ...nnnnnnnnsnedd eyerkaaialkqqqekqrqmelelqreyerlaaeegkspeptpeeixadqrkkeeexkgr fqedktfxqnqkhlr*rkgrn--- ---xsxxt

  1. Dicty_cDB: SHG194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SLTIV DTQTLTCSAPPGSGIKNAVSFMVKDAESKLSPPLFLDYSPPTIMSSTSVKQVEGGQVTIY GTNFENTLITVNVGSKSCEDVSVIDSTKLTCSI...SLTIV DTQTLTCSAPPGSGIKNAVSFMVKDAESKLSPPLFLDYSPPTIMSSTSVKQVEGGQVTIY GTNFENTLITVNVGSKSCEDVSVIDSTKLTCSI

  2. Between Truth and Beauty. Symposium 194e – 201c

    Czech Academy of Sciences Publication Activity Database

    Boháček, Kryštof

    2010-01-01

    Roč. 2, International Issue 1 (2010), s. 173-195 ISSN 1803-7860 Institutional support: RVO:67985955 Keywords : Plato * Symposium * Gorgias * Agathon * tragic thought * rhetoric * philosophy of power Subject RIV: AA - Philosophy ; Religion http://hdl.handle.net/11104/0236437

  3. 49 CFR 194.107 - General response plan requirements.

    Science.gov (United States)

    2010-10-01

    ... organization's role and the Federal On Scene Coordinator's role in pollution response; (ii) Establish... management system including the functional areas of finance, logistics, operations, planning, and command...

  4. Dicty_cDB: AFN194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DFRNLSSRFLGSTKDEQFKIKDELSHYCLRLAMCDSTD RNWFITTESILLANRLNQSDLTTIISSFKGFGWSPVSQEEYEQYQDDLGYLVKKANLNLN ...DFRNLSSRFLGSTKDEQFKIKDELSHYCLRLAMCDSTD RNWFITTESILLANRLNQSDLTTIISSFKGFGWSPVSQEEYEQYQDDLGYLVKKANLNLN

  5. Dicty_cDB: VFN194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CSM/SS/SSA3-D/SSA384Q.Seq.d/ 767 0.0 VSF451 (VSF451Q) /CSM/VS/VSF4-C/VSF451Q.Seq.d/ 622 e-177 VSB757... (VSB757Q) /CSM/VS/VSB7-C/VSB757Q.Seq.d/ 143 8e-33 own update 2002.12.19 Homology vs DNA

  6. 40 CFR 194.23 - Models and computer codes.

    Science.gov (United States)

    2010-07-01

    ... of the theoretical backgrounds of each model and the method of analysis or assessment; (2) General... input and output files from a sample computer run; and reports on code verification, benchmarking, validation, and quality assurance procedures; (3) Detailed descriptions of the structure of computer codes...

  7. All projects related to | Page 194 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2016-08-23

    Silence around the topic of sexual violence has increased in South Asian countries of Bangladesh, India, Nepal, Pakistan and Sri Lanka, even as its incidence has also increased in recent conflicts. End Date: August 23, 2016. Topic: SEXUAL ABUSE, SOCIAL PROBLEMS, BANGLADESH, ADMINISTRATION OF JUSTICE, ...

  8. 27 CFR 26.194 - Detention of articles.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Detention of articles. 26..., DEPARTMENT OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Shipment of... Detention of articles. (a) Upon receiving a notification in accordance with § 26.193(b), the appropriate TTB...

  9. Cranial Defects and Cranioplasty. Part 8. Chapter 194,

    Science.gov (United States)

    1984-01-01

    have described such procedures which require the services of a dental prosthetics laboratory. If the patient’s own bone flap or that of another patient...reorganization of a dead bone plate requires revascularization followed by resorption of dead bone trabeculae and 17 S S J. -* Donald J. Prolo, M.D. cortex

  10. Dicty_cDB: CHO194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available er of HSP's gapped (non-prelim): 0 length of query: 121 length of database: 80,480,566 effective HSP length: 17 effective... length of query: 104 effective length of database: 78,821,179 effective search space: 8197402616 effective...successful extensions: 0 Number of sequences better than 10.0: 0 length of query: 121 length of database: _,504,085,797 effective... HSP length: 21 effective length of query: 100 effective length of database: ^,543,142,933 effective... search space: 4654314293300 effective search space used: 4654314293300 T: 0 A: 0 X1: 6 (11.9 b

  11. Publications | Page 194 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  12. Dicty_cDB: AHB194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vklvyyyy*rn*RYKINKNKKKMIIINKDNDKKSLFLLL VSLIFVLFVSNVIADTDYAISPVSLLLPYSTSKYRKPYKLEANKGCFEWINTNPDLVEIT...KILIFAYPPLKSDQSEILLTLGSTLNVFFSGG PEPWHLERKSHFQSIVSNLTNEQNVLSIVPGNGNSFRVTCLTHTNPSKPIGIELTIGNKV TTTNPY...y wyh*flyylyqms*qiqimqyhlyhfyyhivhqnienhin*kqikvvsngsiqiqiwsks hhsmnqqhhvhhlqminskilehqiyhfgtihsinqi...KILIFAYPPLKSDQSEILLTLGSTLNVFFSGG PEPWHLERKSHFQSIVSNLTNEQNVLSIVPGNGNSFRVTCLTHTNPSKPIGIELTIGNKV TTTNPY...vklvyyyy*rn*RYKINKNKKKMIIINKDNDKKSLFLLL VSLIFVLFVSNVIADTDYAISPVSLLLPYSTSKYRKPYKLEANKGCFEWINTNPDLVEIT

  13. Formation of endohedral metallofullerene (EMF) ions of MnC2m+ (M = La, Y, n ≤ 6, 50 ≤ 2m ≤ 194) in the laser ablation process with graphene as precursor.

    Science.gov (United States)

    Kong, Xianglei; Bao, Xiaodi

    2017-05-30

    Graphene has proved to be a versatile precursor for the generation of mono-endohedral metallofullerenes (EMFs) of alkali and alkali earth metal atoms. Thus, it is important to investigate whether graphene is also a good precursor for the generation of EMFs including multi-metal atoms or some transition metal atoms. Experiments were performed on a 7.0 T Fourier transform ion cyclotron resonance (FT-ICR) mass spectrometer. Laser ablation mass spectra were obtained by laser irradiation on mixtures of graphene and LaCl3 , YCl3 or HAuCl4 on a stainless steel plate. A 355 nm Nd:YAG laser with a typical energy of 2.5 mJ/pulse was employed in these experiments. Tandem mass spectrometry was performed by on-resonance excitation collision-induced dissociation (CID) for selected single isotopic peaks. Metallofullerene La1-6C2m+/ Y1-6C2m+ ions were observed in the laser ablation mass spectra of mixtures of graphene and LaCl3 /YCl3 . CID and reactant gas experiments on selected ions showed that these ions had endohedral structures. Considering the experimental condition applied here, a mechanism based on a top-down process for the generation of the EMF ions is suggested. Further experiments on HAuCl4 showed some weak signals of AuC2m+ for the first time. Mono- and multi-EMF ions of MnC2m+ (M = La, Y, n = 1-6, 50 ≤ 2 m ≤ 194) were generated by laser ablation of graphene and the corresponding metal salts and detected by FT-ICR mass spectrometry. The results have shed light on the formation and generation of some new EMF species. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.

  14. KN194L01: WHOI cruise 194 leg 01 aboard the R/V Knorr from 2008-08-07 - 2008-08-31 (NODC Accession 0081218)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Post-cruise download of raw data from shipboard computer(s) as furnished by the Woods Hole Oceanographic Institution Shipboard Scientific Support Group and archived...

  15. KN194L05: WHOI cruise 194 leg 05 aboard the R/V Knorr from 2008-11-01 - 2008-11-14 (NODC Accession 0080960)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Post-cruise download of raw data from shipboard computer(s) as furnished by the Woods Hole Oceanographic Institution Shipboard Scientific Support Group and archived...

  16. Ghaffari et al., Afr J Tradit Complement Altern Med. (2016) 13(6):194 ...

    African Journals Online (AJOL)

    Urease enzyme that is part of H. pylori protein component hydrolyzes urea into ammonia that neutralize stomach acid thus support the initial colonization of the H. pylori in human stomach (Dunn et al., 1997). This ammonia reacts with chloride ions to give a highly toxic compound monochloramine (Mai et al.,. 1991). Urease ...

  17. IMPRISONMENT AS A RESULT OF WOMEN SUBORDINATION 194 REFLECTED IN MAYA ANGELOU‘S POEMS

    Directory of Open Access Journals (Sweden)

    Fatikha Amalina

    2017-12-01

    Full Text Available This research is aimed to describe the imprisonment of African American people, especially women, in the case of patriarchy and women subordination through Maya Angelou‘s selected poems entitled ―Caged Bird‖, ―Still I Rise‖ and ―Woman Work‖. This research discusses the meaning behind the poems that reflected Maya Angelou‘s life experience relating to women subordination and freedom. Feminism approach is applied to analyze the concept of freedom in women subordination and patriarchy in this research. The paper points to how the concept of gender intertwines with labor, ethnics, kinship and gender domination. Without aiming to paint a detailed picture of feminism, the paper explores how ideas developed in these inquiries question the taken-for-granted assumption about the universality of women‘s subordination and challenge the emancipation prerequisite of feminist agenda.

  18. 40 CFR 421.194 - Standards of performance for new sources.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Standards of performance for new... average mg/kg (pounds per million pounds) of indium metal produced Cadmium 2.105 0.929 Lead 2.600 1.238... range of 7.5 to 10.0 at all times. (b) Spent Electrolyte. NSPS for the Secondary Indium Subcategory...

  19. Posttranslational modifications of proteins : tools for functional proteomics [Methods in molecular biology, v. 194

    National Research Council Canada - National Science Library

    Kannicht, Christoph

    2002-01-01

    ... single glycosylation sites in a protein. Additional powerful techniques facilitate the analysis of glycosylphosphatidylinositols, lipid modifications, protein phosphorylation and sulfation, protein methylation and acetylation, a-amidation...

  20. 194 Évaluation de l'efficacité de l'insecticide Tricel 480 EC ...

    African Journals Online (AJOL)

    PR BOKO

    Afin de contrôler l'utilisation croissante et non raisonnée de produits phytosanitaires contre les ravageurs des cultures maraîchères, 3 doses du TRIC 480 EC (0,8 L/ha, 1 L/ha et 2 L/ha), ont été testées. Il s'agit de déterminer la dose optimale d'utilisation pour la réduction efficiente des populations d'insectes ravageurs.

  1. SU-F-J-194: Development of Dose-Based Image Guided Proton Therapy Workflow

    Energy Technology Data Exchange (ETDEWEB)

    Pham, R; Sun, B; Zhao, T; Li, H; Yang, D; Grantham, K; Goddu, S; Santanam, L; Bradley, J; Mutic, S; Kandlakunta, P; Zhang, T [Washington University School of Medicine, Saint Louis, MO (United States)

    2016-06-15

    Purpose: To implement image-guided proton therapy (IGPT) based on daily proton dose distribution. Methods: Unlike x-ray therapy, simple alignment based on anatomy cannot ensure proper dose coverage in proton therapy. Anatomy changes along the beam path may lead to underdosing the target, or overdosing the organ-at-risk (OAR). With an in-room mobile computed tomography (CT) system, we are developing a dose-based IGPT software tool that allows patient positioning and treatment adaption based on daily dose distributions. During an IGPT treatment, daily CT images are acquired in treatment position. After initial positioning based on rigid image registration, proton dose distribution is calculated on daily CT images. The target and OARs are automatically delineated via deformable image registration. Dose distributions are evaluated to decide if repositioning or plan adaptation is necessary in order to achieve proper coverage of the target and sparing of OARs. Besides online dose-based image guidance, the software tool can also map daily treatment doses to the treatment planning CT images for offline adaptive treatment. Results: An in-room helical CT system is commissioned for IGPT purposes. It produces accurate CT numbers that allow proton dose calculation. GPU-based deformable image registration algorithms are developed and evaluated for automatic ROI-delineation and dose mapping. The online and offline IGPT functionalities are evaluated with daily CT images of the proton patients. Conclusion: The online and offline IGPT software tool may improve the safety and quality of proton treatment by allowing dose-based IGPT and adaptive proton treatments. Research is partially supported by Mevion Medical Systems.

  2. 194 Évaluation de l'efficacité de l'insecticide Tricel 480 EC ...

    African Journals Online (AJOL)

    PR BOKO

    donc les pertes par la dégénérescence des plants de chou. Contrôle qui ..... Les plants trop affaiblis meurent. Il a été observé aussi au cours de cette étude, les larves de Diptères telles que la mouche du chou(Deliaradicum) ou la mouche blanche (Aleyrodesproletella) dont les larves font des mines vers le bas des plants ...

  3. 19 CFR 19.4 - CBP and proprietor responsibility and supervision over warehouses.

    Science.gov (United States)

    2010-04-01

    ...) Maintain the inventory control and recordkeeping system in accordance with the provisions of § 19.12 of... the warehouse if the proprietor's inventory control system specifically identifies all locations where... may be stored in multiple locations within the warehouse if the proprietor's inventory control system...

  4. 1935 15' Quad #194 Aerial Photo Mosaic Index - 2 of 2

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  5. 1935 15' Quad #194 Aerial Photo Mosaic Index - 1 of 2

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  6. Structural basis for the enhanced activity of cyclic antimicrobial peptides : The case of BPC194

    NARCIS (Netherlands)

    Mika, Jacek T.; Moiset, Gemma; Cirac, Anna D.; Feliu, Lidia; Bardaji, Eduard; Planas, Marta; Sengupta, Durba; Marrink, Siewert J.; Poolman, Bert

    We report the molecular basis for the differences in activity of cyclic and linear antimicrobial peptides. We iteratively performed atomistic molecular dynamics simulations and biophysical measurements to probe the interaction of a cyclic antimicrobial peptide and its inactive linear analogue with

  7. 40 CFR 194.53 - Consideration of underground sources of drinking water.

    Science.gov (United States)

    2010-07-01

    ... underground sources of drinking water. In compliance assessments that analyze compliance with part 191, subpart C of this chapter, all underground sources of drinking water in the accessible environment that.... In determining whether underground sources of drinking water are expected to be affected by the...

  8. : tous les projets | Page 194 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Date de début : 1 mars 2013. End Date: 1 novembre 2015. Sujet: WAGES, INCOME DISTRIBUTION, LABOUR POLICY, GENDER EQUALITY, ECONOMIC ANALYSIS, LABOUR SUPPLY, LOW INCOME GROUPS. Région: Brazil, South America, India, North and Central America, Central Asia, Far East Asia, South Asia.

  9. Page 1 194 P. Madhavan Nair and S. V. Anantakrishnan with bromo ...

    Indian Academy of Sciences (India)

    watch graduated to 0-2 sec. A second stop-watch of the same quality was employed for determining the reaction times for the samples accurately. Just before taking a reading, the second stop-watch was started at a definite time read in the first one ...

  10. [Study of local anaesthetics--Part 194. Evaluation of carbopol hydrogels with lidocaine].

    Science.gov (United States)

    Vitková, Zuzana; Herdová, Petra; Cizmárik, Jozef; Zabka, Marián; Brázdovicová, Bronislava; Bockajová, Katarína

    2011-04-01

    The objective of this article is to describe the formulation and evaluation of dermal semisolid drugs--carbopol hydrogels containing the solution of Bukofit, zinc chloride and the local anaesthetic lidocaine. The hydrogels were evaluated after 2, 7, 14 and 28 days after their preparation and stored at the temperature of 5 degrees C +/- 0.2 degrees C. All prepared hydrogels were found to be stable with respect to pH values and rheological parameters. It follows from the found rheological parameters and flow curves that all evaluated hydrogels belong to non-Newtonian thixotropic systems. The extensometric analyses revealed increased deformation values, indicating that the gels can be easily spread out over the mucous membrane which results in the increased ability of the drug to diffuse into it. Based on the results obtained, it can be concluded that the prepared hydrogels have appropriate technological parameters and therefore in the future they may become potential drugs for the treatment of various inflammations in the oral cavity.

  11. 49 CFR Appendix A to Part 194 - Guidelines for the Preparation of Response Plans

    Science.gov (United States)

    2010-10-01

    ...) Guidelines” (PREP), which can be found using the search function on the USCG's PREP Web page, http://www.uscg... the search function at the National Response Center's Web site, http://www.nrt.org and; (3) 33 CFR... maintenance personnel and notification of the qualified individual on pipeline facilities which are normally...

  12. Environmentally Sustainable Yellow Smoke Formulations for Use in the M194 Hand Held Signal

    Science.gov (United States)

    2012-06-10

    airborne. As the assembly reaches its apex (an average height of ~725 feet), the burning of the delay element (5-6 seconds) then ignites an...presently used in M18 smoke grenade production. 4 Inhalation studies of SY33 as a smoke dye indicate that this compound is cleared from the lungs very

  13. Association between the NFKB1-94ins/del ATTG polymorphism and cancer risk: an updated meta-analysis.

    Science.gov (United States)

    Duan, Wenyuan; Wang, Erli; Zhang, Fengquan; Wang, Tongjian; You, Xiangdong; Qiao, Bin

    2014-08-01

    To assess the effect of the NFKB1 -94ins/del polymorphism on cancer, we conducted a meta-analysis based on 25 studies including 8,750 cases and 9,170 controls. Overall, the -94ins/del polymorphism was associated with cancer risk in the pooled analysis and in Asian population, whereas no association was observed in Caucasian population. Stratified analysis by subtypes of cancer showed that the -94ins/del polymorphism was associated with oral squamous cell carcinoma and ovarian cancer risk, but had no association with colorectal cancer, bladder cancer, and renal cell cancer. Our meta-analysis suggests the NFKB1 -94ins/del polymorphism affects cancer susceptibility, and the association is ethnic-specific.

  14. FCJ-194 From #RaceFail to #Ferguson: The Digital Intimacies of Race-Activist Hashtag Publics

    Directory of Open Access Journals (Sweden)

    Nathan Rambukanna

    2015-06-01

    Full Text Available This paper explores the rough, emergent and partial public culture of race-activist hashtags through the discourses of #RaceFail, a critical race quarrel that started in the sci-fi and fantasy blogosphere, and expanded from there into a broader, sustained discussion over social media; and #Ferguson, a recent race-activist hashtag raising issues around censorship, filtering and ‘gated discourse’. It ends with a discussion of how the frictions between the neoliberal desire to reduce hashtag publics to product publicity, and the activist desire to use hashtags to further public sphere awareness of political issues, is exemplified in the controversy over Facebook’s ‘algorithmic filtering’ of #Ferguson, and how, nevertheless, critical race hashtags are tapping into a developing tradition of vocal social media–supported dissent.

  15. NOC Liverpool report for the UK-IMON Project. April-June 2013 Unit 194 Glider deployment

    OpenAIRE

    Balfour, C.; Palmer, M.

    2013-01-01

    This document summarises an extended deployment of a 200 metre depth rated Slocum Electric glider by the National Oceanography Centre, Liverpool, UK. The glider was deployed on the 6th April and was recovered on the 3rd of June 2013, completing a survey of almost 58 days in length. The glider survey was sponsored by the UK Integrated Marine Observing Network (UK-IMON) initiative. UK-IMON is aimed enhancing the quality of and providing reliable marine data by implementing improvements to measu...

  16. 75 FR 54921 - Withdrawal of Regulatory Guides 1.38, 1.94, and 1.116

    Science.gov (United States)

    2010-09-09

    ....38 endorses the American Society of Mechanical Engineers (ASME) American National Standard Institute... endorses the ASME/ANSI Standard N45.2.5-- 1974, ``Supplementary Quality Assurance Requirements for... ASME/ANSI Standard N45.2--1975, ``Supplementary Quality Assurance Requirements for Installation...

  17. SU-E-T-194: Commissioning of Monaco Treatment Planning System On An Elekta VersaHD Linear Accelerator

    Energy Technology Data Exchange (ETDEWEB)

    Narayanasamy, G; Bosse, C; Saenz, D; Cruz, W; Papanikolaou, N; Stathakis, S [University of Texas Health Science Center at San Antonio, TX (United States); Mavroidis, P [University of North Carolina, Chapel Hill, NC (United States)

    2015-06-15

    Purpose: The Monaco treatment planning system (TPS) uses a Monte-Carlo algorithm based dose computation engine to model the photon beams of a linear accelerator. The aim is to perform verification of Monaco TPS beam modeling of a Elekta VersaHD linac with 6MV, 6MV FFF, 10 MV, 10MV FFF, 18MV photon beams and 160 multileaf collimators (MLC) with a projected width of 5-mm at the isocenter. Methods: A series of dosimetric tests were performed to validate Monaco calculated beams including point dose measurement in water with and without heterogeneity and 2-dimensional dose distributions on a Delta4 bi-planar diode dosimeter array (Scandidos, Uppsala, Sweden). 3D conformal beams of different field sizes, source-to-surface distances, wedges, and gantry angles were delivered onto a phantom consisting of several plastic water and Styrofoam slabs. Point dose measurements were verified with a PTW 31013 Semiflex 0.3 cc ionization chamber (PTW, Freiburg, Germany). In addition, 8 step and shoot intensity modulated radiotherapy (IMRT) and volumetric modulated arc radiotherapy (VMAT) beams included in the Monaco TPS commissioning suite were verified against measurements on Delta4 to test and fine tune parameters in the beam model. IMRT verification was computed using gamma analysis with dose difference and distance-to-agreement criteria of 3%/3mm with a dose threshold of 10%. Results: Point dose measurements agreed within 2% in the homogeneous phantom and within 3% in the heterogeneous phantom for all photon energies. IMRT beams yielded a passing percentage of 99.1±1.1% in the gamma analysis which is well above the institutional passing threshold of 90%. Conclusion: Monaco TPS commissioning was successfully performed for all the photon energies on the Elekta VersaHD linac prior to clinical usage.

  18. 76 FR 194 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing of Proposed Rule Change Relating...

    Science.gov (United States)

    2011-01-03

    ... Bank, International Bank for Reconstruction and Development, and the International Finance Corporation... Money Market Securities and derivative instruments, as described below. The Fund seeks to achieve its... derivative instruments. For these purposes, Money Market Securities include: short-term, high-quality...

  19. 15 CFR 19.4 - What notice will Commerce entities send to a debtor when collecting a Commerce debt?

    Science.gov (United States)

    2010-01-01

    ... the Commerce entity intends to garnish the debtor's private sector (i.e., non-Federal) wages (see § 19.... 3201(e); 31 U.S.C. 3720B, 31 CFR 285.13, and § 19.17(a) of this Part); (16) If applicable, the Commerce... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false What notice will Commerce entities...

  20. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  1. δ37Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.

  2. δ³⁷Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine

  3. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  4. Multibeam collection for KN194-04: Multibeam data collected aboard Knorr from 2008-10-03 to 2008-10-31, Reykjavik, Iceland to Reykjavik, Iceland

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  5. Uso de drogas entre anestesiologistas no contexto das relações de trabalho -doi:10.5020/18061230.2008.p194

    OpenAIRE

    Marcelo Niel; Alessandra Maria Julião; Denise Martin; Dartiu Xavier da Silveira Filho

    2012-01-01

    Objetivo: Compreender o uso de drogas por médicos anestesiologistas, tendo como enfoque o contexto das relações de trabalho. Métodos: Tratou-se de pesquisa qualitativa fenomenológica. Os dados foram coletados a partir da realização de entrevistas em profundidade com quinze sujeitos médicos anestesiologistas. Realizou-se a análise do conteúdo das entrevistas a partir da organização em categorias relevantes aos temas, como a constatação do uso de drogas no contexto da profissão, o acesso facili...

  6. Comment on “Spin manipulation of 1.94  GeV/c polarized protons stored in the COSY cooler synchrotron”

    Directory of Open Access Journals (Sweden)

    M. Bai

    2005-09-01

    Full Text Available We show that the formula of the strength of the spin resonance driven by a rf dipole in the commented paper is incorrect. A derivation of the resonance strength due to direct spin rotation from a rf dipole is shown. The result of a numerical simulation to verify our derivation is also presented.

  7. AB194. A 12-year retrospective evaluation of TVT and TVT-O in the surgical management of SUI in females and the analysis of influence factors

    Science.gov (United States)

    Zhu, Kejia; Liu, Yaxiao; Chen, Fan; Cheng, Shanshan; Yang, Yue; Shi, Benkang

    2016-01-01

    Objective We evaluate the clinical effect of TVT and TVT-O slings in the surgical management of SUI in women at mostly 12-year follow-ups and the factors that influence it. Methods In this retrospective analysis, 94 women with stress incontinence treated by TVT (14 cases) or TVT-O (80 cases) were included. Subjective evaluation included ICIQ-SF, KHQ, PGI-I and patient satisfaction, and we recorded the objective data of the procedures. We analyzed whether the age, BMI, disease duration, surgery history, postoperative follow-up duration or other factors were related to the subjective cure rate. Results Eight cases of TVT and 59 cases of TVT-O completed the follow-up. Patients were followed up for 1.3–12 years in TVT and 0.2–9.2 years in TVT-O group. The rates of subjectively assessed success were 87.5% and 84.7%, respectively (P=1.00). The total KHQ were (21.93±30.42) and (16.89±25.85) (P=0.55). The operation duration were (59.29±21.02) in TVT group and (29.87±12.04) in TVT-O group (P=0.00). The postoperative days of indwelling catheter were (4.14±1.79) and (3.11±1.51) (P=0.02), and the post-operation hospitalization days were (5.64±2.06) and (5.01±1.77) (P=0.27). The factors above didn’t affect the subjective cure rate. Conclusions The patient reported long-term success rate were both high and had no significant differences between the groups. Operation duration and postoperative durations of indwelling catheter of TVT-O was shorter. The factors above didn’t affect the subjective cure rate.

  8. Spectral and timing properties of MAXI J1836-194 during its 2011 outburst and estimation of mass with TCAF solution

    Science.gov (United States)

    Jana, Arghajit; Debnath, Dipak; Chakrabarti, Sandip Kumar; Mondal, Santanu; Chatterjee, Debjit; Molla, Aslam Ali

    2016-07-01

    We make a detailed analysis of the BHC using 2.5-25 keV RXTE/PCA data with two components advective flow (TCAF) model generated fits file as an additive table model in XSPEC. From the spectral analysis, we extract Keplerian disk rate, sub-Keplerian halo rate, shock location and compression ratio. We also estimate mass of the BHC from spectral analysis and we find it in the range of 7.5-11 M_{Sun}. During the entire outburst we keep the normalization in a very narrow range of 0.25-0.35 except a few days when radio jet is observed. We find quasi periodic oscillation (QPO) frequencies are in sporadic nature. From the variation of accretion rate ratio (ARR=halo rate/disk rate), QPO frequencies and photon indices, we classify the outburst in two states - hard and hard-intermediate. Unlike other BHC, soft and soft-intermediate states are absent during the entire outburst. This may be the reason due to the fact that the BHC is immersed within the excreation disk of the companion which is a Be star.

  9. Personal Factors Associated with Sickness Absence: A Study of 194 Men with Contrasting Sickness Absence Experience in a Refinery Population1

    Science.gov (United States)

    Taylor, P. J.

    1968-01-01

    Men with different patterns of sickness absence behaviour have been identified from a refinery population by simple epidemiological techniques. A detailed clinical study is described of four groups: 56 men with five or more sickness spells in 1964 and a matched control of 56 men; 35 men who had 60 or more days of sickness absence in 1964; and finally 47 men who had not had one day off sick for at least eight years. Whereas the men who were frequently sick tended to be younger and mostly on day work, those with long periods of sickness were reasonably representative of the whole population, and the men without any sickness absence were older and mostly on shift work. An analysis of records both before and since 1964 showed that the groups had maintained a consistent pattern of sickness absence, but when individuals were considered their behaviour was less consistent. Nevertheless there appeared to be states of sickness absence `liability' and also `resistance' which persisted for a variable length of time from a year or two up to many years. The pre-employment medical examination proved in retrospect to have been of little predictive value. Absenteeism, lateness, and also occupational injuries were all strongly associated with sickness spells, although the level of overtime was not. Previous episodes of neurotic illness, peptic ulceration, and loss of work due to back pain were also associated with frequent sickness spells, so also were frequent colds and troublesome constipation. An unexpected finding from the physical examination was that over one quarter of those who were never sick had some organic disease. Although neither the social nor economic circumstances differed between the groups, the attitude of the men towards themselves and their work proved to be of major importance. A memory of an unhappy childhood was more common in both groups with a lot of sickness absence, whilst dislike of the job or frustrated ambition was common in men with frequent spells. Those who were never sick denied all such problems as they denied illness. Personality testing revealed that extroversion was more marked in the frequently sick group, neuroticism in the long sick, and introversion in the never sick. The validity and significance of the results are discussed and suggestions are made for further investigation. PMID:4231051

  10. American Recovery and Reinvestment Act ( ARRA) FEMP Technical Assistance, U.S. General Services Administration - Project 194 U.S. Custom Cargo Inspection Facility, Detroit, MI

    Energy Technology Data Exchange (ETDEWEB)

    Arends, J.; Sandusky, William F.

    2010-05-31

    This report documents the findings of an on-site audit of the U.S. Customs Cargo Inspection Facility (CIF) in Detroit, Michigan. The federal landlord for this building is the General Services Administration (GSA). The focus of the audit was to identify various no-cost or low-cost energy-efficiency opportunities that, once implemented, would reduce electrical and gas consumption and increase the operational efficiency of the building. This audit also provided an opportunity to identify potential capital cost projects that should be considered in the future to acquire additional energy (electric and gas) and water savings to further increase the operational efficiency of the building.

  11. Publisher’s Note to Modeling the influence of potassium content and heating rate on biomass pyrolysis [Appl. Energy J. 194 (2017) 199–211

    DEFF Research Database (Denmark)

    Trubetskaya, Anna; Surup, Gerrit; Shapiro, Alexander

    2017-01-01

    The authors and the editors regret to report that the following errors were found in the article after its availability online.......The authors and the editors regret to report that the following errors were found in the article after its availability online....

  12. Immunohistochemical changes in the expression of HSP27 in exercised human vastus lateralis muscle”. Acta Physiologica (Oxf). 194(3): 215-22, 2008

    DEFF Research Database (Denmark)

    Folkesson, Mattias; Mackey, A L; Holm, Lars

    2008-01-01

    27 protein in muscle fibres from five of nine subjects. The number of fibres with accumulation of HSP27 in RE ranged from 0% to 32% with a mean of 6.3% of the total number of fibres. CONCLUSION: We conclude that this rapid HSP27 protein relocation after RE is an important player in the cellular...... remodelling of human muscle fibres in response to exercise involving high-force contractions, but not in response to endurance exercises....

  13. DOE's Notification of Planned Change to the EPA 40 CFR Part 194 Certification of the Waste Isolation Pilot Plant: Remote-Handled Transuranic Waste Characterization Plan

    Science.gov (United States)

    The U.S. Department of Energy's Carlsbad Field Office (DOE/CBFO) provided the U.S. Environmental Protection Agency (EPA) this Notification of Planned Change to accept remote-handled (RH) transuranic (TRU) waste at the Waste Isolation Pilot Plant (WIPP).

  14. 22 CFR Appendix A to Part 194 - Inter-American Commercial Arbitration Commission Rules of Procedure (As Amended April 1, 2002)

    Science.gov (United States)

    2010-04-01

    ..., shall be accompanied by a translation into the language or languages agreed upon by the parties or... shall make arrangements for the translation of oral statements made at a hearing and for a record of the... legal representation and assistance of the successful party if such costs were claimed during the...

  15. 194. Tratamiento quirúrgico de la miocardiopatía hipertrófica obstructiva mediante la técnica de Konno modificada

    Directory of Open Access Journals (Sweden)

    G. Candela Navarro

    2010-01-01

    Conclusiones: Esta técnica supone una alternativa a la cirugía convencional de la MHO, cambiando la resección muscular (Morrow por la ampliación del tracto de salida de ventrículo izquierdo (VI en la zona hipertrofiada. En nuestro caso se ha mostrado eficaz y segura, y ha proporcionado resultados estables en el tiempo.

  16. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  17. Production cross section of At radionuclides from 7Li+natPb and 9Be+natTl reactions

    Science.gov (United States)

    Maiti, Moumita; Lahiri, Susanta

    2011-12-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from 6,7Li- and 9Be-induced reactions on natural lead and thallium targets, respectively. The production of astatine radionuclides were investigated experimentally with two heavy-ion-induced reactions: 9Be + natTl and 7Li + natPb. Formation cross sections of the evaporation residues, 207,208,209,210At, produced in the (HI,xn) channel, were measured by the stacked-foil technique followed by off-line γ spectrometry at low incident energies (<50 MeV). Measured excitation functions were interpreted in terms of a compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach models. Measured cross-section values are lower than the respective theoretical predictions.

  18. Le palais d’Aiétès et son jardin chez Apollonios de Rhodes (Arg., III, v. 194-252. Un exemple de paysage-palimpseste antique ? The Palace of Aeetes and its Garden in Apollonius of Rhodes (Arg., III, lines 194-252. An example of ancient landscape as palimpsest? Il palazzo di Eeta e il suo giardino in Apollonio Rodio (Arg., III, 194-252. Un esempio di paesaggio-palinsesto antico?

    Directory of Open Access Journals (Sweden)

    Laury-Nuria André

    2012-07-01

    Full Text Available Lorsque le lecteur découvre au chant III des Argonautiques d’Apollonios de Rhodes l’espace du « paysage urbain » colque, au fur et à mesure de la progression visuelle des personnages, se dessine mentalement tout un espace littéraire fait de réminiscences homériques. L’espace végétal semble composé d’un bouquet d’intertextes de nature endogène tandis que l’architecture palatiale combine structure archaïque et ornements hellénistiques. Nulle trace d’exotisme donc, mais un espace composé de référents grecs typiques. Du fait de ces référents littéraires, la construction de l’espace palatial urbain emprunte sa configuration même au type d’écriture poétique sollicité par le poète épique : la réécriture. Comment comprendre alors que le palais d’Aiétès puisse être à l’image du palais du souverain grec hellénistique, image idéale d’une architecture s’inscrivant dans l’ordre divin ? Il faut voir ici non seulement la mise en image, l’illustration concrète via l’architecture et, partant, le « paysage urbain » qui se singularise par sa nature hybride, de la volonté de rapprocher Orient et Occident, mais aussi et surtout les moyens mêmes de cette mise en œuvre. Le palais et son jardin ne seraient alors qu’une promesse, un prototype d’un modèle idéal à étendre, grandeur nature, sur l’ensemble du territoire colque, et de l’oïkoumène tout entière.When the reader of the third book of Apollonius of Rhodes discovers, in the course of the characters’ visual progression, the space of a Colchian “urban landscape”, s/he mentally creates a literary space made of Homeric recollections. The garden space seems composed of a bouquet of intertexts of endogenous nature, whereas the palatial architecture combines archaic structure with hellenistic ornamentation. So no trace of the exotic, but a space composed of typical Greek references. As a result of these literary references, the construction of palatial urban space borrows its own configuration from the type of poetic writing the epic poet himself solicits: re-writing. How else can one explain that the palace of Aeetes can be the image of a hellenistic Greek royal palace, the perfect image of an architecture that inscribes itself into a divine order? One should see here not only the reconfiguration, the concrete illustration through the archictecture and, consequently, the urban “landscape” of such an unusual hybrid character, as a result of the wish to reconcile East and West, but also, perhaps especially, the means of its implementation. The palace and garden would then only be a promise, an ideal prototype to be extended, on a large scale, over all of the Colchian land and the entire oekoumene.Quando il lettore scopre, nel terzo libro delle Argonautiche di Apollonio Rodio, lo spazio del ‘paesaggio urbano’ colco, via che progredisce la visuale dei personaggi, viene tracciato mentalmente tutto uno spazio letterario fatto di reminiscenze omeriche. Lo spazio vegetale sembra composto da un insieme di intertesti endogeni, laddove l’architettura palaziale combina struttura arcaica e decorazioni ellenistiche. Nessuna traccia d’esotismo, quindi, ma uno spazio composto di tipici referenti greci. A partire da questi referenti letterari, la costruzione dello spazio palaziale urbano deve la sua stessa configurazione al tipo di scrittura poetica sollecitata dal poeta epico: la riscrittura. Come comprendere, allora, che il palazzo di Eeta possa essere a immagine del palazzo del sovrano greco ellenistico, immagine ideale di un’architettura che si inscrive nell’ordine divino? Occorre vedere qui non soltanto la raffigurazione, l’illustrazione concreta tramite l’architettura e, perciò, il ‘paesaggio urbano’ che si distingue per la sua natura ibrida, dalla volontà di avvicinare Oriente e Occidente, ma anche e soprattutto i mezzi stessi di questa attuazione. Il palazzo e il suo giardino non sarebbero allora altro che una promessa, un prototipo di un modello ideale da estendere, in scala naturale, all’insieme del territorio colco e dell’intera ecumene.

  19. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Koziorowski, J

    1998-10-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on {sup 211}At and {sup 124}I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[{sup 211}At]astato-2`-deoxyuridine (AUdR) and N-succinimidyl-4-[{sup 211}At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [{sup 124}I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[{sup 124}I]iodo-2`-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for

  20. Multibeam collection for KN194-02: Multibeam data collected aboard Knorr from 2008-09-01 to 2008-09-23, departing from Nuuk (Godthab), Greenland and returning to Nuuk (Godthab), Greenland

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  1. Comments on the paper: M. Pawlak, K. Strzałkowski, Identification of the photoluminescence response in the frequency domain modulated infrared radiometry signal of ZnTe:Cr bulk crystal, Infrared Phys. Technol. 78 (2016) 190-194

    Science.gov (United States)

    Pawlak, M.

    2017-09-01

    The frequency-domain expression for the photoluminescence signal SPL (the photocarrier radiometry signal which is the form of the near infrared photoluminescence) which consists of the discrete lifetimes can be written as following [1

  2. Reply to “Comment on ‘Spin manipulation of 1.94  GeV/c polarized protons stored in the COSY cooler synchrotron’ ”

    Directory of Open Access Journals (Sweden)

    V. S. Morozov

    2005-09-01

    Full Text Available It seems improper to publish a theoretical Comment about an experimental Article without mentioning the Article’s referenced theoretical paper, which derived the equation that the Comment claims is incorrect. Our experimental collaboration declines to offer any opinion about which factor of 2 is correct.

  3. Review: Husserl and Stein Edited by Richard Feist and William Sweet Contemporary Change, Series I, Vol. 31 The Council for Research in Values and Philosophy, 2003. Pp. vi + 202. ISBN: 1–56518–194–8

    OpenAIRE

    Lebech, Mette

    2007-01-01

    Husserl and Stein is a collection of essays relating to these two thinkers. The individual essays are mostly of very good quality, highlighting aspects which are often left underdeveloped: Husserl’s relations to his colleagues in mathematics and to his assistant Stein, as well as problems in Stein’s philosophy. The book sheds interesting light on early phenomenology and on the problems that spurred its development.

  4. Ana Hours et Jean-Pierre Piéchaud (coord., 2010, Penser la métropole parisienne, Plaidoyer pour un projet citoyen, égalitaire et postcarbone, L’Harmattan-Les Editions des Recollets, 194 p.

    Directory of Open Access Journals (Sweden)

    Jacques Stambouli

    2010-09-01

    Full Text Available Comment penser la métropole, dans le cas de l’agglomération parisienne ? Comment y penser un développement urbain durable ? L’association 4D, dans le cadre de l’Encyclopédie du développement durable (www.encyclopedie-dd.org, a choisi de rassembler sur ces sujets 19 contributions, venant principalement d’acteurs de terrain, responsables politiques ou administratifs, techniciens, membres d’associations. En conclusion, l’association propose une synthèse, parmi les pistes à suivre les plus stimu...

  5. Physical data collected from Seaglider SG194 during Cuddy Survey in the North Pacific Ocean, Coastal Waters of Washington/Oregon deployed from 2013-10-25 to 2014-05-10 (NCEI Accession 0162349)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Seaglider is a buoyancy driven autonomous underwater vehicle (AUV) developed by scientists and engineers at the University of Washington's School of Oceanography and...

  6. Dicty_cDB: Contig-U10506-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available = 9e-54 Identities = 194/194 (100%) Strand = Plus / Plus Query: 14 tccaaanaaaatccnanaaccatatttnttaatattnccaa...aatcgganatcatcnttnc 73 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 14 tccaaanaaaatccna...ct: 74 caatttnganaaaaccnttggnaaaacttggnttattgattttgaaaaanaaacaactaa 133 Query: 134 aatccnanatggnagnttcnttncn...||||||||||||||||||| Sbjct: 134 aatccnanatggnagnttcnttncnaatattnaaaanacnttnattcnttggaanagaca 193 Query: 194 n... Score = 206 bits (104), Expect(2) = 2e-60 Identities = 194/194 (100%) Strand = Plus / Minus Query: 14 tccaaanaaaatccna

  7. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...

  8. ORF Alignment: NC_005070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available FSVEFIRNTHSMADSYSLAIKTPVGTIIFTGDFKFDHTPVDGEHFDMARLAHHG 194 ... VKVGQHFSVEFIRNTHSMADSYSLAIKTPVGTIIFTGDFKFDHTPVDGEHFDM...ARLAHHG Sbjct: 121 VKVGQHFSVEFIRNTHSMADSYSLAIKTPVGTIIFTGDFKFDHTPVDGEHFDM

  9. ORF Alignment: NC_005126 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NTFCGGLDLQIF 60 ... Query: 135 FAAENAKFRIEETNIGMMADLGILQRLQHLIPSGIARYLALTGDTLSAVQAHDLGLVVKV 194 ... FAAENAKFRIEETNIGMMAD...LGILQRLQHLIPSGIARYLALTGDTLSAVQAHDLGLVVKV Sbjct: 121 FAAENAKFRIEETNIGMMAD

  10. Making Riflemen from Mud: Restoring the Army’s Culture of Irregular Warfare (CSL Student Issue Paper, Volume S01-07, Jul 2007)

    Science.gov (United States)

    2007-07-01

    Services Detachment 101, Nazira , India, 194-194, U.S. Army Military History Institute Stacks number D767.6.U56. 14 During the war in the Pacific...Strategic Services, Special Unit, Detachment 101, Office of Strategic Services Detachment 101, Nazira , India, 194-194, U.S. Army Military History

  11. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC194 (Link to dictyBase) - - - Contig-U16455-1 VFC194P (Link... to Original site) VFC194F 385 VFC194Z 544 VFC194P 929 - - Show VFC194 Library VF (Link to library) Clone ID VFC194 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL http://dict...0.0 2 AF016242 |AF016242.1 Dictyostelium discoideum protein synthesis elongation factor 1-alpha (tef2) gene,...4.0 %: peroxisomal >> prediction for VFC194 is nuc 5' end seq. ID VFC194F 5' end seq. >VFC194F.Seq CTGTTGGCC

  12. Compensatory structural and functional adaptation after radical nephrectomy for renal cell carcinoma according to preoperative stage of chronic kidney disease. Choi DK, Jung SB, Park BH, Jeong BC, Seo SI, Jeon SS, Lee HM, Choi HY, Jeon HG.J Urol. 2015 Oct;194(4):910-5. [Epub 2015 Apr 28]. doi: 10.1016/j.juro.2015.04.093.

    Science.gov (United States)

    Jay, Raman; Jung, S B; Park, B H; Jeong, B C; Seo, S I; Jeon, S S; Lee, H M; Choi, H Y; Jeon, H G

    2017-03-01

    We investigated structural hypertrophy and functional hyperfiltration as compensatory adaptations after radical nephrectomy in patients with renal cell carcinoma according to the preoperative chronic kidney disease stage. We retrospectively identified 543 patients who underwent radical nephrectomy for renal cell carcinoma between 1997 and 2012. Patients were classified according to preoperative glomerular filtration rate as no chronic kidney disease-glomerular filtration rate 90ml/min/1.73m2 or greater (230, 42.4%), chronic kidney disease stage II-glomerular filtration rate 60 to less than 90ml/min/1.73m2 (227, 41.8%), and chronic kidney disease stage III-glomerular filtration rate 30 to less than 60ml/min/1.73m2 (86, 15.8%). Computerized tomography performed within 2 months before surgery and 1 year after surgery was used to assess functional renal volume for measuring the degree of hypertrophy of the remnant kidney, and the preoperative and postoperative glomerular filtration rate per unit volume of functional renal volume was used to calculate the degree of hyperfiltration. Among all patients (mean age = 56.0y) mean preoperative glomerular filtration rate, functional renal volume, and glomerular filtration rate/functional renal volume were 83.2ml/min/1.73m2, 340.6cm3, and 0.25ml/min/1.73m2/cm3, respectively. The percent reduction in glomerular filtration rate was statistically significant according to chronic kidney disease stage (no chronic kidney disease 31.2% vs. stage II 26.5% vs. stage III 12.8%, Prenal volume in the remnant kidney was not statistically significant (no chronic kidney disease 18.5% vs. stage II 17.3% vs. stage III 16.5%, P = 0.250). The change in glomerular filtration rate/functional renal volume was statistically significant (no chronic kidney disease 18.5% vs. stage II 20.1% vs. stage III 45.9%, Prenal volume above the mean value were body mass index (P = 0.012), diabetes mellitus (P = 0.023), hypertension (P = 0.015), and chronic kidney disease stage (Prenal function than those with a higher preoperative glomerular filtration rate due to greater degrees of functional hyperfiltration. Copyright © 2017. Published by Elsevier Inc.

  13. Gclust Server: 9651 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences Related Sequences(29) 194 Tripartite ATP-independent periplasmic transporter, DctQ component 11 1...194 Representative annotation Tripartite ATP-independent periplasmic transporter, DctQ component Number

  14. ORF Alignment: NC_002946 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VE ... Sbjct: 1 ... IAVSVGEASGDLLGAHLIRAIRKRCPQARLTGIGGELMKAEGFESLYDQERLAVRGFVEV 60 ... Query: 135 RRERVGKIVHQVNRVLCLFPMEPQLYLDAGGRAEFVGHPMA...QLMPLEDDRETARKTLGAD 194 ... RRERVGKIVHQVNRVLCLFPMEPQLYLDAGGRAEFVGHPMAQLMPLEDD...RETARKTLGAD Sbjct: 121 RRERVGKIVHQVNRVLCLFPMEPQLYLDAGGRAEFVGHPMAQLMPLEDDRETARKTLG

  15. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  16. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  17. Nuclear and in-source laser spectroscopy with the ISAC yield station

    Energy Technology Data Exchange (ETDEWEB)

    Kunz, Peter, E-mail: pkunz@triumf.ca; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning [TRIUMF, 4004 Wesbrook Mall, Vancouver, British Columbia V6T 2A3 (Canada); Andreoiu, Corina; Wong, Fiona [Department of Chemistry, Simon Fraser University, Burnaby, British Columbia V5A 1S6 (Canada)

    2014-05-15

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10{sup 11} ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of {sup 46}K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  18. Nuclear and in-source laser spectroscopy with the ISAC yield station.

    Science.gov (United States)

    Kunz, Peter; Andreoiu, Corina; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning; Wong, Fiona

    2014-05-01

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10(11) ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of (46)K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  19. Radiopharmaceutical chemistry of targeted radiotherapeutics, part 4: Strategies for211At labeling at high activities and radiation doses of211At α-particles.

    Science.gov (United States)

    Pozzi, Oscar R; Zalutsky, Michael R

    2017-03-01

    Alpha particles are radiation of high energy and short range, properties that can lead to radiolysis-mediated complications in labeling chemistry at the high radioactivity levels required for clinical application. In previous papers in this series, we have shown that radiation dose has a profound effect on the astatine species that are present in the labeling reaction and their suitability for the synthesis of N-succinimidyl 3-[ 211 At]astatobenzoate. The purpose of this study was to evaluate the effects of adding N-chlorosuccinimide (NCS) to the methanol solution used for initial isolation of 211 At after distillation, a process referred to as 211 At stabilization, on 211 At chemistry after exposure to high radiation doses. High performance liquid chromatography was used to evaluate the distribution of 211 At species present in methanol in the 500-65,000Gy radiation dose range and the synthesis of SAB from N-succinimidyl 3-(tri-n-butylstannyl)benzoate in the 500-120,000Gy radiation dose range using different 211 At timeactivity combinations under conditions with/without 211 At stabilization. In the absence of NCS stabilization, a reduced form of astatine, At(2), increased with increasing radiation dose, accounting for about half the total activity by about 15,000Gy, while with stabilization, At(2) accounted for 60,000Gy. SAB yields without stabilization rapidly declined with increasing dose, falling to ~20% at about 5000Gy while with stabilization, yields >80% were obtained with 211 At solutions stored for more than 23h and receiving radiation doses >100,000Gy. Adding NCS to the methanol solution used for initial isolation of 211 At is a promising strategy for countering the deleterious effects of radiolysis on 211 At chemistry. This strategy could facilitate the ability to perform 211 At labeling at sites remote from its production and at the high activity levels required for clinical applications. Copyright © 2016 Elsevier Inc. All rights reserved.

  20. Dicty_cDB: SFA691 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 510164 |AJ510164.1 Cloning vector pDXA-3strep. 194 7e-47 2 X85119 |X85119.1 Artificial... sequences cloning vector DNA pDXA-3H. 194 7e-47 2 X85122 |X85122.1 Artificial sequences cloning vector... DNA pDXA-HY. 194 7e-47 2 AJ510165 |AJ510165.1 Cloning vector pDXA-3FLAG. 194 7e-47 2 X85118 |X85118.1 Artificial... sequences cloning vector DNA pDXA-3C. 194 7e-47 2 X85123 |X85123.1 Artificial... sequence. 194 7e-47 2 X85120 |X85120.1 Artificial sequences cloning vector DNA pDXD-3H. 194 8e-47 2 AJ51016

  1. Urologic Oncologic SurveyRobotic level III inferior vena cava tumor thrombectomy: Initial series. Gill IS, Metcalfe C, Abreu A, Duddalwar V, Chopra S, Cunningham M, Thangathurai D, Ukimura O, Satkunasivam R, Hung A, Papalia R, Aron M, Desai M, Gallucci M. J Urol. 2015 Oct;194(4):929-938. [Epub 2015 Apr 6]. doi: 10.1016/j.juro.2015.03.119.

    Science.gov (United States)

    Meng, Max

    2017-05-01

    Level III inferior vena cava tumor thrombectomy for renal cancer is one of the most challenging open urologic surgeries. We present the initial series of completely intracorporeal robotic level III inferior vena cava tumor thrombectomy. Nine patients underwent robotic level III inferior vena cava thrombectomy and 7 patients underwent level II thrombectomy. The entire operation (high intrahepatic inferior vena cava control, caval exclusion, tumor thrombectomy, inferior vena cava repair, radical nephrectomy, and retroperitoneal lymphadenectomy) was performed exclusively robotically. To minimize the chances of intraoperative inferior vena cava thrombus embolization, an "inferior vena cava-first, kidney-last" robotic technique was developed. Data were accrued prospectively. All 16 robotic procedures were successful, without open conversion or mortality. For level III cases (9), median primary kidney (right 6, left 3) cancer size was 8.5cm (range: 5.3-10.8) and inferior vena cava thrombus length was 5.7cm (range: 4-7). Median operative time was 4.9 hours (range: 4.5-6.3), estimated blood loss was 375ml (range: 200-7,000), and hospital stay was 4.5 days. All surgical margins were negative. There were no intraoperative complications and 1 postoperative complication (Clavien 3b). At a median 7 months of follow-up (range: 1-18) all patients are alive. Compared to level II thrombi the level III cohort trended toward greater inferior vena cava thrombus length (3.3 vs 5.7cm), operative time (4.5 vs 4.9h) and blood loss (290 vs 375ml). With appropriate patient selection, surgical planning and robotic experience, completely intracorporeal robotic level III inferior vena cava thrombectomy is feasible and can be performed efficiently. Larger experience, longer follow-up and comparison with open surgery are needed to confirm these initial outcomes. Copyright © 2017. Published by Elsevier Inc.

  2. ORF Alignment: NC_003037 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1021) ... magaplasmid pSymA ... Length = 215 ... Query: 74 ... LDRREHLIGVAASFEAHVEKRLVVAIDELYPEHALG...ELFAEFAVHFPHVELELLFPMMED 133 ... LDRREHLIGVAASFEAHVEKRLVVAIDELYPEHALGELFAEFAVHFPHVELELLFPMMED Sbjct: ...1 ... LDRREHLIGVAASFEAHVEKRLVVAIDELYPEHALGELFAEFAVHFPHVELELLFPMMED 60 ... Query: 194 I

  3. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... sulfurreducens PCA] ... Length = 194 ... Query: 352 MVSRQGALKRVQVHIGAGEGSAVAVTDPHXXXXXXXXXXXXARDAMPD...GGRLDVAVSTGA 411 ... MVSRQGALKRVQVHIGAGEGSAVAVTDPH ... ARDAMPDGGRLD...VAVSTGA Sbjct: 23 ... MVSRQGALKRVQVHIGAGEGSAVAVTDPHQLQQVLINLLINARDAMPDGGRLDVAVSTGA 82 ... Query: 472 IFDPFFTTKEPGR

  4. [Thiele, C. Minderheitenschutz in Estland : werden die Rechtsnormen der politischen Wirklichkeit gerecht?] / Г. Андреева

    Index Scriptorium Estoniae

    Андреева, Г. Н.

    2002-01-01

    Tutv. art.: Thiele, Carmen. Minderheitenschutz in Estland : werden die Rechtsnormen der politischen Wirklichkeit gerecht? // Moderner Minderheitenschutz : rechtliche oder politische Absicherung? Bonn, 1998, lk. 185-194

  5. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available putative [Entamoeba histolytica HM-1:IMSS] ... Length = 194 ... Query: 220 LDVAPLTLGIETAGGVMTALIPRNSTIPA...KKSEIFSTYADNQAEVLIQVFEGEASMTKHC 279 ... LDVAPLTLGIETAGGVMTALIPRNSTIPAKKSEIFSTYADNQAEVLIQVFEGEASMTKHC Sbjct: 1 ... LDVAPLTLGIETAG

  6. ORF Alignment: NC_002570 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... halodurans C-125] ... Length = 139 ... Query: 74 ... FIQSVSTLPKYQMIYDIPPAEINTRDKKRMMADHYALWRIEDPL...RMISNVGSLQGAEAIL 133 ... FIQSVSTLPKYQMIYDIPPAEINTRDKKRMMADHYALWRIEDPLRMISNVGSLQGAEAIL Sbjct: 1 ... FIQS...VSTLPKYQMIYDIPPAEINTRDKKRMMADHYALWRIEDPLRMISNVGSLQGAEAIL 60 ... Query: 194 DLPKENEEA

  7. Risk factors for complications associated with uppergastrointestinal foreign bodies

    National Research Council Canada - National Science Library

    2015-01-01

    ...: We retrospectively reviewed the medicalrecords of 194 patients with a diagnosis of foreign bodyimpaction in the upper gastrointestinal tract, confirmedby endoscopy, at two university hospital in South...

  8. Appraisal of geomorphology of the Goa coast

    Digital Repository Service at National Institute of Oceanography (India)

    Wagle, B.G.; Kunte, P.D.

    stream_size 7 stream_content_type text/plain stream_name Proc_Workshop_Coast_Mar_Area_Manage_Plan_Goa_1999_194.pdf.txt stream_source_info Proc_Workshop_Coast_Mar_Area_Manage_Plan_Goa_1999_194.pdf.txt Content-Encoding ISO-8859...

  9. Science Academies' XLVII Refresher Course in Experimental Physics

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 2. Science Academies' XLVII Refresher Course in Experimental Physics. Information and Announcements Volume 18 Issue 2 February 2013 pp 194-194. Fulltext. Click here to view fulltext PDF. Permanent link:

  10. GETDB: 113551 [GETDB

    Lifescience Database Archive (English)

    Full Text Available Genetics. FM7c Link to clone table - 1 194 Link to cluster table 194 1 Request - uniform epidermal from stg 10. prob better...dermal from stg 10. prob better than 32B. Larval GFP ubiquitous in larval tissue. disc not apparent. Larval

  11. Pamjat teksta i tekst kak pamjat / Ülle Pärli

    Index Scriptorium Estoniae

    Pärli, Ülle

    1999-01-01

    Bibl. lk. 194. Kokkuvõtted eesti k. "Teksti mälu ja tekst kui mälu" ning inglise k. "The memory of a text and text as a memory", lk. 194-195. Jossif Brodski luuletusest "Järelsõna valmile" ("Posleslovije k basne")

  12. Human recombinant antibodies against Plasmodium falciparum merozoite surface protein 3 cloned from peripheral blood leukocytes of individuals with immunity to malaria demonstrate antiparasitic properties

    DEFF Research Database (Denmark)

    Lundquist, Rasmus; Nielsen, Leif Kofoed; Jafarshad, Ali

    2006-01-01

    against MSP-3 residues 194 to 257 (MSP-3(194-257)) on the molecular level. mRNA from peripheral blood leukocytes from clinically immune individuals was used as a source of Fab (fragment antibody) genes. A Fab-phage display library was made, and three distinct antibodies designated RAM1, RAM2, and RAM3...

  13. Norman Ernest Borlaug (1914–2009)

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 19; Issue 2. Norman Ernest Borlaug (1914–2009). Featured Scientist Volume 19 Issue 2 February 2014 pp 194-194. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/019/02/0194-0194. Resonance – Journal ...

  14. EST Table: CK542222 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK542222 rswhb0_006655.y1 10/09/29 96 %/194 aa ref|NP_001091829.1| vacuolar ATP syn...i] 10/08/31 95 %/194 aa FBpp0263620|DyakGE18610-PA 10/08/28 88 %/196 aa Y49A3A.2#CE22210#WBGene00013025#locu

  15. Dicty_cDB: AFB519 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available stercoralis cDNA 5' similar to WP:C41C4.8 CE05402 TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE HOMOLOG 2 ;, mRNA...stercoralis cDNA 5' similar to WP:C41C4.8 CE05402 TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE HOMOLOG 2 ;, mRNA...embryo spinal... 194 1e-48 S25197( S25197 ;S30329) transitional endoplasmic reticulum ATPase ... 194 1e-48...DKFZp434K0... 194 1e-48 ( P03974 ) RecName: Full=Transitional endoplasmic reticulum ATPase... 194 1e-48 AK169140_1(...RecName: Full=Transitional endoplasmic reticulum ATPase... 194 1e-48 (Q3ZBT1) RecName: Full=Transitional endoplasmic

  16. Alpha particle emitters in medicine

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, D.R.

    1989-09-01

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ({sup 211}At) and natural bismuth-212 ({sup 212}Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ({sup 223}Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs.

  17. α decay of the very neutron-deficient isotopes 197-199Fr

    Science.gov (United States)

    Kalaninová, Z.; Andreyev, A. N.; Antalic, S.; Heßberger, F. P.; Ackermann, D.; Andel, B.; Drummond, M. C.; Hofmann, S.; Huyse, M.; Kindler, B.; Lane, J. F. W.; Liberati, V.; Lommel, B.; Page, R. D.; Rapisarda, E.; Sandhu, K.; Šáro, Š.; Thornthwaite, A.; Van Duppen, P.

    2013-04-01

    Decay properties of the very neutron-deficient isotopes 197-199Fr were studied at the velocity filter Separator for Heavy Ion reaction Products (SHIP) at GSI in Darmstadt. The isotopes were produced in the 2n-4n evaporation channels of the fusion-evaporation reaction 60Ni+141Pr → 201Fr*. Improved α-decay properties of 199Fr were determined and the possible existence of two α-decaying states in this nucleus is discussed. For the isotope 198Fr a broad α-decay energy distribution was detected in the range of (7470-7930) keV and two α-decaying states were observed with half-lives of 1.1(7) and 15(3) ms. The new isotope 197Fr was identified based on the observation of one α-decay chain yielding Eα=7728(15) keV and T1/2=0.6-0.3+3.0 ms. The systematics of reduced α-decay widths are presented for neutron-deficient francium, radon, and astatine isotopes.

  18. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Directory of Open Access Journals (Sweden)

    Sherif S Nafee

    Full Text Available Thallium (81(217Tl, Bismuth (83(217Bi, Astatine (85(217At, Francium (87(217Fr, Actinium (89(217Ac and Protactinium (91(217Pa are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221Fr-, (221Ac- and (221Pa-α-decays.

  19. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Science.gov (United States)

    Nafee, Sherif S; Shaheen, Salem A; Al-Ramady, Amir M

    2016-01-01

    Thallium (81(217)Tl, Bismuth (83(217)Bi), Astatine (85(217)At), Francium (87(217)Fr), Actinium (89(217)Ac) and Protactinium (91(217)Pa) are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α) has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF) calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221)Fr-, (221)Ac- and (221)Pa-α-decays.

  20. On the theory of time dilation in chemical kinetics

    Science.gov (United States)

    Baig, Mirza Wasif

    2017-10-01

    The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

  1. SPECT assay of radiolabeled monoclonal antibodies. Progress report, September 1, 1992--August 24, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1993-08-20

    The overall goal of this project is to improve the effectiveness of single photon emission computed tomography (SPECT) to image and quantify radiolabeled monoclonal antibodies. During the past year, we have made significant progress toward this goal, and this report summarizes that work. Our efforts have been mainly directed along three fronts. First, we have developed and tested new reconstruction methods including three-dimensional iterative algorithms that model non-uniform attenuation and distance-dependent detector response. Both fan beam and parallel beam collimator geometries have been modeled and novel ways of improving the efficiency of the computationally intensive methods have been introduced. Second, an ultra-high resolution, small field-of-view pinhole collimator has been constructed and evaluated. Reconstructed spatial resolution of 1 to 3 mm (FWHM) has been achieved in phantom scans with a useful field-of-view of 9 to 10 cm. Finally, we have investigated the ability of SPECT to image and quantify astatine-211 distributions. Reconstructed images of phantom data demonstrated quantitative accuracy to within 10% with proper attenuation and scatter compensation.

  2. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Science.gov (United States)

    Marsh, B. A.; Andel, B.; Andreyev, A. N.; Antalic, S.; Atanasov, D.; Barzakh, A. E.; Bastin, B.; Borgmann, Ch.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Dehairs, M.; Derkx, X.; De Witte, H.; Fedorov, D. V.; Fedosseev, V. N.; Focker, G. J.; Fink, D. A.; Flanagan, K. T.; Franchoo, S.; Ghys, L.; Huyse, M.; Imai, N.; Kalaninova, Z.; Köster, U.; Kreim, S.; Kesteloot, N.; Kudryavtsev, Yu.; Lane, J.; Lecesne, N.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Molkanov, P. L.; Nicol, T.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Schweikhard, L.; Seliverstov, M. D.; Sels, S.; Sjödin, A. M.; Truesdale, V.; Van Beveren, C.; Van Duppen, P.; Wendt, K.; Wienholtz, F.; Wolf, R. N.; Zemlyanoy, S. G.

    2013-12-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  3. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  4. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  5. Evaluating 99mTc Auger electrons for targeted tumor radiotherapy by computational methods.

    Science.gov (United States)

    Tavares, Adriana Alexandre S; Tavares, João Manuel R S

    2010-07-01

    Technetium-99m (99mTc) has been widely used as an imaging agent but only recently has been considered for therapeutic applications. This study aims to analyze the potential use of 99mTc Auger electrons for targeted tumor radiotherapy by evaluating the DNA damage and its probability of correct repair and by studying the cellular kinetics, following 99mTc Auger electron irradiation in comparison to iodine-131 (131I) beta minus particles and astatine-211 (211At) alpha particle irradiation. Computational models were used to estimate the yield of DNA damage (fast Monte Carlo damage algorithm), the probability of correct repair (Monte Carlo excision repair algorithm), and cell kinetic effects (virtual cell radiobiology algorithm) after irradiation with the selected particles. The results obtained with the algorithms used suggested that 99mTc CKMMX (all M-shell Coster-Kroning--CK--and super-CK transitions) electrons and Auger MXY (all M-shell Auger transitions) have a therapeutic potential comparable to high linear energy transfer 211At alpha particles and higher than 131I beta minus particles. All the other 99mTc electrons had a therapeutic potential similar to 131I beta minus particles. 99mTc CKMMX electrons and Auger MXY presented a higher probability to induce apoptosis than 131I beta minus particles and a probability similar to 211At alpha particles. Based on the results here, 99mTc CKMMX electrons and Auger MXY are useful electrons for targeted tumor radiotherapy.

  6. Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

    Energy Technology Data Exchange (ETDEWEB)

    Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se

    2005-08-01

    Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

  7. Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

  8. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  9. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  10. A Model to Guide Development of Environmental Final Governing Standards for Overseas United States Department of Defense Installations

    Science.gov (United States)

    2014-03-28

    quality 8.75% Biodiversity and habitat 17.5% Biome protection 8.75% Marine protection 4.38% Critical habitat protection 4.38% Forests 5.83... Forest loss 1.94% Forest cover change 1.94% Growing stock change 1.94% Fisheries 5.83% Coastal shelf fishing pressure 2.92% Fish stocks...restrictions on compost use in certain areas of the country and forested areas. 30 FGS has additional sections on regional filling stations in Hessen

  11. Clinical outcome following a low-suspicion multiparametric prostate MRI or benign MRI-guided biopsy to detect prostate cancer

    DEFF Research Database (Denmark)

    Boesen, Lars; Nørgaard, Nis; Løgager, Vibeke

    2017-01-01

    predictive values of MRI in ruling out any prostate cancer and significant prostate cancer defined as: a) any core with Gleason score (GS) > 6 or b) > 2 positive cores/cancerous core ≥ 50%. RESULTS: Prostate cancer was detected in 38/194 (20%) patients during the median study period of 47 months...... (interquartile range 43-52). The overall negative predictive value of MRI in ruling out any and significant prostate cancer was 80% (156/194) and 95% (184/194), respectively. No patient with a low-suspicion MRI had intermediate/high grade cancer (Gleason score > 6). The majority of patients with no cancer during...

  12. Quantitative Trait Loci for Mercury Accumulation in Maize (Zea mays L.) Identified Using a RIL Population: e107243

    National Research Council Canada - National Science Library

    Zhongjun Fu; Weihua Li; Qinbin Zhang; Long Wang; Xiaoxiang Zhang; Guiliang Song; Zhiyuan Fu; Dong Ding; Zonghua Liu; Jihua Tang

    2014-01-01

      To investigate the genetic mechanism of mercury accumulation in maize (Zea mays L.), a population of 194 recombinant inbred lines derived from an elite hybrid Yuyu 22, was used to identify quantitative trait loci...

  13. Fire Management Plan: Upper Mississippi River National Wildlife and Fish Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Upper Mississippi River National Wildlife and Fish Refuge consists of approximately 194,000 acres of wooded islands, waters and marshes extending southward along...

  14. Technology Demonstration of Wet Abrasive Blasting for Removal of Lead- and Asbestos-Containing Paint

    National Research Council Canada - National Science Library

    Race, Timothy

    2003-01-01

    A group of 194Os-era concrete block buildings at Fort Carson, CO, must be demolished, but they are coated' with lead-based paint containing asbestos filler that must both be disposed of as hazardous waste...

  15. Dicósimo, Daniel y Simonassi, Silvia (comp., Trabajadores y empresarios en la Argentina del siglo XX: indagaciones desde la historia social

    Directory of Open Access Journals (Sweden)

    Valeria Ianni

    2013-01-01

    Full Text Available Dicósimo, Daniel y Simonassi, Silvia (comp., Trabajadores y empresarios en la Argentina del siglo XX: indagaciones desde la historia social, Prohistoria ediciones, Rosario, 2011 (194 págs..

  16. Eimuntas Nekroshiuse teatripoeetika / Ruta Mazheikiene ; tõlk. Tiina Kattel

    Index Scriptorium Estoniae

    Mazheikiene, Ruta

    2004-01-01

    E. Nekroshiuse lavastustele iseloomulikest joontest, toetudes tema lavastustele "Hamlet" "Macbeth", "Othello", "Onu Vanja", "Nina". Samuti näitlejatega töötamise strateegiast. Kasut. kirjandus, lk. 194-195

  17. Radioimmunoassays for cyclic AMP cross-react with phosphodiesterase inhibitors and buffer components

    NARCIS (Netherlands)

    Sinha, B; Semmler, J; Haen, E; Moeller, J; Endres, S

    We addressed the issue of cross-reactivity of several commonly used phosphodiesterase inhibitors with radioimmunoassays for cyclic AMP, after we had observed a considerably high cross-reactivity with a noncommercial antibody. Theophylline, pentoxifylline, penthydroxifylline (BL 194), albifylline

  18. Disease: H01343 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available portant crop and forest plants, and has been reported as an occasional clinical isolate. It has been conside... Complete genome sequence of clinical isolate Pantoea ananatis LMG 5342. ... JOURNAL ... J Bacteriol 194:1615-6

  19. 2-(2-Diethylaminoethoxy)ethyl α, α-Diethylphenylacetate(Oxeladin)の鎮咳効果の作用点の追究

    National Research Council Canada - National Science Library

    高木, 敬次郎; 由井薗, 倫一; 加瀬, 佳年

    1967-01-01

    ...-diethylphenylacetate (Oxeladin) were investigated. The 50% antitussive doses (AtD50) of Oxeladin, administered intravenously, evaluated by the "coughing dog and cat" methods, were 19.4 (16.0∼23.5) mg./kg...

  20. Breast Cancer Basics and You: Introduction | NIH MedlinePlus the Magazine

    Science.gov (United States)

    ... of this page please turn Javascript on. Feature: Breast Cancer Breast Cancer Basics and You: Introduction Past Issues / Spring - Summer ... were more than 194,000 new cases of breast cancer in the United States in 2009. More than ...

  1. Exercise compliance and health outcome in a chronic disease ...

    African Journals Online (AJOL)

    compliance with a chronic disease management programme (CDM programme) influenced shifts measured in clinical parameters over a period of 12 months. A retrospective analysis was done on data collected (30 months) from 206 men and 194 ...

  2. Journal de la Recherche Scientifique de l'Université de Lomé - Vol ...

    African Journals Online (AJOL)

    un Cas · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. MA Soedje, DH Sama, A Bagny, B Kpassagou, EK Gumedezoe, S Salifou, L Sonhahe, M Kolou, M Belo, SK Dassa, 191-194 ...

  3. Which clinical parameters predict a CSF diagnosis of meningitis in a ...

    African Journals Online (AJOL)

    2014-06-02

    Jun 2, 2014 ... clinical predictors of meningitis, parameters were explored using univariate and multivariate logistic regression ..... One area inconsistently recorded was antiretroviral therapy ... J Intensive Care Med 2007;22(4):194-207.

  4. The Effects on Students’ Conceptual Understanding of Electric Circuits of Introducing Virtual Manipulatives Within a Physical Manipulatives-Oriented Curriculum

    NARCIS (Netherlands)

    Zacharia, Zacharias C.; de Jong, Anthonius J.M.

    2014-01-01

    This study investigates whether Virtual Manipulatives (VM) within a Physical Manipulatives (PM)-oriented curriculum affect conceptual understanding of electric circuits and related experimentation processes. A pre–post comparison study randomly assigned 194 undergraduates in an introductory physics

  5. ORF Alignment: NC_002971 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TIG_COXBU ... Trigger factor (TF) ... Length = 124 ... Query: 135 EITEEDLDKMLEALRKQYAEWKEMDRPAKAD...DRVIIDFEGTLDGKPFERGSAKDFQLELG 194 ... EITEEDLDKMLEALRKQYAEWKEMDRPAKADDRVII...DFEGTLDGKPFERGSAKDFQLELG Sbjct: 1 ... EITEEDLDKMLEALRKQYAEWKEMDRPAKADDRVIIDFEGTLDGKPFERGSAKDFQLELG 60 ... Query: 255 QFAE 258 ... QFAE Sbjct: 121 QFAE 124

  6. Gestão de Recursos Humanos: uma Metanálise de seus Efeitos sobre Desempenho Organizacional/Human Resource Management: a Meta-analysis of its Effects on Organizational Performance

    National Research Council Canada - National Science Library

    Agostinha Mafalda Barra de Oliveira; Alexandre José de Oliveira

    2011-01-01

    .... Therefore, in order to update, accept suggestions and examine moderators are not analyzed in other reviews, this study aims to conduct a meta-analysis of the results of 194 registers of empirical and...

  7. Cloud amount/frequency, NITRATE and other data from NOAA Ship WHITING from 1993-04-25 to 1993-07-13 (NODC Accession 9400013)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Conductivity, Temperature and Depth (CTD) and other data were collected from NOAA Ship WHITING cruises 93115-194. The data was collected over a period spanning...

  8. Epstein-Barr Virus Neurologic Complications

    Directory of Open Access Journals (Sweden)

    J. Gordon Millichap

    2015-12-01

    Full Text Available Investigators at the Karol Marcinkowski University of Medical Sciences, Poznan, Poland, analyzed the records of 194 children diagnosed with Epstein-Barr virus infection and having the viral capsid antigen IgM antibody.

  9. Journal of Agriculture, Science and Technology - Vol 13, No 2 (2011)

    African Journals Online (AJOL)

    An investigation of the utility scale wind energy for north‐eastern Kenya region · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JN Kamau, R Kinyua, JK Gathua, 173-194 ...

  10. Efficacy of a single dose of a transdermal diclofenac patch as pre ...

    African Journals Online (AJOL)

    2012-01-25

    Jan 25, 2012 ... Original Research: Efficacy of single dose of transdermal diclofenac patch. 194 ... period. Prevention and establishment of this hypersensitivity ... This clinical ..... International Journal Pharmaceutical Sciences Review and.

  11. Evolutionary history of the thicket rats (genus Grammomys) mirrors the evolution of African forests since late Miocene

    Czech Academy of Sciences Publication Activity Database

    Bryja, J.; Šumbera, R.; Kerbis Peterhans, J. C.; Aghová, T.; Bryjová, A.; Mikula, Ondřej; Nicolas, V.; Denys, C.; Verheyen, E.

    2017-01-01

    Roč. 44, č. 1 (2017), s. 182-194 ISSN 0305-0270 Institutional support: RVO:67985904 Keywords : Arvicanthini * coastal forests * late Miocene Subject RIV: EG - Zoology Impact factor: 4.248, year: 2016

  12. Effects of Zingiber officinale extract on antioxidation and lipid ...

    African Journals Online (AJOL)

    Yomi

    2012-02-07

    2011). The cytotoxic mechanism of malondialdehyde and protective effect of carnosine via protein cross-linking/mitochondrial dysfunction/reactive oxygen species/MAPK pathway in neurons. Eur. J. Pharmacol. 650(1): 184-. 194.

  13. Innovaatiline mõtlemine nõuab juhilt julgust kastist välja tulla / Alexander Kotchubei

    Index Scriptorium Estoniae

    Kotchubei, Alexander, 1963-

    2005-01-01

    Ilmunud ka: Juhi ideelaegas. - Tallinn, 2006, lk. 194-196. Uuenduslikkuse aluseks on konkurentidest efektiivsem mõtlemine. Vt. samas: Tänapäeva juht peab olema avatud ja riskijulge; Uusi ideid soodustavad muudatused mõtteviisis

  14. Relationship between the angle of repose and angle of internal ...

    African Journals Online (AJOL)

    Abstract. Click on the link to view the abstract. Keywords: Angle of repose, angle of internal friction, granular materials, triaxial compression machine, moisture content. Tanzania J. Agric. Sc. (1998) Vol.1 No.2, 187-194 ...

  15. The Effect of Knowledge Management Systems on Organizational Performance. Do Soldier and Unit Counterinsurgency Knowledge and Performance Improve Following ’Push’ or ’Adaptive-Push’ Training

    Science.gov (United States)

    2009-01-01

    at Cisco and Enron provided a sense of overconfidence in predictive business models at Cisco and in the online market exchange at Enron that led to...Video reenactments were developed by the battle command training center (BCTC), using videogame software and adding realistic audio. The audio...Secure Mosque 193 Secure market 193 Secure/check on school 193 Establish high ground 194 Secure site through dominant terrain 194 Secure site 195 Secure

  16. An anti-HIV-1 V3 loop antibody fully protects cross-clade and elicits T-cell immunity in macaques mucosally challenged with an R5 clade C SHIV.

    Directory of Open Access Journals (Sweden)

    Jennifer D Watkins

    2011-03-01

    Full Text Available Neutralizing antibodies have been shown to protect macaques against SHIV challenge. However, genetically diverse HIV-1 clades have evolved, and a key question left unanswered is whether neutralizing antibodies can confer cross-clade protection in vivo. The novel human monoclonal antibody HGN194 was isolated from an individual infected with an HIV-1 clade AG recombinant circulating recombinant form (CRF. HGN194 targets an epitope in the third hypervariable loop (V3 of HIV-1 gp120 and neutralizes a range of relatively neutralization-sensitive and resistant viruses. We evaluated the potential of HGN194 to protect infant rhesus monkeys against a SHIV encoding a primary CCR5-tropic HIV-1 clade C envelope. After high-dose mucosal challenge, all untreated controls became highly viremic while all HGN194-treated animals (50 mg/kg were completely protected. When HGN194 was given at 1 mg/kg, one out of two monkeys remained aviremic, whereas the other had delayed, lower peak viremia. Interestingly, all protected monkeys given high-dose HGN194 developed Gag-specific proliferative responses of both CD4+ and CD8+ T cells. To test whether generation of the latter involved cryptic infection, we ablated CD8+ cells after HGN194 clearance. No viremia was detected in any protected monkeys, thus ruling out virus reservoirs. Thus, induction of CD8 T-cell immunity may have resulted from transient "Hit and Run" infection or cross priming via Ag-Ab-mediated cross-presentation. Together, our data identified the HGN194 epitope as protective and provide proof-of-concept that this anti-V3 loop mAb can prevent infection with sterilizing immunity after challenge with virus of a different clade, implying that V3 is a potential vaccine target.

  17. A prospective study of XRCC1 haplotypes and their interaction with plasma carotenoids on breast cancer risk

    Energy Technology Data Exchange (ETDEWEB)

    Mohrenweiser, H W; Han, J; Hankinson, S E; De Vivo, I; Spiegelman, D; Tamimi, R M; Colditz, G A; Hunter, D J

    2004-01-15

    The XRCC1 protein is involved in the base excision repair pathway through interactions with other proteins. Polymorphisms in the XRCC1 gene may lead to variation in repair proficiency and confer inherited predisposition to cancer. We prospectively assessed the associations between polymorphisms and haplotypes in XRCC1 and breast cancer risk in a nested case-control study within the Nurses' Health Study (incident cases, n 1004; controls, n 1385). We further investigated gene-environment interactions between the XRCC1 variations and plasma carotenoids on breast cancer risk. We genotyped four haplotype-tagging single nucleotide polymorphisms Arg {sup 194}Trp, C26602T, Arg{sup 399}Gln, and Gln{sup 632}Gln in the XRCC1 gene. Five common haplotypes accounted for 99% of the chromosomes in the present study population of mostly Caucasian women. We observed a marginally significant reduction in the risk of breast cancer among {sup 194}Trp carriers. As compared with no-carriers, women with at least one {sup 194}Trp allele had a multivariate odds ratio of 0.79 (95% of the confidence interval, 0.60 -1.04). The inferred haplotype harboring the {sup 194}Trp allele was more common in controls than in cases (6.6 versus 5.3%, P 0.07). We observed that the Arg {sup 194}Trp modified the inverse associations of plasma -carotene level (P, ordinal test for interaction 0.02) and plasma -carotene level (P, ordinal test for interaction 0.003) with breast cancer risk. No suggestion of an interaction was observed between the Arg {sup 194}Trp and cigarette smoking. Our results suggest an inverse association between XRCC1 {sup 194}Trp allele and breast cancer risk. The findings of the effect modification of the Arg {sup 194}Trp on the relations of plasma -and -carotene levels with breast cancer risk suggest a potential protective effect of carotenoids in breast carcinogenesis by preventing oxidative DNA damage.

  18. Dietary patterns and prevalence of wasting among street children in ...

    African Journals Online (AJOL)

    Foods that are mostly eaten on a daily basis include nsima (100%), rice (50%), confectionery (44.4%), and mangoes (41.7%). On the other hand, foods that are eaten three times a week are fish (80.6%), chicken (58.3%), potatoes (36.1%), cookies (19.4%), pumpkin leaves (19.4%), and bananas (13.9%). For the majority of ...

  19. EST Table: DC545654 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DC545654 E_FL_phe-_03O23_F_0 10/09/28 40 %/194 aa ref|NP_001037610.1| putative alco...9445690:1|gene:AGAP001753 10/09/10 36 %/191 aa gnl|Amel|GB15410-PA 10/09/10 36 %/...194 aa gi|189239647|ref|XP_966954.2| PREDICTED: similar to putative alcohol dehydrogenase [Tribolium castaneum] DC550061 phe- ...

  20. Optimizing MIBG therapy of neuroendocrine tumors: preclinical evidence of dose maximization and synergy

    Energy Technology Data Exchange (ETDEWEB)

    Mairs, Rob J. [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)], E-mail: r.mairs@beatson.gla.ac.uk; Boyd, Marie [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)

    2008-08-15

    [{sup 131}I]meta-Iodobenzylguanidine ([{sup 131}I]MIBG) has been used for the therapy of tumors of neuroectodermal origin since the 1980s. Its role in the management of these malignancies remains controversial because of the large variation in response rates. Appreciation of the mode of conveyance of [{sup 131}I]MIBG via the noradrenaline transporter into malignant cells and of factors that influence the activity of the uptake mechanism has indicated various ways in which the effectiveness of this type of targeted radiotherapy may be improved. Experimental observations indicate that radiolabeling of MIBG to high specific activity reduced the amount of cold competitor, thereby increasing tumor dose and minimizing pressor effects. We observed supra-additive tumor cell kill and inhibition of tumor growth following combined topotecan and [{sup 131}I]MIBG treatment. The improved efficacy is related to topotecan's increased disruption of DNA repair. Radiation damage to targeted tumors may also be enhanced by the use of the {alpha}-particle emitter [{sup 211}At]astatine rather than {sup 131}I as radiolabel. Furthermore, recent experimental findings indicate that [{sup 123}I]MIBG may have therapeutic potential over and above its utility as an imaging agent. It has recently been demonstrated that potent cytotoxic bystander effects were induced by the intracellular concentration of [{sup 131}I]MIBG, [{sup 123}I]MIBG or meta-[{sup 211}At]astatobenzylguanidine. Identification of the nature of bystander factors could be exploited to maximize the specificity and potency of MIBG-targeted radiotherapy. By employing a range of strategies, there are good prospects for the improvement of the [{sup 131}I]MIBG therapy of neuroectodermal tumors.

  1. Immuno-vectorization of radioelements emitters of alpha particles: a new therapy in cancerology; Immunovectorisation de radioelements emetteurs de particules alpha: une nouvelle voie therapeutique en cancerologie

    Energy Technology Data Exchange (ETDEWEB)

    Bourgeois, M

    2007-05-15

    The radio-immunotherapy is an anti cancerous therapy which consists in vectorising with immuno-specific agents very radio toxic radioelements on tumors or in their environment to destroy them. The first part of this report presents the different characteristics of antibodies as well as their means of production under monoclonal shapes specifically steered against a tumoral antigen of interest. The second part of this report replaces the importance of the immunological vectors in the context of the nuclear medicine. It is notably described that the different methods which allow to radio-label the vector, as well as the different ways of optimization which were envisaged to improve the targeting of radioelements on a tumor. These different developments allow to define the potential place of the alpha radio-immunotherapy in treatments and so re-place the interest of the experimental part. If the radio-immunotherapy, using beta emitters isotopes as the {sup 131}iodine or the{sup 90}yttrium, is today current in anti cancerous therapy, it finds limits because of the disintegration characteristics of the isotopes it uses. Indeed, compared with alpha particles, the beta particles deposit less energy by unit of length in the crossed material.The experimental part of this report aims at studying the feasibility of the coupling between an immunological vector and an alpha emitter isotope.The different tests led on the bismuth 213, the bismuth 212, the lead 212 and the astatine 211 demonstrated that the fixation of these radionuclides was possible. This research theme is strengthened by the construction in Nantes of a cyclotron with high energy ( A.R.R.O.N.A.X.) and the optimization of the obtained promising results should allow a therapeutic use in oncology of the alpha radio-immunotherapy. (N.C.)

  2. Locoregional therapy with α-emitting trastuzumab against peritoneal metastasis of human epidermal growth factor receptor 2-positive gastric cancer in mice.

    Science.gov (United States)

    Li, Huizi Keiko; Morokoshi, Yukie; Nagatsu, Kotaro; Kamada, Tadashi; Hasegawa, Sumitaka

    2017-08-01

    Peritoneal metastasis of gastric cancer (PMGC) is incurable and thus has an extremely poor prognosis. We have found, however, that locoregionally administered trastuzumab armed with astatine-211 ((211) At-trastuzumab) is effective against human epidermal growth factor receptor 2 (HER2)-positive PMGC in a xenograft mouse model. We first observed that (211) At-trastuzumab can specifically bind and effectively kill NCI-N87 (N87) cells, which are HER2-positive human metastatic GC cells, both in vitro and in s.c. tumors. We established a PMGC mouse model using N87 xenografts stably expressing luciferase to test α-particle radioimmunotherapy with (211) At-trastuzumab against PMGC. Biodistribution analysis in this PMGC mouse model revealed that the i.p. administration of (211) At-trastuzumab (1 MBq) was a more efficient means of delivery of (211) At into metastatic tumors than i.v. injection; the maximum tumor uptake with i.p. administration was over 60% injected dose per gram of tissue (%ID/g) compared to approximately 18%ID/g with i.v. injection. Surprisingly, a single i.p. injection of (211) At-trastuzumab (1 MBq) was sufficient to completely eradicate intraperitoneally disseminated HER2-positive GC xenografts in two of six treated mice by inducing DNA double-strand breaks, and to drastically reduce the tumor burden in another three mice. No bodyweight loss, leukocytopenia, or significant biochemical changes in liver or kidney function were observed in the treatment group. Accordingly, locoregionally administered (211) At-trastuzumab significantly prolonged the survival time of HER2-positive PMGC mice compared with control treatments. Our results provide a proof-of-concept demonstration that locoregional therapy with (211) At-trastuzumab may offer a new treatment option for HER2-positive PMGC. © 2017 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.

  3. MORPHOLOGICAL ALTERATIONS OF STAPHYLOCOCCUS AUREUS CAUSED BY ARYL ALIPHATIC AMINOALCOHOL DERIVATIVE

    Directory of Open Access Journals (Sweden)

    Dronova M.

    2015-05-01

    Full Text Available Increasing of antimicrobial resistance has created a critical need of the novel antimicrobial agents. One of the promising chemical classes for its development are aryl aliphatic aminoalcohols. New compounds of this class were synthesized at the Institute of organic chemistry (Kiev, Ukraine, by Y. Korotkiy. After the screening studies compound KVM-194 was selected as the potent antistaphylococcal agent. The aim of the study was to examine ultrastructural changes in the bacterial cells under the influence of the compound KVM-194. Materials and methods. Staphylococcus aureus ATCC 25923 was used in all experiments. The minimum inhibitory concentration was determined by serial macrodilution method in Mueller-Hinton broth. Bacteria were exposed to the 0,5 MIC and 5 MICs of the KVM- 194 for 1 h and 24 h. Ultrastructure of intact and treated Staphylococcus aureus cells was examined by transmission electron microscopy after contrasting by osmium tetraoxide and lead citrate. Results and Discussion. The compound KVM-194 possesses a distinct antibacterial activity against Staphylococcus aureus, the minimum inhibitory concentration is 1.25 μg/ml. We found that exposure to KVM-194 at a subinhibitory concentration resulted in alterations of the cell morphology even after 1 h of treatment. The roughness of the cell surface and emerging of the intracellular particles of different electron density were observed. Increase of the incubation time to 24 h led to detachment of membrane from cytoplasm, multimembrane structures within cells emergence and formation of nonpolar septum. 1 h exposition to suprainhibitory concentration of KVM-194 resulted in nucleoid fragmentation, septum abnormalities and necrosis of some cells. We found that increasing of the incubation period to 24 h led to exacerbation of alterations: cell wall rupture, leakage of cytoplasm and a large number of lysed cells were registered. Conclusion. Observed alterations, suggest the possible

  4. Identification of Specific Effect of Chloride on the Spectral Properties and Structural Stability of Multiple Extracellular Glutamic Acid Mutants of Bacteriorhodopsin.

    Directory of Open Access Journals (Sweden)

    Tzvetana Lazarova

    Full Text Available In the present work we combine spectroscopic, DSC and computational approaches to examine the multiple extracellular Glu mutants E204Q/E194Q, E204Q/E194Q/E9Q and E204Q/E194Q/E9Q/E74Q of bacteriorhodopsin by varying solvent ionic strength and composition. Absorption spectroscopy data reveal that the absorption maxima of multiple EC Glu mutants can be tuned by the chloride concentration in the solution. Visible Circular dichroism spectra imply that the specific binding of Cl- can modulate weakened exciton chromophore coupling and reestablish wild type-like bilobe spectral features of the mutants. The DSC data display reappearance of the reversible thermal transition, higher Tm of denaturation and an increase in the enthalpy of unfolding of the mutants in 1 M KCl solutions. Molecular dynamics simulations indicate high affinity binding of Cl- to Arg82 and to Gln204 and Gln194 residues in the mutants. Analysis of the experimental data suggests that simultaneous elimination of the negatively charged side chain of Glu194 and Glu204 is the major cause for mutants' alterations. Specific Cl- binding efficiently coordinates distorted hydrogen bonding interactions of the EC region and reconstitutes the conformation and structure stability of mutated bR in WT-like fashion.

  5. Search for new candidates for the neutrino-oriented mass determination by electron-capture

    CERN Multimedia

    Herfurth, F; Boehm, C; Blaum, K; Beck, D

    2008-01-01

    This proposal is part of an extended program dedicated to the neutrino-mass determination in the electron-capture sector, which aims at ultra-precise mass measurements by Penning traps in combination with cryogenic micro-calorimetry for atomic de-excitation measurements. Here, precise mass measurements with ISOLTRAP are proposed for the orbital electron-capture nuclides $^{194}$Hg and $^{202}$Pb, as well as their daughters, with the goal to determine accurately their Q-values. These values are expected to be the smallest ones among a great variety of known electron-capture precursors. Therefore, these nuclides are strong candidates for an improved electron-neutrino mass determination. We ask for 8 shifts of on-line beam at ISOLDE for mass measurements of $^{194}$Hg, $^{194}$ Au, $^{202}$Pb, and $^{202}$Tl at ISOLTRAP.

  6. Characterization of CDOM of river waters in China using fluorescence excitation-emission matrix and regional integration techniques

    Science.gov (United States)

    Zhao, Ying; Song, Kaishan; Shang, Yingxin; Shao, Tiantian; Wen, Zhidan; Lv, Lili

    2017-08-01

    The spatial characteristics of fluorescent dissolved organic matter (FDOM) components in river waters in China were first examined by excitation-emission matrix spectra and fluorescence regional integration (FRI) with the data collected during September to November between 2013 and 2015. One tyrosine-like (R1), one tryptophan-like (R2), one fulvic-like (R3), one microbial protein-like (R4), and one humic-like (R5) components have been identified by FRI method. Principal component analysis (PCA) was conducted to assess variations in the five FDOM components (FRί (ί = 1, 2, 3, 4, and 5)) and the humification index for all 194 river water samples. The average fluorescence intensities of the five fluorescent components and the total fluorescence intensities FSUM differed under spatial variation among the seven major river basins (Songhua, Liao, Hai, Yellow and Huai, Yangtze, Pearl, and Inflow Rivers) in China. When all the river water samples were pooled together, the fulvic-like FR3 and the humic-like FR5 showed a strong positive linear relationship (R2 = 0.90, n = 194), indicating that the two allochthonous FDOM components R3 and R5 may originate from similar sources. There is a moderate strong positive correlation between the tryptophan-like FR2 and the microbial protein-like FR4 (R2 = 0.71, n = 194), suggesting that parts of two autochthonous FDOM components R2 and R4 are likely from some common sources. However, the total allochthonous substance FR(3+5) and the total autochthonous substances FR(1+2+4) exhibited a weak correlation (R2 = 0.40, n = 194). Significant positive linear relationships between FR3 (R2 = 0.69, n = 194), FR5 (R2 = 0.79, n = 194), and chromophoric DOM (CDOM) absorption coefficient a(254) were observed, which demonstrated that the CDOM absorption was dominated by the allochthonous FDOM components R3 and R5.

  7. Dicty_cDB: Contig-U07344-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cessful extensions: 1 Number of sequences better than 10.0: 1 length of query: 194 length of database: 5,674...,871 effective HSP length: 15 effective length of query: 179 effective length of database: 5,571,296 effecti...f successful extensions: 126 Number of sequences better than 10.0: 0 Length of query: 194 Length of database...: 95,242,211,685 Length adjustment: 22 Effective length of query: 172 Effective length of database: 93,199,6...ber of sequences better than 10.0: 0 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 0 Length of query

  8. Execution spaces for simple higher dimensional automata

    DEFF Research Database (Denmark)

    Raussen, Martin

    2012-01-01

    Higher dimensional automata (HDA) are highly expressive models for concurrency in Computer Science, cf van Glabbeek (Theor Comput Sci 368(1–2): 168–194, 2006). For a topologist, they are attractive since they can be modeled as cubical complexes—with an inbuilt restriction for directions of allowa......Higher dimensional automata (HDA) are highly expressive models for concurrency in Computer Science, cf van Glabbeek (Theor Comput Sci 368(1–2): 168–194, 2006). For a topologist, they are attractive since they can be modeled as cubical complexes—with an inbuilt restriction for directions...

  9. The Relationship of Social Security Benefits and the Military Survivors Benefit Plan.

    Science.gov (United States)

    1980-07-09

    The fdct that she is .jtIj cL, to benefits’based on her husband’s earnings iikes the reduction Illanid’iury. There is, however, no reduction in the...nondisabled) and thus would be conservative for a woman . 19 ,g {. PIA - .9(194) + .32 (424.05- 194) (See Appendix C for bend points.) = 174.60 + 73.62...those for a military member (nondisabled) and thus would be conservative for a woman . 12 Some differences in social security benefits attributable to

  10. Quantitative Single-Particle Digital Autoradiography with α-Particle Emitters for Targeted Radionuclide Therapy using the iQID Camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W.; Frost, Sophia; Frayo, Shani; Kenoyer, Aimee L.; Santos, E. B.; Jones, Jon C.; Green, Damian J.; Hamlin, Donald K.; Wilbur, D. Scott; Fisher, Darrell R.; Orozco, Johnnie J.; Press, Oliver W.; Pagel, John M.; Sandmaier, B. M.

    2015-07-01

    Abstract Alpha emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm) causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with alpha emitters may inactivate targeted cells with minimal radiation damage to surrounding tissues. For accurate dosimetry in alpha-RIT, tools are needed to visualize and quantify the radioactivity distribution and absorbed dose to targeted and non-targeted cells, especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, iQID (ionizing-radiation Quantum Imaging Detector), for use in alpha-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection technology that images and identifies charged-particle and gamma-ray/X-ray emissions spatially and temporally on an event-by-event basis. It employs recent advances in CCD/CMOS cameras and computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, we evaluated this system’s characteristics for alpha particle imaging including measurements of spatial resolution and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 (211At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ~20 μm full width at half maximum (FWHM) and the alpha particle background was measured at a rate of (2.6 ± 0.5) × 10–4 cpm/cm2 (40 mm diameter detector area). Simultaneous imaging of multiple tissue sections was performed using a large-area iQID configuration (ø 11.5 cm

  11. Quantitative single-particle digital autoradiography with α-particle emitters for targeted radionuclide therapy using the iQID camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W., E-mail: brian.miller@pnnl.gov [Pacific Northwest National Laboratory, Richland, Washington 99354 and College of Optical Sciences, The University of Arizona, Tucson, Arizona 85719 (United States); Frost, Sofia H. L.; Frayo, Shani L.; Kenoyer, Aimee L.; Santos, Erlinda; Jones, Jon C.; Orozco, Johnnie J. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 (United States); Green, Damian J.; Press, Oliver W.; Pagel, John M.; Sandmaier, Brenda M. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 and Department of Medicine, University of Washington, Seattle, Washington 98195 (United States); Hamlin, Donald K.; Wilbur, D. Scott [Department of Radiation Oncology, University of Washington, Seattle, Washington 98195 (United States); Fisher, Darrell R. [Dade Moeller Health Group, Richland, Washington 99354 (United States)

    2015-07-15

    Purpose: Alpha-emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm), causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with α emitters may thus inactivate targeted cells with minimal radiation damage to surrounding tissues. Tools are needed to visualize and quantify the radioactivity distribution and absorbed doses to targeted and nontargeted cells for accurate dosimetry of all treatment regimens utilizing α particles, including RIT and others (e.g., Ra-223), especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, the ionizing-radiation quantum imaging detector (iQID) camera, for use in α-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection system that images and identifies charged-particle and gamma-ray/x-ray emissions spatially and temporally on an event-by-event basis. It employs CCD-CMOS cameras and high-performance computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, the authors evaluated its characteristics for α-particle imaging, including measurements of intrinsic detector spatial resolutions and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 ({sup 211}At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ∼20 μm full width at half maximum and the α-particle background was measured at a rate as low as (2.6 ± 0.5) × 10{sup −4} cpm/cm{sup 2} (40 mm diameter detector area

  12. α-Imaging Confirmed Efficient Targeting of CD₄₅-Positive Cells After ²¹¹At-Radioimmunotherapy for Hematopoietic Cell Transplantation

    Energy Technology Data Exchange (ETDEWEB)

    Frost, Sophia; Miller, Brian W.; Back, Tom; Santos, E. B.; Hamlin, Donald K.; Knoblaugh, E.; Frayo, Shani; Kenoyer, Aimee L.; Storb, Rainer; Press, O. W.; Wilbur, D. Scott; Pagel, John M.; Sandmaier, B. M.

    2015-09-03

    Alpha-radioimmunotherapy (α-RIT) targeting CD45 may substitute for total body irradiation in hematopoietic cell transplantation (HCT) preparative regimens for lymphoma. Our goal was to optimize the anti-CD45 monoclonal antibody (MAb; CA12.10C12) protein dose for astatine-²¹¹(²¹¹At)-RIT, extending the analysis to include intra-organ ²¹¹At activity distribution and α-imaging-based small-scale dosimetry, along with imunohistochemical staining. Methods: Eight normal dogs were injected with either 0.75 (n=5) or 1.00 mg/kg (n=3) of ²¹¹At-B10-CA12.10C12 (11.5–27.6 MBq/kg). Two were euthanized and necropsied 19–22 hours postinjection (p.i.), and six received autologous HCT three days after ²¹¹At-RIT, following lymph node and bone marrow biopsies at 2–4 and/or 19 hours p.i. Blood was sampled to study toxicity and clearance; CD45 targeting was evaluated by flow cytometry. ²¹¹At localization and small scale dosimetry were assessed using two α-imaging : α-camera and iQID. Results: Uptake of ²¹¹At was highest in spleen (0.31–0.61 %IA/g), lymph nodes (0.02–0.16 %IA/g), liver (0.11–0.12 %IA/g), and marrow (0.06–0.08 %IA/g). Lymphocytes in blood and marrow were efficiently targeted using either MAb dose. Lymph nodes remained unsaturated, but displayed targeted ²¹¹At localization in T lymphocyte-rich areas. Absorbed doses to blood, marrow, and lymph nodes were estimated at 3.9, 3.0, and 4.2 Gy/210 MBq, respectively. All transplanted dogs experienced transient hepatic toxicity. Liver enzyme levels were temporarily elevated in 5 of 6 dogs; 1 treated with 1.00 mg MAb/kg developed ascites and was euthanized 136 days after HCT. Conclusion: ²¹¹At-anti-CD45 RIT with 0.75 mg MAb/kg efficiently targeted blood and marrow without severe toxicity. Dosimetry calculations and observed radiation-induced effects indicated that sufficient ²¹¹At-B10-CA12.10C12 localization was achieved for efficient conditioning for HCT.

  13. The role of alpha therapy for local and systemic treatment of cancer

    Energy Technology Data Exchange (ETDEWEB)

    Allen, B.J. [St George Hospital, Kogarah, NSW (Australia)

    1998-03-01

    Major problems in the management of cancer relate to the inability to control some primary lesions, e.g. glioblastoma multiforme (GBM), and the inability to deal with metastatic cancer arising from malignant cancers such as melanoma, breast and other cancers. Binary alpha therapy using neutron capture in boron-10 offers the potential for improved prognosis for high grade brain tumours such as GBM and melanoma metastases to the brain. Metastatic cancer proceeds through a number of quite separate stages in the development of lethal disease, i e. cells in transit, preangiogenic lesions, subclinical and clinical lesions. Early stages offer the potential for control if targeted alpha therapy is applied. However, the dose must be localised to the cancer cell and this requirement rules out beta-emitting radionuclides, which are more suited for clinical lesions. Alpha-emitting radionuclides are the most appropriate toxins, as their efficacy depends on the linear energy transfer (LET) and range of the alpha particles. After matching the cancer stage, radiolabel and carrier, we find that {sup 149}Tb is the radionuclide of choice for systemic therapy in all aspects except production. The production of {sup 149}Tb in {mu}Ci (kBq) quantities has been achieved using the heavy ion reaction at the ANU tandem accelerator at Canberra and in multi-mCi (MBq) quantities using the spallation reaction in combination with on-line isotope separation technology of ISOLDE at CERN. Terbium is ideally suited for chelation to monoclonal antibodies to produce stable radio-immunoconjugates (RIC). Astatine-211 is a halide and has potential for the elimination of early stage melanoma metastases as At-MTB. However, the availability of the alpha generators {sup 228}Th-{sup 212}Bi and {sup 225}Ac-{sup 213}Bi facilitates the use of Bi-RIC in clinical trials for acute myeloid leukaemia and cystic glioma. Alpha therapy has the potential to control refractory cancers when treated at the minimum residual

  14. Systematics of Alpha-Radioactivity

    Energy Technology Data Exchange (ETDEWEB)

    Perlman, I.; Ghiorso, A.; Seaborg, G.T.

    1949-09-12

    Correlations of alpha-decay energies in terms of mass number and atomic number have been made for all of the alpha-emitting species now numbering over 100. For each element isotopes show increase in alpha-energy with decrease in mass number except in the region of 126 neutrons where there is an explainable reversal. This reversal has the effect of creating a region of relatively low alpha-energy and long half-life at low mass numbers for such elements as astatine, emanation, francium, and possibly higher elements as had been noted already for bismuth and polonium. Methods and examples of using alpha-decay data to define the energy surface in the heavy element region are discussed. The regularities in alpha-decay are used for predictions of nuclear properties including prediction of the beta-stable nuclides among the heavy elements. The half-life vs. energy correlations show that the even-even nuclides conform well with existing alpha-decay theory, but all nuclear types with odd nucleons show prohibited decay. The reason for this prohibition is not found in spin changes in the alpha-emission but in the assembly of the components of the alpha particle, and this theory is discussed further in terms of observations made on nuclides having two or more alpha-groups. Using most of the even-even nuclei to define 'normal nuclear radius' calculations are now able to show the shrinkage in the regions of lead and of 126 neutrons to amount to about 10%. The much greater change in 'effective radius' for bismuth isotopes can be dissociated into the effects of odd nucleons superimposed on the actual decrease in nuclear radius. The simple expression r = 1.48 A{sup 1/3} {center_dot} 10{sup -13} cm seems to fit the data for the even-even nuclei outside of the region of 126 neutrons better than more complex functions.

  15. Indilinga: African Journal of Indigenous Knowledge Systems - Vol 10 ...

    African Journals Online (AJOL)

    Health Benefits and Omega-3-Fatty Acid Content of Selected Indigenous Foods in the Limpopo Province, South Africa · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. S M Makuse, X G Mbhenyane, 182-194 ...

  16. Retinal layer location of increased retinal thickness in eyes with subclinical and clinical macular edema in diabetes type 2

    DEFF Research Database (Denmark)

    Bandello, Francesco; Tejerina, Amparo Navea; Vujosevic, Stela

    2015-01-01

    PURPOSE: To identify the retinal layer predominantly affected in eyes with subclinical and clinical macular edema in diabetes type 2. METHODS: A cohort of 194 type 2 diabetic eyes/patients with mild nonproliferative diabetic retinopathy (ETDRS levels 20/35) were examined with Cirrus spectral-doma...

  17. Treatment of spelling variants in Setswana monolingual dictionaries

    African Journals Online (AJOL)

    user

    Abstract: This paper argues that the Setswana language is characterised by spelling variants which are a consequence of ... be pronunciation variants, as those found, for instance, in words such as data. (deɪtə or dɑ:tə), ...... idiom is "an independent lexical item having an opaque meaning" (Svensén. 2009: 194). Treatment ...

  18. Pattern of neonatal admissions and outcome in a tertiary institution ...

    African Journals Online (AJOL)

    20.1%), and birth asphyxia (11.5%). Out of the 572 neonates, 111 (19.4%) died. About three quarters (76.5%) of the mortalities occurred in the first week of life with 46.4% of these occurring in the first 24 hours (X2-20.2, P < 0.001). The common ...

  19. Domain Modeling: NP_597715.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_597715.2 chr16 CRYSTAL STRUCTURE OF A DESIGNED ZINC FINGER PROTEIN BOUND TO DNA c1meyf_ chr16/NP_597715....2/NP_597715.2_holo_181-277.pdb blast 181R,185C,187T,188L,189G,190S,191N,192L,194H,19

  20. Dicty_cDB: Contig-U13413-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available est89= SLD566Z ,412,659 est90= SLF816Z ,413,659 est91= SLD507Z ,420,659 est92= S... ) Dictyostelium discoideum slug cDNA, clone SLD507. 194 1e-48 2 ( C92592 ) Dictyostelium discoideum slug cD

  1. Isolation of Cryptococcus neoformans from bats ( Molossus major ...

    African Journals Online (AJOL)

    The study determines the ecological significance of bats excrement in cryptococcosis in Awka, Nigeria. A total of 194 samples of bats droppings were collected from church, houses and public buildings. Each sample was suspended 1:10 in sterile normal saline solution and then cultured in Staib medium (Guizotia ...

  2. 75 FR 36773 - Pipeline Safety: Updating Facility Response Plans in Light of the Deepwater Horizon Oil Spill

    Science.gov (United States)

    2010-06-28

    ... Light of the Deepwater Horizon Oil Spill AGENCY: Pipeline and Hazardous Materials Safety Administration... Bulletin to operators of hazardous liquid pipeline facilities required to prepare and submit an oil spill response plan under 49 CFR part 194. In light of the Deepwater Horizon oil spill in the Gulf of Mexico...

  3. File list: InP.Liv.10.AllAg.Liver_tumor [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available InP.Liv.10.AllAg.Liver_tumor mm9 Input control Liver Liver tumor SRX1008193,SRX1008...194 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.Liv.10.AllAg.Liver_tumor.bed ...

  4. Light trap surveys for moths in Sile region of Istanbul, Turkey ...

    African Journals Online (AJOL)

    In this study, Heterocera species collected by light trap method in Sile region, Istanbul province, Turkey during the years of 2007 - 2008 was evaluated. A total of 194 specimens were collected from 48 different locations in Sile. According to identification results, 70 species belonging to 15 families were recorded. The family ...

  5. Inhibition of telomerase activity and cell growth by free and ...

    African Journals Online (AJOL)

    15. A Gharib, Z Faezizadeh, M Godarzee. Preparation and characterization of nanoliposomal beta-cryptoxanthin and its effect on proliferation and apoptosis in human leukemia cell line K562. Trop J Pharm Res 2015; 14: 187-194. 16. Fang JY, Hwang TL. Enhancement of the transdermal delivery of catechins by liposomes ...

  6. Vitamin B12 status is associated to bone mineral content and bone mineral density in frail elderly women, but not in men

    NARCIS (Netherlands)

    Dhonukshe-Rutten, R.A.M.; Lips, M.; Jong, N.; Chin A Paw, M.J.M.; Hiddink, G.J.; Dusseldorp, van M.; Groot, de C.P.G.M.; Staveren, van W.A.

    2003-01-01

    Subclinical vitamin B-12 deficiency is common in the elderly. Encouraged by early indications, we investigated the plasma vitamin B-12 status in association with bone mineral content (BMC) and bone mineral density (BMD) in frail elderly people. Data of 194 free-living Dutch frail elderly (143 women

  7. Thin metal films in resistivity-based chemical sensing

    Czech Academy of Sciences Publication Activity Database

    Podešva, Pavel; Foret, František

    2013-01-01

    Roč. 9, č. 4 (2013), s. 642-652 ISSN 1573-4110 R&D Projects: GA ČR(CZ) GAP301/11/2055 Institutional support: RVO:68081715 Keywords : voltohmmetric sensing * chemiresistor * thin metal film * gas sensing Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.194, year: 2013

  8. Knowledge, Perceptions and Ever Use of Modern Contraception ...

    African Journals Online (AJOL)

    Erah

    Adeleye A, Akoria OA Shuaib ZO, Ogholoh OD. Barriers and knowledge of benefits regarding family planning methods among women attending antenatal clinics in a southern Nigerian community. Asian J Med. Sci. 2010;2(4):190-194. 11. Ismail S. Men's knowledge, attitude and practices of family planning in north Gondar.

  9. Implementing an outcomes-based approach to university essay writing

    African Journals Online (AJOL)

    The lecturer reflects on these aspects and how she developed and implemented a second essay‑writing task. The teaching assistant and students' feedback are also discussed. The lecturer's reflections and comments are indicated by indentation. South African Journal of Higher Education Vol.15(3) 2001: 194-201 ...

  10. QTL Information Table: 107 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available tification and mapping of yield and yield related QTLs from an Indian accession of Oryza rufipogon. BMC Genet 6, 33. ... ...F1(test cross) IR 58025A O. rufipogon (IC 22015) B RM194 RM249 pha Marri, P.R., Sarla, N., Reddy, L.V., and Siddiq, E.A. (2005). Iden

  11. The Marine Mollusca of the Kendeng Beds (East Java) Gastropoda, Part IV (Families Cassididae – Ficidae inclusive)

    NARCIS (Netherlands)

    Regteren Altena, van C.O.

    1942-01-01

    Part III of this monograph (by Dr. F. A. Schilder) was published in volume 12 of this Journal, pp. 171—194, 1941. The fourth part deals with the families which can be summarised as Tonnacea (= Doliacea Thiele). They contain 31 species, two of which are new to science. The manuscript was already

  12. Educational Orientation and Upward Influence: An Examination of Students' Conversations about Disappointing Grades

    Science.gov (United States)

    Wright, Courtney N.

    2012-01-01

    The influence of student attitudes toward learning and grades on their communication with instructors about grades has received limited attention despite its potential implications for learning, performance outcomes, and student-teacher interactions. Participants (N = 194) who discussed a disappointing grade with an instructor completed measures…

  13. African Journal of Environmental Science and Technology - Vol 4 ...

    African Journals Online (AJOL)

    Bacteriological, physicochemical and mineral studies on Awedele spring water and soil samples in Ado Ekiti, Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AT Odeyemi, AC Dada, OR Ogunbanjo, MA Ojo. http://dx.doi.org/10.5897/AJEST09.194 ...

  14. Brain computed tomography of patients with HIV/AIDS before the ...

    African Journals Online (AJOL)

    enhancing lesions 7 (19.4%), cerebral atrophy 5 (13.9%), multiple nodular lesions 4 (11.1%), acute intracerebral hemorrhage 3 (8.3%), cerebral hemiatrophy 2 (5.6%), and solitary ring‑enhancing lesions 1 (2.8%). Eight patients with single or ...

  15. Becoming a Blood Stem Cell Donor

    Medline Plus

    Full Text Available ... Marrow Transplant - Mayo Clinic - Duration: 2:21. Mayo Clinic 194,730 views 2:21 Loading more suggestions... Show more Language: English Location: United States Restricted Mode: Off History Help Loading... Loading... Loading... About Press Copyright Creators ...

  16. Gclust Server: 192963 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 192963 DME_CG10934_19922472 Cluster Sequences - 194 CG10934: CG10934-PA 1 1.00e-99 ...0.0 0.0 0.0 0.0 0.0 12.5 Show 192963 Cluster ID 192963 Sequence ID DME_CG10934_19922472 Link to cluster sequ

  17. 25 original article hematological derangement patterns in nigerian ...

    African Journals Online (AJOL)

    boaz

    Immunopathology, 2002; 87 : 187 – 194. 4. Poltera, A. A. Pathology of human African. Trypanosomiasis with reference to African. Trypanosomiasis and infections of the central nervous system. British Medical. Bulletin, 1985; 41 (2): 169-174. 5. Abenga J. N. A comparative pathology of. Trypanosoma brucei infections. Global.

  18. Prevalence and management of diarrhoea among children in ...

    African Journals Online (AJOL)

    These were distributed to parents of the children used for the study. Using Pearson's correlation coefficient, we found that diarrhoea among children of this age was neither correlated with residential location (r = -0.47, p = 0.652), occupation of the parent (r = 0.134, p = 0.194) nor sex of the child (r = 0.092, p = 0.377).

  19. 29 CFR 19.3 - Authorization.

    Science.gov (United States)

    2010-07-01

    ... written request under the Act only if: (a) No administrative summons or subpoena authority reasonably... records are sought; (b) There is reason to believe that the records sought are relevant to a legitimate... delegate this authority to others; (d) The request adheres to the requirements set forth in § 19.4; and (e...

  20. UN-EDITED VERSION

    Indian Academy of Sciences (India)

    38

    480. doi: 10.3389/fimmu.2013.00480. Roth GS and Hess GD 1982 Changes in mechanisms of hormone and neurotransmitter action during aging: current status of receptor and post-receptor alterations. Mech. Ageing. Dev. 20. 175-194. Sands JM 2003 Urine-concentrating ability in the aging kidney. Sci. Aging Knowledge ...

  1. Children's Perception of Television Commercial in Lagos State ...

    African Journals Online (AJOL)

    Nekky Umera

    Gbadeyan, R. A. - Faculty of Business and Social Sciences, Department of ... such as advertisements on the radio, in print media, on public transportation ..... Table 2: Distribution of Respondents Based on What Interest Them on the. Television Commercial. WHAT INTEREST CHILDREN. PERCENTAGE (%). Music. 19.4.

  2. Research Organizations Interview the Poor

    Science.gov (United States)

    Weiss, Carol H.

    1974-01-01

    Researchers who conducted 194 interviews surveys of low income populations returned mail questionnaires about their experiences; the results are interpreted as bearing upon both the ease or difficulty of interviewing poor people and how advisable it may be to employ interviewers matched to respondents by class and race/ethnicity in surveys of the…

  3. Accuracy of Self-Reported College GPA: Gender-Moderated Differences by Achievement Level and Academic Self-Efficacy

    Science.gov (United States)

    Caskie, Grace I. L.; Sutton, MaryAnn C.; Eckhardt, Amanda G.

    2014-01-01

    Assessments of college academic achievement tend to rely on self-reported GPA values, yet evidence is limited regarding the accuracy of those values. With a sample of 194 undergraduate college students, the present study examined whether accuracy of self-reported GPA differed based on level of academic performance or level of academic…

  4. Genetics of leaf and stripe rust resistance in a bread wheat cultivar ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 87; Issue 2. Genetics of leaf and stripe rust resistance in a bread wheat cultivar Tonichi. Satinder Kaur U. K. Bansal Renu Khanna R. G. Saini. Research Note Volume 87 Issue 2 August 2008 pp 191-194 ...

  5. The Prevalence of Injuries in Professional Turkish Soccer Players

    Science.gov (United States)

    Yamaner, Faruk; Gumusdag, Hayrettin; Kartal, Alparslan; Gumus, M.; Gullu, A.; Imamoglu, O.

    2011-01-01

    Study aim: To assess the prevalence and anatomical sites of injuries in professional soccer players in one game season. Material and methods: A cohort of 510 professional male soccer players consisting of 48 goalkeepers, 194 defence players, 189 mid-field players and 79 forward players of the 1st and 2nd Turkish Professional Soccer Leagues in…

  6. ORIGINAL ARTICLE 223

    African Journals Online (AJOL)

    boaz

    Basaca-Sevilla V., Cross J. H., Alquiza L.,. Lacap T. Prevalence of Trichomonasvaginalisin some Filipino women, Southeast. Asian J. Trop. Med. Public Health. 1986;. 17(2): 194–196. 6. Jamali R., Zareikar R., Kazemi A., Yousefee. S. Diagnosis of Trichomonasvaginalisinfection using PCR method compared to culture and.

  7. ASSESSMENT OF THE PHYT curcas IN THE REMOVAL OF HEAVY ...

    African Journals Online (AJOL)

    userpc

    Revista Chilena de Historia. Natural. 77(1): 185-194. Huang, J.W, Chen J, Casper, T and Cunningham, S.D.. (1997). Phytoextraction of Lead from. Contaminated Soils. In Kruger, E.L. T.A.. Anderson and J.R. Coats (Eds.), Phyto. Soils. Wat.Contam., pp: 283-289. IITA (International Institute for Tropical Agriculture). (1979).

  8. Heavy metal concentrations in soils and accumulation in plants ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-09-03

    Sep 3, 2008 ... Szegediensis 46(3-4): 113-114. Ginocchio R, Baker AJM (2004). Metallophytes in Latin America: a remarkable biological and genetic resource scarcely known and studied in the region, Revista Chilena de Historia Natural 77: 185-. 194. Kabata-Pendias A, Pendias H (2001). Trace elements in soils and.

  9. Slaaphouding en toedekken van zuigelingen in het najaar van 1994 [Sleeping positions and bed clothes of infants in the autumn of 1994

    NARCIS (Netherlands)

    Burgmeijer, R.J.F.; Jonge, G.A. de

    1995-01-01

    Objective: To determine whether the sleeping position and the use of duvets in infants in 1994 had changed in comparison with earlier years. Design: Questionnaire survey. Setting: Nationwide investigation in infant welfare centres. Method: 194 infant welfare centres participated in the

  10. 2017-11-05T01:16:22Z https://www.ajol.info/index.php/all/oai oai:ojs ...

    African Journals Online (AJOL)

    Aderinto, AA; Social Sciences and Reproductive Health Research Network, East Gate Road, University College Hospital, Ibadan. Olawoye, JE ... African Journal for the Psychological Study of Social Issues Vol.7(2) 2004: 167-194 Department of Psychology, University of Ibadan 2005-05-27 info:eu-repo/semantics/article ...

  11. Machiavellianism, Relationship Satisfaction, and Romantic Relationship Quality

    OpenAIRE

    Brewer, G; Abell, L

    2017-01-01

    Machiavellianism is characterised by a manipulative interpersonal style, willingness to exploit others, and a preference for emotionally detached relationships. The present studies investigate the extent to which Machiavellianism influences relationship satisfaction and romantic relationship quality. In study 1, 194 heterosexual partnered women completed Machiavellianism and Relationship Satisfaction measures. Women with higher levels of Machiavellianism reported lower levels of relationship ...

  12. Probabilistically Bounded Staleness for Practical Partial Quorums

    Science.gov (United States)

    2012-01-03

    Conway, J. M. Hellerstein, and W. R. Marczak. Consistency Analysis in Bloom: a CALM and Collected Approach. In CIDR 2011. [13] M. Armbrust, K. Curtis, T... CIDR 2009. [34] M. Herlihy. Dynamic quorum adjustment for partitioned data. ACM Transactions on Database Systems, 12 (2):170–194, 1987. [35] M

  13. 5 CFR 2641.102 - Applicability.

    Science.gov (United States)

    2010-01-01

    ... provisions of 18 U.S.C. 207 as amended by the Ethics Reform Act of 1989, title I, Public Law 101-194, 103... the Ethics in Government Act of 1978, title V, Public Law 95-521, 92 Stat. 1864 (with amendments... Administrative Personnel OFFICE OF GOVERNMENT ETHICS GOVERNMENT ETHICS POST-EMPLOYMENT CONFLICT OF INTEREST...

  14. 40 CFR 98.193 - Calculating GHG emissions.

    Science.gov (United States)

    2010-07-01

    ... month n, determined according to § 98.194(c) (metric tons MgO/metric ton lime). 2000/2205 = Conversion...). 2000/2205 = Conversion factor for metric tons to tons. (iii) You must calculate the annual CO2.../2205 = Conversion factor for metric tons to tons. (iv) You must calculate annual CO2 process emissions...

  15. Excitation functions of deuteron-induced nuclear reactions on natural platinum up to 24 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Khandaker, Mayeen Uddin, E-mail: mu_khandaker@yahoo.com [Department of Physics, University of Malaya, 50603 Kuala Lumpur (Malaysia); Haba, Hiromitsu; Murakami, Masashi [Nishina Center for Accelerator-Based Science, RIKEN, Wako, Saitama 351-0198 (Japan); Otuka, Naohiko [Nuclear Data Section, Division of Physical and Chemical Sciences, Department of Nuclear Sciences and Applications, International Atomic Energy Agency, A-1400 Vienna (Austria); Kassim, Hasan Abu [Department of Physics, University of Malaya, 50603 Kuala Lumpur (Malaysia)

    2015-11-01

    Excitation functions of the {sup nat}Pt(d,x){sup 192,193,194,195,196m2,196,198m,198,199}Au, {sup 195m,197}Pt and {sup 190(g+m1+0.086m2),192(g+m1),194m}Ir nuclear reactions were measured from the respective threshold up to 24 MeV deuteron energy by using the stacked foil activation technique combined with HPGe gamma-ray spectrometry. Measured data were critically compared with the available literature data and theoretical data extracted from the TENDL-2013 library, and only partial agreement among them was found. Physical thick target yields for the investigated reaction products were also deduced and compared with the directly measured ones in the literature. The deduced yield curves indicate that a low energy cyclotron (<15 MeV) and a highly enriched {sup 198}Pt target could be used to obtain {sup 198,199}Au in no carrier added form. All cross-sections for {sup 190(g+m1+0.086m2),194m}Ir and those for {sup 193,194,196m2,196,199}Au, and {sup 195m,197}Pt in the lower energy region are reported for the first time.

  16. Africa Insight - Vol 45, No 4 (2016)

    African Journals Online (AJOL)

    A Comparative Analysis of The Carbon Footprint of Middle Income and Low Income Households in Two Townships in Ndola, Zambia · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Moses Mwambeni, Wizaso Munthali, Phenny Mwaanga, 182-194 ...

  17. Intergenerational Contact and Mediators Impact Ambivalence towards Future Selves

    Science.gov (United States)

    Jarrott, Shannon E.; Savla, Jyoti

    2016-01-01

    Intergenerational contact can promote positive attitudes towards elders. However, contact with older adults often fosters multiple stereotypes, which may contribute to ambivalence about aging and poorer health in late life. Online survey data from 457 young adults (M age = 19.4 years; 74% female) were used to explore the relationship between…

  18. Evaluating Voltage Regulation Compliance of MIL-PRF-GCS600A (Army) for Vehicle On-Board Generators and Assessing Overall Vehicle Bus Compliance

    Science.gov (United States)

    2012-08-16

    Characterization • Back EMF Measurement and Characterization • Rotor Inertia • Spinning Losses (Iron Loss, Friction, Windage) – Spin Down Test...Speed (rpm) UNCLASSIFIED UNCLASSIFIED Electrical and Mechanical Response Estimation 16 August 2012 1.87 1.88 1.89 1.9 1.91 1.92 1.93 1.94 1.95

  19. MSmetrix: accurate untrained method for longitudinal lesion segmentation

    OpenAIRE

    Jain, Saurabh; Sima, Diana; Maertens, Anke; Van Huffel, Sabine; Maes, Frederik; Smeets, Dirk

    2015-01-01

    Jain S., Sima D.M., Maertens A., Van Huffel S., Maes F., Smeets D., ''MSmetrix: accurate untrained method for longitudinal lesion segmentation'', Multiple sclerosis journal, vol. 21 (S11), pp. 193-194, 2015 (31th congress of the European Committee for Treatment and Reseach in Multiple Sclerosis (ECTRIMS), October 7-10, 2015, Barcelona, Spain).

  20. An analysis of the generalized double-sliding models for cohesionless granular materials

    NARCIS (Netherlands)

    Kruyt, Nicolaas P.

    1990-01-01

    A well-known class of constitutive relations for cohesionless granular materials are the double-sliding models. The double-sliding model proposed by Spencer (J. Mech. Phys. Solids, 12, 337, 1964) for incompressible materials as well as those of Spencer and Kingston (Rheol. Acta, 12, 194, 1974) and

  1. 2016-2017 Travel Expense Reports for Mary Anne Chambers ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Beata Bialic

    Purpose: Attend Canada School of Public Service Course on Crown Corporations. Date(s):. 2016-11-28 to 2016-11-29. Destination(s):. Ottawa. Airfare: $212.58. Other. Transportation: $29.05. Accommodation: $194.37. Meals and. Incidentals: $51.19. Other: $0.00. Total: $487.19. Comments: 2016-2017 Travel Expense ...

  2. Antifungal activity of plant growth-promoting rhizobacteria isolates ...

    African Journals Online (AJOL)

    Strains WPR-51, WPR-42 and WM-30 were selected to test in planta antagonistic activity on two wheat verities infected with R. solani. These three strains belonging to Azotobacter and Azospirillum produced IAA ranging from 19.4 to 30.2 ug/ml and possessed phosphorus solublization capability. Out of these three strains ...

  3. 76 FR 76743 - Government-Owned Inventions; Licensing and Collaborative Research Opportunity: Chemotoxins for...

    Science.gov (United States)

    2011-12-08

    ... selected inventions to extend market coverage for companies and may also be available for licensing. FOR.... Intellectual Property and Developmental Status Viral Chemokine Antigen Fusion Proteins (E-194-2000). Patent... and pre-clinical development ongoing. Anti-Tumor Immunity Elicited by Defensin Tumor Antigen Fusion...

  4. Gclust Server: 98292 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences Related Sequences(194) 167 nhr-31: Nuclear Hormone Receptor family member (nhr-31) 1 1.00e-90 0.0...167 Representative annotation nhr-31: Nuclear Hormone Receptor family member (nhr-31) Number of Sequences

  5. Epidemiology Of Neural Tube Defects In North Central Nigeria | Uba ...

    African Journals Online (AJOL)

    The sites mostly affected were the lumbosacral and the thoracolumbar regions in 55.8% and 31.9% of cases, respectively. Hydrocephalus was the most common complication occurring in 194 (68.3%) patients. Among those patients presenting with myelomeningocele, 95 (42%) had ruptured sacs, while in 62 (27.4%) the ...

  6. Internal correction of hafnium oxide spectral interferences and mass bias in the determination of platinum in environmental samples using isotope dilution analysis.

    Science.gov (United States)

    Rodríguez-Castrillón, José Angel; Moldovan, Mariella; García Alonso, J Ignacio

    2009-05-01

    A method has been developed for the accurate determination of platinum by isotope dilution analysis, using enriched (194)Pt, in environmental samples containing comparatively high levels of hafnium without any chemical separation. The method is based on the computation of the contribution of hafnium oxide as an independent factor in the observed isotope pattern of platinum in the spiked sample. Under these conditions, the ratio of molar fractions between natural abundance and isotopically enriched platinum was independent of the amount of hafnium present in the sample. Additionally, mass bias was corrected by an internal procedure in which the regression variance was minimised. This was possible as the mass bias factor for hafnium oxide was very close to that of platinum. The final procedure required the measurement of three platinum isotope ratios (192/194, 195/194 and 196/194) to calculate the concentration of platinum in the sample. The methodology has been validated using the reference material "BCR-723 road dust" and has been applied to different environmental matrices (road dust, air particles, bulk wet deposition and epiphytic lichens) collected in the Aspe Valley (Pyrenees Mountains). A full uncertainty budget, using Kragten's spreadsheet method, showed that the total uncertainty was limited only by the uncertainty in the measured isotope ratios and not by the uncertainties of the isotopic composition of platinum and hafnium.

  7. Methods and problems of testing TiO2 photocatalytic products and standardization

    Czech Academy of Sciences Publication Activity Database

    Peterka, F.; Kavan, Ladislav; Balek, Vladimír; Šubrt, Jan; Štengl, Václav; Lukeš, Petr; Krýsa, J.; Jirkovský, Jaromír

    2002-01-01

    Roč. 9, č. 12 (2002), s. 194-195 ISSN 1345-5818. [Symposium on Recent Advances in Photocatalysis /9./. Tokio, 02.12.2002] R&D Projects: GA MŠk ME 540 Institutional research plan: CEZ:AV0Z2043910 Keywords : titanium oxide, photocatalysis, standardization Subject RIV: CB - Analytical Chemistry, Separation

  8. Analysis of mtDNA hypervariable region II for increasing the ...

    African Journals Online (AJOL)

    aghomotsegin

    2015-03-11

    Mar 11, 2015 ... positions G92C, C113G, C150G, T156A, C194G, C198G, G207C, G225C and G228C are described and may in future be suitable sources for identification purpose. The data obtained can be used to identify variable nucleotide positions characterized by frequent occurrence most promising for identification.

  9. Chemical composition, true metabolisable energy content and ...

    African Journals Online (AJOL)

    aneldavh

    Erickson, J.P., 1985. Lupins show potential as protein source for livestock. Feedstuffs 57, 22–23. Evans, A.J. & Cheung, P.C.K., 1993. The carbohydrate composition of cotyledons and hulls of cultivars of. Lupinus angustifolius from Western Australia. J. Sci. Food Agric. 61, 189–194. Garrido, A., Gomez-Cabrera, A., Guerrero, ...

  10. Effects of melatonin on the quality of life in patients with delayed sleep phase syndrome.

    NARCIS (Netherlands)

    Nagtegaal, J.E.; Laurant, M.W.; Kerkhof, G.A.; Smits, M.G.; Meer, Y.G.; Coenen, A.M.L.

    2000-01-01

    Compared health-related quality of life of 43 delayed sleep phase syndrome (DSPS) patients (mean age 34.1 yrs) with a random Dutch sample of 1,063 Ss (aged 18-89 yrs) and 95 sleep apnea, 262 clinical depression, 546 migraine, and 194 osteoarthritis patients. The effectiveness of treatment with 5 mg

  11. Video gaming and children's psychosocial wellbeing: A longitudinal study

    NARCIS (Netherlands)

    Lobel, A.M.; Engels, R.C.M.E.; Stone, L.L.; Burk, W.J.; Granic, I.

    2017-01-01

    The effects of video games on children's psychosocial development remain the focus of debate. At two timepoints, 1 year apart, 194 children (7.27-11.43 years old; male = 98) reported their gaming frequency, and their tendencies to play violent video games, and to game (a) cooperatively and (b)

  12. AcEST: BP911513 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ribosomal protein S23 OS=Spodoptera fru... 194 2e-49 sp|Q6EV23|RS23_PAPDA 40S ribosomal protein S23 OS=Papilio dardan...23_PAPDA 40S ribosomal protein S23 OS=Papilio dardanus GN=RpS23 PE=2 SV=1 Length

  13. Serum AGEs in black South African patients with type 2 diabetes

    African Journals Online (AJOL)

    diabetic control group with one another. Note: rs: Spearman correlation coefficient. **Significant at the 0.01 level (1-tailed). Factor. TAGEs. CML. CEL. FAGEs. TAGEs rs. 1.00. 0.665**. −0.194. 0.385 p (1-tail). 0.000. 0.080. 0.091. CML rs. 0.665**.

  14. DR. H. BERKHOF, en VertfacAtiny, Holland Uitgevers maatschappij ...

    African Journals Online (AJOL)

    Test

    DR. H. BERKHOF, en VertfacAtiny, Holland Uitgevers maatschappij Amsterdam, 1948, 194 bis., prys 12/6. Die vererende versoek om bogenoemde boek in hierdie kolomme te bespreek het my in nie geringe verleentheid gebring nie, want om die waarheid te sê, kan ek feitlik niks as goeds daarvan getuig nie, met ander ...

  15. Nachbar zweier deutscher Staaten. Dänemark, die Bundesrepublik und die DDR

    DEFF Research Database (Denmark)

    Lammers, Karl Christian

    Artiklen omhandler den danske politik over for de to tyske stater fra 1949. Danmark var eneste NATO- land, der under den Kolde Krig havde grænser til begge tyske stater, og det stillede Danmark i en særlig position.   The article treats with Danish politics towards the two German states after 194...

  16. 26 CFR 1.461-1 - General rule for taxable year of deduction.

    Science.gov (United States)

    2010-04-01

    ... property where the estimated life of the improvements is in excess of the remaining period of the lease. In... rules governing the effect to be given renewal options in determining whether the useful life of the... 170 (charitable contributions), section 192 (black lung benefit trusts), section 194A (employer...

  17. Numerical modelling on fate and transport of petroleum ...

    Indian Academy of Sciences (India)

    Alfnes E, Breedveld G D, Kinzelbach W and Aagaard P 2004. Investigation of hydrogeologic processes in a dipping layer structure 2. Transport and biodegradation of organics;. J. Contam. Hydrol. 69 173–194. Antonopoulos V Z 2006 Water movement and heat transfer simulations in a soil under Ryegrass; Biosys. Engg. 95.

  18. Four key findings to promote good health and well-being for all ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2017-09-14

    being of the global population at their center, were adopted by 194 countries in September 2015. With a specific focus on health, SDG #3 will influence the achievement of many of the other 16 SDGs, just as the progress toward ...

  19. Charismatic aspect of transformational leadership and its role in creating organizational culture / Gerda Mihhailova, Kulno Türk

    Index Scriptorium Estoniae

    Mihhailova, Gerda

    2006-01-01

    Ettevõtte kasvu- ja küpsusfaasis vajatakse autorite hinnangul enam nn. klassikalisi juhte, karismaatilised juhid sobivad pigem radikaalseid muutusi nõudvatesse situatsioonidesse, nagu näiteks ettevõtte rajamine või selle langusfaasist välja toomine. Skeemid. Tabel. Lisa lk. 194

  20. Hollow-Core Fiber Lamp

    Science.gov (United States)

    Yi, Lin (Inventor); Tjoelker, Robert L. (Inventor); Burt, Eric A. (Inventor); Huang, Shouhua (Inventor)

    2016-01-01

    Hollow-core capillary discharge lamps on the millimeter or sub-millimeter scale are provided. The hollow-core capillary discharge lamps achieve an increased light intensity ratio between 194 millimeters (useful) and 254 millimeters (useless) light than conventional lamps. The capillary discharge lamps may include a cone to increase light output. Hollow-core photonic crystal fiber (HCPCF) may also be used.

  1. Synthesis of New Prophylactic Antiradiation Drugs.

    Science.gov (United States)

    1982-08-01

    Pharmacognosy ELECTE College of Pharmacy, University of Illinois DEC17 194 at the Medical Center Chicago, Illinois 60680 SS "LU DOD DISTRIBUTION STATEMENT...AND ADDRESS 10. PROGRAM ELEMENT. PROJECT. TASK Department of Medicinal Chemistry and Pharmacognosy AREA & WORK UNIT NUMBERS College of Pharmacy

  2. The INSIG2 rs7566605 polymorphism is not associated with body mass index and breast cancer risk

    DEFF Research Database (Denmark)

    Campa, Daniele; Hüsing, Anika; McKay, James D.

    2010-01-01

    of choice to evaluate body fatness and there is evidence that body fatness is related with an increased risk of breast cancer (BC). Methods we tested in a large-scale association study (3,973 women, including 1,269 invasive BC cases and 2,194 controls), nested within the EPIC cohort, the involvement of rs...

  3. Knowledge of Autism among school personnel in the Garki District of ...

    African Journals Online (AJOL)

    This paper investigated knowledge of autism among school personnel in the Garki District of the Federal Capital Territory Abuja. The study sample comprised 194 school personnel made up of 82 males and 112 females. The respondents were randomly selected from government- owned primary and secondary schools ...

  4. Employed Carers' Empathy towards People with Intellectual Disabilities: The Development of a New Measure and Some Initial Theory

    Science.gov (United States)

    Collins, Kirsten; Gratton, Caroline; Heneage, Celia; Dagnan, Dave

    2017-01-01

    Background: This study aimed to develop a self-report measure of paid caregivers' empathy towards people with intellectual disabilities. Materials and Methods: Following questionnaire development, 194 staff working in services for people with intellectual disabilities completed self-report questionnaires, including the new empathy measure. The…

  5. Structure, Dynamics, and Interactions of a C4'-Oxidized Abasic Site in DNA: A Concomitant Strand Scission Reverses Affinities

    Czech Academy of Sciences Publication Activity Database

    Patel, C.; Dršata, Tomáš; Lankaš, Filip; Dumont, E.

    2013-01-01

    Roč. 52, č. 45 (2013), s. 8115-8125 ISSN 0006-2960 Institutional support: RVO:61388963 Keywords : duplex DNA * hydrogen-bonds * AP sites * tandem lesions * oxidation Subject RIV: CE - Biochemistry Impact factor: 3.194, year: 2013

  6. Breath Analysis and the Measurement of Total Body Water Using Isotope Dilution - Applications in the Dialysis Clinic

    Czech Academy of Sciences Publication Activity Database

    Davies, S. J.; Engel, B.; Chan, C.; Tan, B. K.; Yu, Z.; Asghar, R. B.; John, B.; Španěl, Patrik; Smith, D.

    2013-01-01

    Roč. 9, č. 4 (2013), s. 593-599 ISSN 1573-4110 R&D Projects: GA ČR GA203/00/0632 Institutional support: RVO:61388955 Keywords : bioimpedance * body composition * dialysis Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.194, year: 2013

  7. 76 FR 44907 - Cancellation of Pesticides for Non-Payment of Year 2011 Registration Maintenance Fees

    Science.gov (United States)

    2011-07-27

    ... impact on the availability of the pesticide for the use. The Agency has waived the fee for 194 minor.... 000777-00090 Lysol Brand Disinfectant All Purpose Cleaner II. 000777-00092 RB 101. 000777-00093 Lysol Brand II Disinfectant Mist Away Daily Shower Cleaner. 000777-00098 Brace Kitchens. 000777-00103...

  8. Ajaleht Pravda ja 40 keisri hullu : "40 kiri" sündis siis, kui teisiti enam ei saanud / Lauri Vahtre

    Index Scriptorium Estoniae

    Vahtre, Lauri, 1960-

    2005-01-01

    Eesti kultuuritegelaste kirjutatud "40 kirjast" 1980. aastal, kus tunti muret Eesti ühiskonna ja kultuuri tuleviku pärast. Artikkel sisaldab kirjale allakirjutanute nimesid. Ilmunud ka rmt.: Vahtre, Lauri. Ajaloo pööripäevad. Tallinn, 2006, lk. 190-194

  9. 76 FR 22670 - Black Hills National Forest, Hell Canyon Ranger District, South Dakota, Vestal Project

    Science.gov (United States)

    2011-04-22

    ... potential for high severity wildfire adjacent to the at-risk community of Custer, SD. The proposal is being... the town of Custer, SD and overall fire hazard in the area is high due to dense stand conditions and... area are privately owned, with an estimated 3,194 private structures. Proposed Action Thin and harvest...

  10. Patterns of bone loss around teeth restored with endodontic posts

    NARCIS (Netherlands)

    Katsamakis, S.; Timmerman, M.; van der Velden, U.; de Cleen, M.; van der Weijden, F.

    2009-01-01

    Objectives: This retrospective study described the pattern of bone loss around teeth with endodontic posts in periodontitis patients, and compared it with contra-lateral teeth without posts. Material and Methods: From full-mouth radiographic surveys of 146 periodontitis patients (35 years), 194

  11. Linguo-Intercultural Sensitivity and Its Predictors in EFL in a Bosnian Sample

    Science.gov (United States)

    Aydogan, Hakan; Akbarov, Azamat

    2015-01-01

    In this article, the predictive power of five variables relevant for Linguo-intercultural sensitivity (flexibility) is examined. Communication aspect of intercultural interactions, specifically, the role of English as an international language are emphasized. Attitudes Towards English and Its Usage Scale (ATEUS) was applied to 194 students who…

  12. Comparative Age Differences of Job Satisfaction on Faculty at Higher Education Level: China and Taiwan

    Science.gov (United States)

    Tu, Leafy; Plaisent, Michel; Bernard, Prosper; Maguiraga, Lassana

    2005-01-01

    Purpose--The study aims to examine the age differences of job satisfaction between Taiwanese and Chinese higher education faculty. Design/methodology/approach--The data on job satisfaction were obtained from 194 Taiwanese faculty and 211 Chinese faculty at college levels in one city. Findings--No statistically significant differences were found…

  13. 78 FR 53757 - Information Collections Being Submitted for Review and Approval to the Office of Management and...

    Science.gov (United States)

    2013-08-30

    ... Regulations Implementing the Controlling the Assault of Non-Solicited Pornography and Marketing Act of 2003... Assault of Non-Solicited Pornography and Marketing Act of 2003 (CAN-SPAM Act). This information is used to... of Non-Solicited Pornography and Marketing Act of 2003, CG Docket No. 04-53, FCC 04-194, published at...

  14. An Analysis of Certain Job Tasks Performed by Selected Ohio Industrial Supervisors.

    Science.gov (United States)

    Stewart, William Joseph

    Using a pretested questionnaire, a survey was made of specific task performance and educational needs of first-line industrial supervisors in Ohio. The questionnaire, consisting of 120 task items under the headings of Transmission of Communications, Building of Management Skills, and Change in Attitudes, was administered to 472 supervisors, 194

  15. Ice-Candy-Man and In the Country of Men: The politics of cruelty and ...

    African Journals Online (AJOL)

    The novel was retitled Cracking India in the later, American edition (2006 [1991]). 2. Compare Dennis Walder (2007:194-195): "The value of postcolonial theory and criticism lies in its attention to forms of cultural representation, especially literary representation, in a way that is alive to the claims of contemporary history and.

  16. Die Änderungen der Arbeitsbedingungen im französischen Individualarbeitsrecht

    OpenAIRE

    Hintermeier, Jürgen H.

    1984-01-01

    Die Änderungen der Arbeitsbedingungen im französischen Individualarbeitsrecht : Versuch e. Abgrenzung d. "acte du pouvoir de direction" von d. "modification unilatérale du contrat" mit einigen Hinweisen zum dt. Recht. - Heidelberg : Decker, 1984. - XIII, 194 S. - Zugl.: Augsburg, Univ., Diss., 1981. - (Schriften zum Wirtschafts-, Arbeits- und Sozialrecht ; 25)

  17. Evaluation of the Ration, Cold Weather, by Navy Seals, 1984

    Science.gov (United States)

    1986-07-01

    improvised shelters (snow c aves) . 2. Exercise Highland Stroller , 13-16 February. A nightime ski exercise covering 70 kilometers over three nights...windchill factor of -67oc. The average temperatures for Exercise Hunter’s Moon, Exercise Highland Stroller , and Exercise Quantum Leap were -19.4oC, -9.8oc

  18. Running Head: Improving Pharmacy Customer Satisfaction

    Science.gov (United States)

    2006-06-29

    maneuver around, especially for 7someone with a baby stroller , a wheel chair, crutches, a walker, a cane, or any apparatus that accompanies them such as...Satisfaction Measurement, Current Issues and Implications. Lippincott’s Case Management. 7, 5, 194-200. a a ] ]3 Pharmacy Satisfaction 52 1Appendix A

  19. Prevalence of Mycobacterium bovis in Cattle Slaughtered at Sokoto ...

    African Journals Online (AJOL)

    This study was undertaken to screen cattle slaughtered at the Sokoto Central Abattoir for antibodies against Mycobacterium bovis. By the lateral flow technique (immunochromatography), using monoclonal antibodies for M. bovis (BioNote, Inc. Gyeonggi-do, Korea) and by post mortem examination. A total of 194 slaughtered ...

  20. Effectiveness of an intervention to reduce sickness absence in patients with emotional distress or minor mental disorders: a randomized controlled effectiveness trial.

    NARCIS (Netherlands)

    Brouwers, E.P.M.; Tiemens, B.G.; Terluin, B.; Verhaak, P.F.M.

    2006-01-01

    OBJECTIVE: The purpose of this study was to evaluate the effectiveness of an activating intervention designed to reduce sick leave duration in patients with emotional distress or minor mental disorders. METHOD: In a 1.5-year randomized controlled trial, 194 patients with minor mental disorders

  1. Saccadic Reaction Times in Infants and Adults: Spatiotemporal Factors, Gender, and Interlaboratory Variation

    Science.gov (United States)

    Kenward, Ben; Koch, Felix-Sebastian; Forssman, Ida; Brehm, Julia; Tidemann, Linda; Sundqvist, Annette; Marciszkom, Carin; Hermansen, Tone Kristine; Heimann, Mikael; Gredebäck, Gustaf

    2017-01-01

    Saccade latency is widely used across infant psychology to investigate infants' understanding of events. Interpreting particular latency values requires knowledge of standard saccadic RTs, but there is no consensus as to typical values. This study provides standard estimates of infants' (n = 194, ages 9 to 15 months) saccadic RTs under a range of…

  2. Effects of Behavioral Weight Control Intervention on Binge Eating Symptoms among Overweight Adolescents

    Science.gov (United States)

    Mehlenbeck, Robyn S.; Jelalian, Elissa; Lloyd-Richardson, Elizabeth E.; Hart, Chantelle N.

    2009-01-01

    This study examined change in binge eating symptoms reported by moderately overweight adolescents following participation in a behavioral weight control intervention. A total of 194 adolescents across two randomized controlled trials participated. Adolescents in both study samples endorsed a mild level of binge eating symptoms at baseline. Results…

  3. East Cent. Afr. j. surg.

    African Journals Online (AJOL)

    DELL

    The incidence of Diabetes mellitus has been increasing over the past decade. In Africa, incidence and prevalence rates of ... Diabetic foot problems are very common. They have a significant impact on the ..... Microbiology of Diabetic Foot Infections in a Teaching Hospital in Malaysia; a retrospective study of 194 cases.

  4. Parent Reports of Young Spanish-English Bilingual Children's Productive Vocabulary: A Development and Validation Study

    Science.gov (United States)

    Mancilla-Martinez, Jeannette; Gámez, Perla B.; Vagh, Shaher Banu; Lesaux, Nonie K.

    2016-01-01

    Purpose: This 2-phase study aims to extend research on parent report measures of children's productive vocabulary by investigating the development (n = 38) of the Spanish Vocabulary Extension and validity (n = 194) of the 100-item Spanish and English MacArthur-Bates Communicative Development Inventories Toddler Short Forms and Upward Extension…

  5. The Attitude Scale towards Distance Nursing Education (AstDNE)

    Science.gov (United States)

    Boz Yuksekdag, Belgian; Unsal Barlas, Gul

    2015-01-01

    In this study, a measurement is seen as an instrument to measure the attitudes of the nurses towards the distance nursing education was developed. The study population consist of nurses who working in two hospitals of the ministry of health and two special hospitals in Istanbul. The sample of the study consisted of 194 nurses who agreed to…

  6. Data of evolutionary structure change: 1B06E-2CDYD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available nce>QIMGQ--GQANQ >H -- > ATOM 55...Chain>E 1B06E NNMAPAGKGGGK re>H ...IDChain>2CDYD LVVKD--GKLDV ture...>EEEE -- EEEE> ATOM 5896 CA LEU D 136 10.194 35.852 6.892 1.0...IDChain> LYYDNESGNLQI >E EE>

  7. The Construct of State-Level Suspicion A Model and Research Agenda for Automated and Information Technology (IT) Contexts

    Science.gov (United States)

    2013-08-01

    are being used (Lee & See, 2004) Ease of use of a web site (“site quality” in McKnight et al., 2002; navigability, spelling , grammar in Metzger...Automation Interactions, Human Factors, 50, 194-210. Mlodinow, L. (2012). Subliminal: How your Unconscious Mind Rules your Behavior. New York, NY

  8. Allee effects and pulsed invasion by the gypsy moth

    Science.gov (United States)

    Derk M. Johnson; Andrew M. Liebhold; Patrick C. Tobin; Ottar N. Bjornstad

    2006-01-01

    Biological invasions pose considerable threats to the world's ecosystems and cause substantial economic losses. A prime example is the invasion of the gypsy moth in the United States, for which more than $194 million was spent on management and monitoring between 1985 and 2004 alone. The spread of the gypsy moth across eastern North America is, perhaps, the most...

  9. AcEST: BP916097 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |PALY_AMAMU Phenylalanine ammonia-lyase OS=Amanita musc... 30 8.8 sp|Q32LL5|INT12_BOVIN Integrator complex s...----AYC 194 >sp|O93967|PALY_AMAMU Phenylalanine ammonia-lyase OS=Amanita muscaria

  10. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 194 ... Vol 23 (2013), Cosmic tragedy in Steve Chimombo's The Python, Abstract PDF. Bright Molande. Vol 17 (2003), Culture and Societal Institutions in Chinua Achebe's Things Fall Apart: A critical reading, Details PDF. Victor Alumona. Vol 10-11, No 1 (1997), Cyclicity in Bantu: Evidence from Chichewa ...

  11. MICs of Selected Antibiotics for Bacillus anthracis, Bacillus cereus, Bacillus thuringiensis, and Bacillus mycoides From a Range of Clinical and Environmental Sources as Determined by the Etest

    Science.gov (United States)

    2004-08-01

    Cow , outbreak on sewage farm, UK, 1990 ASC 194 .......................................................Elephant, 25...10 Sept 1991, UK (33a) ASC 259 ....................................................... Cow , Zambia, 1992 ASC 266...Nongastrointestinal infection ......... F77/1589c; bovine mastitis , serotype 12 F77/2809A; infant born very edematous, serotype 6 F78/660; facial burns, cellulitis

  12. Perceptions of Domestic Violence: The Effects of Domestic Violence Myths, Victim's Relationship with Her Abuser, and the Decision to Return to Her Abuser

    Science.gov (United States)

    Yamawaki, Niwako; Ochoa-Shipp, Monica; Pulsipher, Craig; Harlos, Andrew; Swindler, Scott

    2012-01-01

    Researchers in this study examined the attitudes toward domestic violence, the victim, and her perpetrator. A total of 194 participants were randomly assigned to one of 4 hypothetical scenarios to evaluate how observers' perceptions were influenced by their own sex and myths about domestic violence, by the victim's decision to return to the…

  13. Development of an Abbreviated Social Phobia and Anxiety Inventory (SPAI) Using Item Response Theory: The SPAI-23

    Science.gov (United States)

    Roberson-Nay, Roxann; Strong, David R.; Nay, William T.; Beidel, Deborah C.; Turner, Samuel M.

    2007-01-01

    An abbreviated version of the Social Phobia and Anxiety Inventory (SPAI) was developed using methods based in nonparametric item response theory. Participants included a nonclinical sample of 1,482 undergraduates (52% female, mean age = 19.4 years) as well as a clinical sample of 105 individuals (56% female, mean age = 36.4 years) diagnosed with…

  14. The Validation of a New Obsessive-Compulsive Disorder Scale: The Obsessive-Compulsive Inventory.

    Science.gov (United States)

    Foa, Edna B.; Kozak, Michael J.; Salkovskis, Paul M.; Coles, Meredith E.; Amir, Nader

    1998-01-01

    The Obsessive-Compulsive Inventory (OCI), a new self-report measure for determining the diagnosis and severity of obsessive- compulsive disorder (OCD), was validated with 141 patients with OCD, 58 with social phobia, 44 with posttraumatic stress disorder, and 194 nonpatients. The OCI exhibited satisfactory reliability and validity with all four…

  15. How Reading Strategy Use and Personality Types Are Related?

    Science.gov (United States)

    Safdarian, Zahra; Ghyasi, Majid; Farsani, Mohammad Amini

    2014-01-01

    This study sought to uncover the reading strategies utilized by Iranian undergraduate English Foreign Language (EFL) learners and their relationship with personality types. To this end, 194 university EFL learners were asked to fill out the Myers-Briggs Type Indicator (MBTI) to identify their personality types and answer a reading strategy…

  16. Effects of adiCox®AP and monensin on production parameters and ...

    African Journals Online (AJOL)

    Monika

    2014-05-30

    May 30, 2014 ... However, the leg muscles of the control chickens were characterized by a significantly higher content of protein (19.4%) ... The plant coccidiostat effected a higher water-holding capacity (52.2%) and a lower cooking ... Meat and food products of animal origin are main elements of the human diet. One of the ...

  17. original articles

    African Journals Online (AJOL)

    heart lesions and infections, chromosomal disorders, severe n:r:II perinatal asphyxia, inborn errors of metabolism, ...... neurological abnonnalities. Am' Clin Nutr 1982; 35: 617-623. 27. Horrobin OF. Nutritional and medical importance of gamma-linolenic acid. Frog Lipid Res. 1992; 31, 163-194. 28. Uauy-Dagach R, Birch EE, ...

  18. Self-Efficacy and Burnout in Professional School Counselors

    Science.gov (United States)

    Gunduz, Bulent

    2012-01-01

    This study investigated the relationships between burnout and self-efficacy among school counselors. Also, the level of their burnout and self-efficacy was examined in terms of the social support, task perception and the number of students. A sample of 194 school counselors filled out the Maslach Burnout Inventory, The School Counselors…

  19. State Land-Use Laws in the Northeast: A Compendium and Classification of Selected Statutes. Publication 7.

    Science.gov (United States)

    Hyde, Leslie C.

    Prepared as part of the program of the Northeast Regional Center for Rural Development under Title V of the Rural Development Act of 1972, this compendium cites 194 state laws related to public control of privately owned land outside developed urban areas in 12 Northeastern States. Arranged alphabetically and ordered chronologically, this…

  20. Poly-specific association of the olive baboon ( Papio anubis ) group ...

    African Journals Online (AJOL)

    black and white colobus monkey Colobus polykomos, putty nosed monkey Cercopithecus nictitans, squirrel-Protoxerus stangeri, mona monkey Cercopithecus mona, human being Homo sapien, chimpanzee Pan troglodytes, and red river hog Potamochoerus porcus with poly specific association percentage of 32. 7, 19.4 ...

  1. Gclust Server: 98340 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences Related Sequences(194) 304 possible alpha/beta hydrolase superfamily 1 1.00e-80 0.0 0.0 4.0 0...length 304 Representative annotation possible alpha/beta hydrolase superfamily Number of Sequences 1 Homologs

  2. Living Together: The Impact of the Intifada and the Peace Negotiations on Attitudes toward Coexistence of Arab and Jewish Pupils in Ethnically Segregated and Mixed Schools in Jaffa.

    Science.gov (United States)

    Zuzovsky, Ruth

    1997-01-01

    Changes in the willingness of Jews and Arabs to coexist were studied in 1989 with 217 12-year-olds and in 1994 with 194 in Jaffa (Israel), where both Jews and Arabs live. Separatist attitudes increased and faith in coexistence decreased, but mixed schools seemed to improve attitudes toward coexistence. (SLD)

  3. The 1984 Literacy Campaign in the People's Democratic Republic of Yemen. A Case Study. Notes, Comments...No. 183.

    Science.gov (United States)

    Fara, Mohammed Saeed; Fisher, Nigel

    In 1984, the People's Democratic Republic of Yemen undertook a nationwide literacy campaign, which mobilized the entire nation in an effort to reach an estimated 194,000 illiterate people, 77 percent of them women. The campaign plan demanded the full and active participation of formal school teachers and students at secondary level and above as…

  4. The "Reading the Mind in the Voice" Test-Revised: A Study of Complex Emotion Recognition in Adults with and Without Autism Spectrum Conditions

    Science.gov (United States)

    Golan, Ofer; Baron-Cohen, Simon; Hill, Jacqueline J.; Rutherford, M. D.

    2007-01-01

    This study reports a revised version of the "Reading the Mind in the Voice" (RMV) task. The original task (Rutherford et al., (2002), "Journal of Autism and Developmental Disorders, 32," 189-194) suffered from ceiling effects and limited sensitivity. To improve that, the task was shortened and two more foils were added to each of the remaining…

  5. Forensic findings from the Nairobi U.S. embassy terrorist bombing ...

    African Journals Online (AJOL)

    The rest required fingerprinting (3%), DNA testing (2%), and forensic odontology (1%). Ninety six percent of the victims (194 cases) had primary blast injuries. The typical triad of blast fragmentation injuries was found in only 47% of the cases. Eighty nine percent (179 cases) had injuries in multiple anatomical regions.

  6. 77 FR 59768 - Shipping and Transportation; Technical, Organizational, and Conforming Amendments

    Science.gov (United States)

    2012-10-01

    ..., 193, 194, 195, 197, 199, and 401 49 CFR Parts 450, 451, 452, and 453 RIN 1625-AB87 Shipping and... Guard shipping and transportation regulations. This rule will have no substantive effect on the... card, online through www.pay.gov , or U.S. Coast Guard Finance Center (OGR), 1430A Kristina Way...

  7. Dicty_cDB: Contig-U14470-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available one) Synthetic construct gene for Raich... 199 2e-49 GN080137_1( GN080137 |pid:none) Sequence 740 from Paten...7 |pid:none) Synthetic construct gene for Raich... 194 3e-48 BT045529_1( BT045529 |pid:none) Salmo salar clo

  8. Dynamic Electromagnetic Evasion-Pursuit Games with Uncertainty

    Science.gov (United States)

    2010-12-01

    Mathematical Systems, Estimation, and Control, 7 (1997), 1–34. [9] H.T. Banks, K. Ito, G.M. Kepler and J.A. Toivanen, Material surface design to counter...Princeton, 1964, 175–194. [17] P. Billingsley, Convergence of Probability Measures, John Wiley, New York, 1968. 20 [18] D. Colton and R. Kress

  9. A comparative study on the landslide susceptibility mapping using ...

    Indian Academy of Sciences (India)

    For this purpose, a landslide inventory map was constructed mainly basedon earlier reports and aerial photographs, as well as, by carrying out field surveys. A total of 194landslides were mapped. Then, the landslide inventory was randomly split into a training dataset; 70%(136 landslides) for training the models and the ...

  10. Family Adjustment Measure: Scale Construction and Validation

    Science.gov (United States)

    Daire, Andrew P.; Dominguez, Vanessa N.; Carlson, Ryan G.; Case-Pease, Jenene

    2014-01-01

    We administered the Family Adjustment Measure to 368 parents of children with special needs to identify positive adjustment. We randomly split the sample to conduct exploratory factor analysis ("n" = 194) and confirmatory factor analysis ("n" = 174). Results indicated four possible subscales and that explain 51% of the variance.

  11. Gclust Server: 14258 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Cluster Sequences Related Sequences(194) 832 dpld: dappled CG1624-PA, isoform A 7 1.00e-60 0.0 0.0 0.0 0.0...Sequence length 832 Representative annotation dpld: dappled CG1624-PA, isoform A Number of Sequences 7 Homologs

  12. Local structure in the disordered solid solution of cis- and trans-perinones

    DEFF Research Database (Denmark)

    Teteruk, Jaroslav L.; Glinnemann, Juergen; Heyse, Winfried

    2016-01-01

    The cis- and trans-isomers of the polycyclic aromatic compound perinone, C26H12N4O2, form a solid solution (Vat Red 14). This solid solution is isotypic to the crystal structures of cis-perinone (Pigment Red 194) and trans-perinone (Pigment Orange 34) and exhibits a combined positional...

  13. The use of lipids as phase change materials for thermal energy storage

    Science.gov (United States)

    Phase change materials (PCMs) are substances capable of absorbing and releasing large 2 amounts of thermal energy (heat or cold) as latent heat over constant temperature as they 3 undergo a change in state of matter (phase transition), commonly, between solid and 4 liquid phases. Since the late 194...

  14. Stereotype Threat and Gender Differences in Performance on a Novel Visuospatial Task

    Science.gov (United States)

    Campbell, Susan Miller; Collaer, Marcia L.

    2009-01-01

    Stereotype threat research has shown that being a member of a negatively stereotyped group may result in impaired performance on tests of skills thought to be relevant to the stereotype. This study investigated whether stereotype threat influences gender differences in performance on a novel test of visuospatial ability. Undergraduates (N = 194)…

  15. Gclust Server: 160417 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available es Link to related sequences - Sequence length 194 Representative annotation M6.4 Number of Sequences 1 Homologs 1 Clustering thresho...ld 1.00e-99 Plants and algae (7species) (%) 0.0 Other Bi

  16. Domain Modeling: NP_001007089.1 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_001007089.1 chrX Crystal Structure of tandem Zif268 molecules complexed to DNA c...1p47b_ chrX/NP_001007089.1/NP_001007089.1_holo_185-265.pdb blast 189Y,192C,194K,195G,196L,197R,198R,199K,200

  17. Efficacy of Psychosocial Group Intervention for Children with Chronic Illness and their Parents.

    NARCIS (Netherlands)

    Scholten, L.; Willemen, A.M.; Last, B.F.; Maurice-Stam, H.; van Dijk-Lokkart, E.M.; Ensink, E.F.A.; Zandbelt, N.; Hoop-Mooij, A.; Schuengel, C.; Grootenhuis, M.A.

    2013-01-01

    OBJECTIVE: To investigate the efficacy of a cognitive-behavioral group intervention for children with chronic illnesses and to test the effect of an added parent component. METHODS: Children (n = 194) and their parents participated in a multicenter randomized clinical trial comparing a child-only

  18. Moderators of the efficacy of a psychosocial group intervention for children with chronic illness and their parents: what works for whom?

    NARCIS (Netherlands)

    Scholten, Linde; Willemen, A. M.; Napoleone, E.; Maurice-Stam, H.; Last, B. F.; van Dijk-Lokkart, E. M.; Zandbelt, N.; Ensink, E.; Grootenhuis, M. A.; Schuengel, C.

    2015-01-01

    To investigate psychosocial characteristics of children and parents as predictors and moderators of the effect of a group intervention for children with chronic illness and their parents. Data from a randomized controlled trial were used, including 194 children (8-18 years) who were assigned to a

  19. Moderators of the efficacy of a psychosocial group intervention for children with chronic illness and their parents: what works for whom?

    NARCIS (Netherlands)

    Scholten, L.; Willemen, A.M.; Napoleone, E.; Maurice-Stam, H.; van Dijk, E.M.; Zandbelt, N.; Ensink, E.F.A.; Grootenhuis, M.; Schuengel, C.

    2015-01-01

    Objective: To investigate psychosocial characteristics of children and parents as predictors and moderators of the effect of a group intervention for children with chronic illness and their parents. Methods: Data from a randomized controlled trial were used, including 194 children (8-18 years) who

  20. Moderators of the efficacy of a psychosocial group intervention for children with chronic illness and their parents: what works for whom?

    NARCIS (Netherlands)

    Scholten, L.; Willemen, A.M.; Napoleone, E.; Maurice-Stam, H.; Last, B.F.; Dijk-Lokkart, E.M. van; Zandbelt, N.; Ensink, E.; Grootenhuis, M.A.; Schuengel, C.

    2015-01-01

    OBJECTIVE: To investigate psychosocial characteristics of children and parents as predictors and moderators of the effect of a group intervention for children with chronic illness and their parents. METHODS: Data from a randomized controlled trial were used, including 194 children (8-18 years) who

  1. Efficacy of psychosocial group intervention for children with chronic illness and their parents

    NARCIS (Netherlands)

    Scholten, L.; Willemen, A.M.; Last, B.F.; Maurice-Stam, H.; Dijk, E.M. van; Ensink, E.; Zandbelt, N.; Hoop-Mooij, A. van der; Schuengel, C.; Grootenhuis, M.A.

    2013-01-01

    OBJECTIVE: To investigate the efficacy of a cognitive-behavioral group intervention for children with chronic illnesses and to test the effect of an added parent component. METHODS: Children (n = 194) and their parents participated in a multicenter randomized clinical trial comparing a child-only

  2. Efficacy of Psychosocial Group Intervention for Children With Chronic Illness and Their Parents

    NARCIS (Netherlands)

    Scholten, Linde; Willemen, Agnes M.; Last, Bob F.; Maurice-Stam, Heleen; van Dijk, Elisabeth M.; Ensink, Elske; Zandbelt, Noortje; van der Hoop-Mooij, Aafke; Schuengel, Carlo; Grootenhuis, Martha A.

    2013-01-01

    OBJECTIVE: To investigate the efficacy of a cognitive-behavioral group intervention for children with chronic illnesses and to test the effect of an added parent component. METHODS: Children (n = 194) and their parents participated in a multi-center randomized clinical trial comparing a child-only

  3. Relationships between production and product traits in ...

    African Journals Online (AJOL)

    ... B had higher MFI for muscle aged for one or seven days, coupled with more tender meat than NB. Pairwise correlations between growth and muscle characteristics indicated that fast growing animals tend to produce less tender meat. South African Journal of Animal Science, Vol 31, Issue 3, Oct – Dec (2001): pp.181-194 ...

  4. Calibration of the Lutetium-Hafnium Clock

    National Research Council Canada - National Science Library

    Erik Scherer; Carsten Münker; Klaus Mezger

    2001-01-01

    ... −1 , in agreement with the two most recent decay-counting experiments. Lutetium-hafnium ages that are based on the previously used λ 176 Lu of 1.93 × 10 −11 to 1.94 × 10 −11 year −1 are thus ∼4...

  5. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 24; Issue 1. Issue front cover thumbnail. Volume 24, Issue 1. February 2001, pages 1-94. pp 1-21 Review---Phase Transitions. Kinetics of pressure induced structural phase transitions—A review · N V Chandra Shekar K Govinda Rajan · More Details Abstract Fulltext ...

  6. Chemical composition and biological activities of essential oils from ...

    African Journals Online (AJOL)

    2-ol (19.4%), transp- mentha-2,8-dien-1-ol (16.4%) and limonene (13.7%). The major components identified in the oil of Cymbopogon schoenanthus were piperitone (68.4%), and ä-2-carene (11.5%). The antimicrobial activity of the essential ...

  7. Vascular epiphyte vegetation in rocky savannas of southeastern Brazil

    Czech Academy of Sciences Publication Activity Database

    Alves, R. J. V.; Kolbek, Jiří; Becker, J.

    2008-01-01

    Roč. 26, 1-2 (2008), s. 101-117 ISSN 0107-055X Institutional research plan: CEZ:AV0Z60050516 Keywords : epiphytic communities * campo rupestre * Minas Gerais Subject RIV: EF - Botanics Impact factor: 0.194, year: 2008

  8. Evolutionary history of the thicket rats (genus Grammomys) mirrors the evolution of African forests since late Miocene

    Czech Academy of Sciences Publication Activity Database

    Bryja, Josef; Šumbera, R.; Kerbis Peterhans, J. C.; Aghová, Tatiana; Bryjová, Anna; Mikula, Ondřej; Nicolas, V.; Denys, C.; Verheyen, E.

    2017-01-01

    Roč. 44, č. 1 (2017), s. 182-194 ISSN 0305-0270 Institutional support: RVO:68081766 Keywords : Arvicanthini * coastal forests * late Miocene * lowland forests * mountain forests * phylogeography * Plio-Pleistocene climate changes * Rodentia * tropical Africa Subject RIV: EG - Zoology Impact factor: 4.248, year: 2016

  9. Presence of the amphibian chytrid pathogen confirmed in Cameroon

    Czech Academy of Sciences Publication Activity Database

    Baláž, V.; Kopecký, O.; Gvoždík, Václav

    2012-01-01

    Roč. 22, č. 3 (2012), s. 191-194 ISSN 0268-0130 R&D Projects: GA MŠk LC06073 Institutional support: RVO:67985904 Keywords : Afromontane * chytridiomycosis * Congolian lowland rainforests Subject RIV: EG - Zoology Impact factor: 1.081, year: 2012

  10. Research

    African Journals Online (AJOL)

    ebutamanya

    2 mars 2015 ... 9. Redfern MS, Cham R, Gielo-Perczak K, et al. Biomechanics of slips. Ergonomics. 2001; 44(13): 1138-66. PubMed | Google. Scholar. 10. Ebbeling CJ, Hamill J, Crussemeyer JA. Lower extremity mechanics and energy cost of walking in high-heeled shoes. J. Orthop Sports Phys Ther. 1994; 19(4): 190-6.

  11. Provenance and tectonic setting of the Triassic Yidun Group, the Yidun Terrane, Tibet

    Directory of Open Access Journals (Sweden)

    Bai-Qiu Wang

    2013-11-01

    Prominently high Zr/Sc ratio or Hf concentration and Paleoproterozoic Nd modal ages (1.94–2.21 Ga point to input of recycling components derived from old sedimentary source in a relatively stable tectonic setting.

  12. Green Nanochemistry Approach to Titanium Dioxide Nanoparticle, Dye- Sensitized Solar Cells

    Science.gov (United States)

    2012-06-01

    ultraviolet -visible wavelengths. In this work, we focus on the relative photon-to- electron conversion efficiency of fruit-based anthocyanin sources...of Photochemistry and Photobiology A Chemistry 2011, 219, 188–194. 4. Fuleki, T.; Francis, F. J. Quantitative Methods for Anthocyanins

  13. Aggression in Dating Relationships Compared by Country of Origin

    Science.gov (United States)

    Seligowski, Antonia; West, Doe

    2009-01-01

    Aims: The purpose of this study was to analyze prevalence levels of aggression in dating relationships and to compare this by country of origin. The study also seeks more understanding of the violence experienced by men in these countries. Method: A convenience sample was used; study participants were 194 females and 168 males ranging in age from…

  14. Mind and Body: Concepts of Human Cognition, Physiology and False Belief in Children with Autism or Typical Development

    Science.gov (United States)

    Peterson, Candida C.

    2005-01-01

    This study examined theory of mind (ToM) and concepts of human biology (eyes, heart, brain, lungs and mind) in a sample of 67 children, including 25 high functioning children with autism (age 6-13), plus age-matched and preschool comparison groups. Contrary to Baron-Cohen [1989, "Journal of Autism and Developmental Disorders," 19(4),…

  15. Case report

    African Journals Online (AJOL)

    ebutamanya

    2016-07-08

    Jul 8, 2016 ... 1. Pagon RA. Ocular coloboma. SurvOphthalmol. 1981; 25:223-. 236. PubMed | Google Scholar. 2. Onwochei BC, Simon JW, Bateman JB, Couture KC, Mir E. Ocular colobomata. SurvOphthalmol. 2000; 45:175-. 194. PubMed | Google Scholar. 3. Denis D, Girard N, Levy-Mozziconacci A, Berbis J, Matonti F.

  16. "EuroPrix 99" / Raivo Kelomees

    Index Scriptorium Estoniae

    Kelomees, Raivo, 1960-

    1999-01-01

    1998. a. algatasid Austria Majandusministeerium ja Euroopa Nõukogu võistluse "EuroPrix MultiMediaArt" väljapaistvate multimeediatoodete esiletõstmiseks. "EuroPrix 99" tutvustus. Tööde saatmise tähtaeg 30. juuni 1999. Multimeediaturust Eestis. Salzburgis korraldatud workshop multimeediaturu stimuleerimise strateegiatest. Ilmunud ka kogumikus "Ekraan kui membraan". Tartu, 2007, lk. 193-194

  17. Psychosocial Correlates of Academic Performance among Primary ...

    African Journals Online (AJOL)

    This was a correlational design study that explored the relationship between pupils' psychosocial variables such as self-esteem, hearing status, attitude towards teachers and school; and between these and academic performance. A total of 194 pupils, 110 hearing normally and 84 hearing impaired were compared in ...

  18. Parental Behaviors during Family Interactions Predict Changes in Depression and Anxiety Symptoms during Adolescence

    Science.gov (United States)

    Schwartz, Orli S.; Dudgeon, Paul; Sheeber, Lisa B.; Yap, Marie B. H.; Simmons, Julian G.; Allen, Nicholas B.

    2012-01-01

    This study investigated the prospective, longitudinal relations between parental behaviors observed during parent-adolescent interactions, and the development of depression and anxiety symptoms in a community-based sample of 194 adolescents. Positive and negative parental behaviors were examined, with negative behaviors operationalized to…

  19. Holocene erosion, sedimentation, and stratigraphy at Raven Fork, Southern Blue Ridge Mountains, USA

    Science.gov (United States)

    David S. Leigh; Paul A. Webb

    2006-01-01

    Holocene colluvial and alluvial stratigraphy and a radiocarbon chronology are presented for the valley of the lower three kilometers of Raven Fork, a mountain stream draining 194 km2 of high relief (1.3 km) terrain of the Southern Blue Ridge Mountains in western North Carolina, USA, which is in a region that lacks good chronological data. Lower hillslopes, alluvial/...

  20. EST Table: FY022111 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY022111 bmte2h22 11/11/04 100 %/206 aa ref|NP_001170882.1| tan protein [Bombyx mori] dbj|BAI87831.1| Tan... 11/11/04 53 %/194 aa gi|91078850|ref|XP_971848.1| PREDICTED: similar to tan CG12120-PA [Tribolium castaneum] AU000330 bmte ...

  1. Predictors of under-five childhood diarrhea: Mecha District, West ...

    African Journals Online (AJOL)

    admin

    regression analyses were undertaken to identify predictors of childhood diarrhea. Results: The ... Maternal education (AOR=5.6, 95% CI: 1.5 - 19.4), maternal history of recent diarrhea (AOR, 5.5; 95% CI, 2.9 - 9.8), ..... compared to early rainy season, and a limitation to the ... health in Mexico Demographic and Health Survey.

  2. HAART in hand: The change in Kaposi's sarcoma presentation in ...

    African Journals Online (AJOL)

    who were not chemotherapy or radiotherapy naïve. ... associations of HAART with age, gender, CD4 count, urban/rural residence, fungating lesions, ulceration and lymphoedema, and treatment delay ... Of 198 patients, 194 were documented as HIV-positive; 168 (86.6%) were on HAART at the time of their KS diagnosis.

  3. Discovery: Prime Numbers

    Science.gov (United States)

    de Mestre, Neville

    2008-01-01

    Prime numbers are important as the building blocks for the set of all natural numbers, because prime factorisation is an important and useful property of all natural numbers. Students can discover them by using the method known as the Sieve of Eratosthenes, named after the Greek geographer and astronomer who lived from c. 276-194 BC. Eratosthenes…

  4. Preparation of Novel Hydrolyzing Urethane Modified Thiol-Ene Networks

    Science.gov (United States)

    2011-10-25

    networks will influence the rate in which water is absorbed into the film. This work represents the preliminary characterization of the hydrolysis of...Linossier, I.; Peron , J.J.; Langlois, V.; Vallee-Rehel, K. Antifouling activity of marine paints: Study of erosion. Prog. Org. Coat. 2007, 60, 194-206

  5. Retinal Layer Location of Increased Retinal Thickness in Eyes with Subclinical and Clinical Macular Edema in Diabetes Type 2

    NARCIS (Netherlands)

    Bandello, Francesco; Tejerina, Amparo Navea; Vujosevic, Stela; Varano, Monica; Egan, Catherine; Sivaprasad, Sobha; Menon, Geeta; Massin, Pascale; Verbraak, Frank D.; Lund-Andersen, Henrik; Martinez, Jose P.; Jürgens, Ignasi; Smets, R. M. Erica; Coriat, Caroline; Wiedemann, Peter; Ágoas, Victor; Querques, Giuseppe; Holz, Frank G.; Nunes, Sandrina; Alves, Dalila; Neves, Catarina; Santos, Torcato; Ribeiro, Luisa; Cunha-Vaz, José

    2015-01-01

    To identify the retinal layer predominantly affected in eyes with subclinical and clinical macular edema in diabetes type 2. A cohort of 194 type 2 diabetic eyes/patients with mild nonproliferative diabetic retinopathy (ETDRS levels 20/35) were examined with Cirrus spectral-domain optical coherence

  6. Gclust Server: 206585 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 206585 PPT_91971 Cluster Sequences - 194 fgenesh1_pg.scaffold_218000023; no annotat...ion 1 1.00e-99 14.29 0.0 0.0 0.0 0.0 0.0 Show 206585 Cluster ID 206585 Sequence ID PPT_91971 Link to cluster

  7. South African Family Practice

    African Journals Online (AJOL)

    nectedness with mother (OR 2.4, 95% CI 1.194.98) and friend (OR 3.1, 95% CI 1.705.72) predicted current substance use. Conclusion: The study documented the important role of positive relationships between street children and their friends/mothers in preventing psychoactive substance use. South African Family Practice ...

  8. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 86; Issue 3. Issue front cover thumbnail. Volume 86, Issue 3. December 2007, pages 187-306. pp 187-187. Editorial · K. Vijay Raghavan · More Details Fulltext PDF. pp 189-194 Research Article. Genetic variation and population structure of interleukin genes among seven ethnic ...

  9. Polyaniline: Aniline oxidation with strong and weak oxidants under various acidity

    Czech Academy of Sciences Publication Activity Database

    Bláha, Michal; Trchová, Miroslava; Bober, Patrycja; Morávková, Zuzana; Prokeš, J.; Stejskal, Jaroslav

    2017-01-01

    Roč. 194, 15 June (2017), s. 206-218 ISSN 0254-0584 R&D Projects: GA ČR(CZ) GA16-02787S Institutional support: RVO:61389013 Keywords : aniline * oxidants * polyaniline Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 2.084, year: 2016

  10. Mothers' Parenting Stress and Adolescents' Emotional Separation: The Role of Youngsters' Self Orientation

    Science.gov (United States)

    Liga, Francesca; Ingoglia, Sonia; Lo Cricchio, Maria Grazia; Lo Coco, Alida

    2015-01-01

    The study examined the association among mothers' parenting stress, adolescents' emotional separation and self-orientation toward connectedness. Participants were 194 Italian adolescents, aged from 15 to 19 years (mean age = 17.39, SD = 1.18), and their mothers, aged from 33 to 64 years (mean age = 44.35, SD = 5.40). General findings showed that…

  11. Thermodynamics of Aluminum, Nitrogen and AlN formation in Liquid Iron

    National Research Council Canada - National Science Library

    Kim, Wan-Yi; Kang, Jin-Goo; Park, Chul-Hwan; Lee, Joong-Beom; Pak, Jong-Jin

    2007-01-01

    ... self interaction parameter of aluminum, and the equilibrium constant for the formation of pure solid AlN in liquid iron as follows.eNAl=−332.2/T+0.194eAlAl=111.0/T−0.016AlN (s)=Al+Nlog KAlN=−16 560/T+...

  12. The Effects on Students' Conceptual Understanding of Electric Circuits of Introducing Virtual Manipulatives within a Physical Manipulatives-Oriented Curriculum

    Science.gov (United States)

    Zacharia, Zacharias C.; de Jong, Ton

    2014-01-01

    This study investigates whether Virtual Manipulatives (VM) within a Physical Manipulatives (PM)-oriented curriculum affect conceptual understanding of electric circuits and related experimentation processes. A pre-post comparison study randomly assigned 194 undergraduates in an introductory physics course to one of five conditions: three…

  13. Co-Rumination Cultivates Anxiety: A Genetically Informed Study of Friend Influence during Early Adolescence

    Science.gov (United States)

    Dirghangi, Shrija; Kahn, Gilly; Laursen, Brett; Brendgen, Mara; Vitaro, Frank; Dionne, Ginette; Boivin, Michel

    2015-01-01

    This study tested 2 related hypotheses. The first holds that high co-rumination anticipates heightened internalizing problems. The second holds that positive relationships with friends exacerbate the risk for internalizing problems arising from co-rumination. A sample of MZ twins followed from birth (194 girls and 170 boys) completed (a)…

  14. Evaluating Hyperspectral Imaging of Wetland Vegetation as a Tool for Detecting Estuarine Nutrient Enrichment

    Science.gov (United States)

    2008-05-01

    to the decline of seagrass in nutrient-enriched coastal waters. Journal of Phycology , 37(4), 453−456. Mutanga, O., Skidmore, A. K., & van Wieren, S...of Applied Phycology , 16, 181−194. Seliskar, D. M., & Gallagher, J. L. (1983). The ecology of tidal marshes of the Pacific Northwest coast: A

  15. Genome sequence of the human- and animal-pathogenic strain Nocardia cyriacigeorgica GUH-2.

    Science.gov (United States)

    Zoropogui, Anthony; Pujic, Petar; Normand, Philippe; Barbe, Valérie; Beaman, Blaine; Beaman, LoVelle; Boiron, Patrick; Colinon, Céline; Deredjian, Amélie; Graindorge, Arnault; Mangenot, Sophie; Nazaret, Sylvie; Neto, Manuelle; Petit, Stéphanie; Roche, David; Vallenet, David; Rodríguez-Nava, Veronica; Richard, Yves; Cournoyer, Benoit; Blaha, Didier

    2012-04-01

    The pathogenic strain Nocardia cyriacigeorgica GUH-2 was isolated from a fatal human nocardiosis case, and its genome was sequenced. The complete genomic sequence of this strain contains 6,194,645 bp, an average G+C content of 68.37%, and no plasmids. We also identified several protein-coding genes to which N. cyriacigeorgica's virulence can potentially be attributed.

  16. Analysis of final year DVM research projects submitted to the Faculty ...

    African Journals Online (AJOL)

    This study analyzed the intellectual output of the undergraduate final year students. research projects submitted to the Faculty of Veterinary Medicine, Usmanu Danfodiyo University, Sokoto, from 1994 to 2004. The findings of the study show that a total of 194 research projects were produced within the period under study.

  17. Gclust Server: 97024 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences(194) 346 iron(III) dicitrate transport system permease protein 1 1.00e-99 0.0 0.0 4.0 0.0 0.0...Representative annotation iron(III) dicitrate transport system permease protein Number of Sequences 1 Homologs

  18. African and Arab American Achievement Motivation: Effects of Minority Membership.

    Science.gov (United States)

    Kovach, Bernadette S.; Hillman, Stephen B.

    The association between ethnic group identification, attributional style, and the use of self-protective attributions with respect to self-esteem, academic achievement and motivation among ethnically diverse adolescents was examined. Participants in the study included 422 African American, 90 Arab American, and 194 European American high school…

  19. Assessment for markers of nephropathy in newly diagnosed type 2 ...

    African Journals Online (AJOL)

    Published by WB Saunders Company 1976; pg 996. Mogensen CE. Elevated glomerular filtration rate in insulin treated short term diabetes non—dependence opf the actual blood sugar level. ACta Med Scan 1973; 194: 559 —— 561. Rabkin R. Diabetic nephropathy. Clin Cornerstone. 2003:5; 1— 11. Baris GL, Williams M, ...

  20. Social network site use among Dutch students: Effects of time and platform

    NARCIS (Netherlands)

    Utz, S.; Comunello, F.

    2011-01-01

    This chapter compares the SNS use of Dutch students across time and platforms. Between 2009 (n = 194) and 2010 (n = 212), many users migrated from Hyves, the hitherto largest Dutch SNS, to Facebook. Comparisons between the two years showed that SNS use remained relatively stable over time; only