WorldWideScience

Sample records for astatine 194

  1. Organic chemistry of astatine

    International Nuclear Information System (INIS)

    The paper surveys the investigations on the chemical behaviour of astatine in organic systems and deals with the preparation and identification of its organic compounds. A discussion is given on some of the physico-chemical properties of these compounds determined by extrapolation techniques as well as by direct measurement. The biomedical importance of 211At-labelled compounds is briefly referred to. (authors)

  2. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  3. Astatine-211: production and availability.

    Science.gov (United States)

    Zalutsky, Michael R; Pruszynski, Marek

    2011-07-01

    The 7.2-h half life radiohalogen (211)At offers many potential advantages for targeted α-particle therapy; however, its use for this purpose is constrained by its limited availability. Astatine-211 can be produced in reasonable yield from natural bismuth targets via the (209)Bi(α,2n)(211)At nuclear reaction utilizing straightforward methods. There is some debate as to the best incident α-particle energy for maximizing 211At production while minimizing production of (210)At, which is problematic because of its 138.4-day half life α-particle emitting daughter, (210)Po. The intrinsic cost for producing (211)At is reasonably modest and comparable to that of commercially available (123)I. The major impediment to (211)At availability is attributed to the need for a medium energy α-particle beam for its production. On the other hand, there are about 30 cyclotrons in the world that have the beam characteristics required for (211)At production. PMID:22201707

  4. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211At species, 211At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  5. Dosimetrical considerations in astatine-211 radioimmunotherapy

    International Nuclear Information System (INIS)

    Several dosimetrical quantities have been suggested for use in alpha-particle dosimetry. To evaluate the expected biological effect when using these quantities, a Monte Carlo program was set to register the single-event distribution of both specific energy and alpha-particle track length to a cell nucleus (r=5.6 μm). Distributions were acquired for both 'bound' (simulating the effect of 211At-labelled antibodies bound to antigens on cell surfaces (r=7.0 μm)) as well as 'non-bound' (simulating 211At-labelled antibodies that have not bound to a cell) astatine-211. From these distributions, various theoretical cell survival curves were established for 3 different dosimetrical quantities, i.e. specific energy, number of alpha-particle hits and total track length. The survival curves for all quantities are presented for the corresponding mean absorbed dose in order to facilitate comparisons of the expected effects of using the 3 different quantities for both distributions of 211At decays. The theoretical survival curves presented here could, combined with experiments using 'bound' and 'non-bound' 211At in a single-cell suspension, reveal which dosimetrical quantity is most suitable for 211 At-radioimmunotherapy. (author)

  6. Discovery of the astatine, radon, francium, and radium isotopes

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  7. Extraction of astatine isotopes for development of radiopharmaceuticals using a 211Rn-211At generator

    International Nuclear Information System (INIS)

    In order to utilize a 211At isotope, a promising α-emitter for radionuclide therapy, the chemical properties of astatine isotopes are studied. We have examined wet chemistry methods through the distribution ratios of astatine in liquid-liquid extraction. The astatine isotopes have been found to be well extracted into DIPE and MIBK. We observed that the distribution ratio of astatine isotopes increases with concentrations of HCl greater than 3 M, while it decreases with the HCl concentration less than 2 M. The results will be useful for development of the 211Rn-211At generator. (author)

  8. Astatine-211-Labeled Targeted Radiotherapeutics: An Update

    International Nuclear Information System (INIS)

    The heavy halogen 211At was first proposed for use in α-particle targeted radiotherapy more than 30 years ago and continues to be one of the most promising radionuclides for this purpose. Although its 7.2-h half life is not ideal for intravenously administered whole antibodies, it is compatible with the pharmacokinetics of antibody fragments, peptides, aptamers and organic molecules. Its diverse chemistry allows its incorporation into a wide array of targeting vehicles, relying on its chemical similarity to iodine to provide a useful point of departure. On the other hand, the relatively low carbon-astatine bond strength is challenging. In common with the other α-emitters being discussed at this symposium, lack of reliable availability is one of the biggest hurdles in the use of 211At for targeted radiotherapy. However, in the case of 211At, it is not a question of production cost or availability of target material, because 211At can be produced in reasonable yield from natural bismuth targets. Rather, the difficulty is the lack of cyclotrons equipped with the medium energy α-particle beams required for its production. If the infrastructure for producing 211At is to be improved to the stage where 211At-labeled radiopharmaceuticals can have a meaningful impact, several developments must occur. First, the ability to produce clinically relevant levels of 211At that can be shipped to remote locations in chemically tractable form must be demonstrated. Approaches under consideration include compensating for radiolysis-mediated effects and the consideration of alternative chemistries. Second, strategies for compensating for heterogeneities in dose deposition must be developed, hopefully in a way that is compatible with approval for human use. And third, it is essential that more clinical trials be performed with 211At-labeled therapeutics, particularly in settings of minimum residual disease where the radiobiological advantages of α-particles can be best exploited. Our

  9. Scrutinizing "Invisible" astatine: A challenge for modern density functionals.

    Science.gov (United States)

    Sergentu, Dumitru-Claudiu; David, Grégoire; Montavon, Gilles; Maurice, Rémi; Galland, Nicolas

    2016-06-01

    The main-group 6p elements did not receive much attention in the development of recent density functionals. In many cases it is still difficult to choose among the modern ones a relevant functional for various applications. Here, we illustrate the case of astatine species (At, Z = 85) and we report the first, and quite complete, benchmark study on several properties concerning such species. Insights on geometries, transition energies and thermodynamic properties of a set of 19 astatine species, for which reference experimental or theoretical data has been reported, are obtained with relativistic (two-component) density functional theory calculations. An extensive set of widely used functionals is employed. The hybrid meta-generalized gradient approximation (meta-GGA) PW6B95 functional is overall the best choice. It is worth noting that the range-separated HSE06 functional as well as the old and very popular B3LYP and PBE0 hybrid-GGAs appear to perform quite well too. Moreover, we found that astatine chemistry in solution can accurately be predicted using implicit solvent models, provided that specific parameters are used to build At cavities. © 2016 Wiley Periodicals, Inc. PMID:27059181

  10. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  11. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates.

    Science.gov (United States)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Svedhem, Sofia; Lindegren, Sture

    2016-03-16

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single cancer cells. A promising radioactive nuclide for this type of therapy is astatine-211. Astatine-211 attached to tumor-specific antibodies as carrier molecules is a system currently under investigation for use in targeted alpha therapy. In the common radiolabeling procedure, astatine is coupled to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies. PMID:26791409

  12. Alpha decay of At-194

    OpenAIRE

    Andreev, Andrei; Antalic, S; Ackermann, D.; Bianco, L.; Franchoo, S.; S. Heinz; F. P. Hessberger; Hofmann, S.; Huyse, Marc; Kojouharov, I.; Kindler, B.; Lommel, B.; Mann, R.; Nishio, K; R.D.Page

    2009-01-01

    Detailed alpha-decay studies of the neutron-deficient isotope At-194 have been performed in the complete fusion reaction Fe-56+Pr-141 -> At-194+3n at the velocity filter SHIP. Two alpha-decaying isomeric states with half-lives of T-1/2(At-194(m1))=310(8) ms and T-1/2(At-194(m2))=253(10) ms were identified in this nucleus. Their complex decays to the states in the daughter nucleus Bi-190 are discussed in the article. We propose that similar to the case of the neighboring At-191,At-192,At-193,A...

  13. Astatine-211: production, injection into monoclonal antibodies radiological effect, possible application to cancer treatment

    International Nuclear Information System (INIS)

    Methods developed in the Laboratory of Nuclear Problems, JINR, for producing astatine-211 and injecting it into monoclonal antibodies are described. The use of its diethylene triamine penta-acetic acid complex is shown to be the most effective method of injecting astatine into a biomolecules. The biological effect of the α-particles emitted from the astatine-211 is investigated using Chinese hamster fibroblasts and Ehrlich carcinoma cells. It is established that the mitotic activity depression, number of degenerating cells, number of cells with chromosome aberrations, and cellular surviving fraction depend on the concentration of the radionuclide in the medium 'in vitro'. The RBE of α-particles in comparison with 60Co γ-rays is 3. Injection of astatine-211 absorbed on tellurium particles into mice with ascitic tumors resulted in prolongation of their life or elimination of the tumors. (author). 39 refs, 7 figs

  14. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    OpenAIRE

    Rothe, S.; A. N. Andreyev; Antalic, S; Borschevsky, A.; Capponi, L.; Cocolios, T.E.; Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the io...

  15. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    Science.gov (United States)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-07-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and physical properties for use in targeted therapies for cancer. Due to the very short range of the emitted α-particles, this therapy is particularly suited to treating occult, disseminated cancers. Astatine is not intrinsically tumour-specific; therefore, it requires an appropriate tumour-specific targeting vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method that combines dry distillation of astatine-211 and a synthesis module for producing radiopharmaceuticals into a process platform. This platform will standardize production of astatinated radiopharmaceuticals, and hence, it will facilitate large clinical studies focused on this promising, but chemically challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies.

  16. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-01-01

    vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method......To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  17. Study of Astatine (III) reactions with O, S and N ligands in solution

    International Nuclear Information System (INIS)

    Full text of publication follows. Astatine (At, Z=85: [Xe]4f145d106s26p5) belongs to the halogen group and is located below iodine in the periodic table. One of its isotopes (211At) appears promising as a therapeutic agent in nuclear medicine (Ref.1) owing to the energy of the alpha particles emitted during the disintegration of its nucleus and its short physical half-life (7.2 h). Since there are no stable isotopes of astatine, the chemistry of this element remains poorly understood. Generally, At is supposed to behave as a halogen (Ref.2) but it has been shown recently in our group that astatine presents a metallic behaviour in aqueous solution: it notably exists as At+ and AtO+ species under the oxidation states +I and +III (Ref.3). At the present time, the number of studies dealing with the complexation properties of the cationic forms of astatine remains limited (Ref.4), owing to its low availability. In this work, we have investigated the reactions of AtO+ species with different hetero-atomic (N, S, O) model ligands. A combined approach based on experimental and theoretical studies has been used (Ref.5). On account of the difficulties of experimental investigations of astatine species, the reactivity of AtO+ was explored using a competition method founded on astatine distributions between two distinct phases. Furthermore, for each AtO+/ ligand complex, the nature of the species formed and the associated thermodynamic constants were determined by computational modeling (DFT calculations). In this framework, an original computational methodology was developed to take into account the specificities of astatine, notably the associated relativistic effects. The computed equilibrium constants have been confronted with the experimental results. This comparison demonstrates an outstanding coherence between experience and theory. Furthermore, the analysis of the results shows a key role of solvent effects on astatine chemistry. Lastly, a specific reactivity for the

  18. 21 CFR 155.194 - Catsup.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Catsup. 155.194 Section 155.194 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CANNED VEGETABLES Requirements for Specific Standardized Canned Vegetables § 155.194 Catsup....

  19. 42 CFR 460.194 - Corrective action.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Corrective action. 460.194 Section 460.194 Public...) Federal/State Monitoring § 460.194 Corrective action. (a) A PACE organization must take action to correct... corrective actions. (c) Failure to correct deficiencies may result in sanctions or termination, as...

  20. 40 CFR 194.27 - Peer review.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Peer review. 194.27 Section 194.27... CFR PART 191 DISPOSAL REGULATIONS Compliance Certification and Re-certification General Requirements § 194.27 Peer review. (a) Any compliance application shall include documentation of peer review that...

  1. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments (209At, 210At, 211At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  2. Astatine-211 Pathway from Radiochemistry to Clinical Investigation

    International Nuclear Information System (INIS)

    Particularly in clinical settings where tumour burden is low and cancers are located in close proximity to essential normal tissue structures, α-particle emitting radionuclides can offer significant advantages for targeted radionuclide therapy. One of the first alpha emitters to be evaluated for this purpose is the 7.2-h half-life radiohalogen Astatine-211 (211At). From a commercialization-potential perspective 211At, is less appealing than the longer half-life alpha particle emitters Radium-223, Actinium-225 and Thorium-227, which have become the focus of many laboratories. However, if methods for providing a better supply of 211At could be developed, this alpha emitter would be the radionuclide of choice for many potential therapeutic applications. With regard to the production of 211At, this can be readily be accomplished by bombarding natural bismuth targets with 28−29.5 MeV alpha particles via the 209Bi(α,2n)211At reaction. The goal is to utilize an alpha particle beam energy that provides the required balance for maximizing 211At production while minimizing creation of 210At, which is problematic because of its 138.4-day half life alpha-particle emitting daughter, 210Po. For most intended clinical applications, alpha particle beam energy of about 29 MeV offers the best compromise between maximizing yield and providing 211At with sufficient radionuclidic purity for clinical use. Clinically relevant levels of 211At have been produced at several institutions using both internal and external cyclotron targets

  3. Dicty_cDB: SLA194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLA194 (Link to dictyBase) - - - Contig-U16368-1 SLA194Z (Link... to Original site) - - SLA194Z 528 - - - - Show SLA194 Library SL (Link to library) Clone ID SLA194 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLA1-D/SLA194Q.Seq.d/ Representative seq. ID SLA19...4Z (Link to Original site) Representative DNA sequence >SLA194 (SLA194Q) /CSM/SL/SLA1-D/SLA194Q.Seq.d/ XXXXX...CAAGCTCAGAAAGCTCAGAAAGCTCATCAGCCACTTCATAAATAAAACTTTGATC sequence update 1997. 5.16 Translated Amino Acid seq

  4. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  5. 46 CFR 194.15-3 - Responsibility.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Responsibility. 194.15-3 Section 194.15-3 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS HANDLING, USE, AND....15-3 Responsibility. (a) With the knowledge and approval of the master, the senior member of...

  6. 46 CFR 194.20-3 - Responsibility.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Responsibility. 194.20-3 Section 194.20-3 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS HANDLING, USE, AND... Responsibility. (a) With the knowledge and approval of the master the senior member of the scientific...

  7. 40 CFR 194.22 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... COMPLIANCE WITH THE 40 CFR PART 191 DISPOSAL REGULATIONS Compliance Certification and Re-certification General Requirements § 194.22 Quality assurance. (a)(1) As soon as practicable after April 9, 1996, the... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Quality assurance. 194.22 Section...

  8. 49 CFR 194.117 - Training.

    Science.gov (United States)

    2010-10-01

    ... for emergency response operations in 29 CFR 1910.120, including volunteers or casual laborers employed during a response who are subject to those standards pursuant to 40 CFR part 311. ... 49 Transportation 3 2010-10-01 2010-10-01 false Training. 194.117 Section 194.117...

  9. 46 CFR 194.15-19 - Electrical.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Electrical. 194.15-19 Section 194.15-19 Shipping COAST....15-19 Electrical. (a) All electrical equipment located within 18 inches of the deck of the chemical laboratory shall be in accordance with the applicable requirements of Subchapter J (Electrical...

  10. 46 CFR 194.10-25 - Ventilation.

    Science.gov (United States)

    2010-10-01

    ... magazines. (1) All integral magazines shall be provided with natural or mechanical ventilation. Design... temperature below 100 °F. with 88 °F. weather air. Mechanical cooling may be used where ventilation... 46 Shipping 7 2010-10-01 2010-10-01 false Ventilation. 194.10-25 Section 194.10-25 Shipping...

  11. Dicty_cDB: AFM194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFM194 (Link to dictyBase) - - - - AFM194P (Link to Original site) AFM194F 623 AFM...194Z 703 AFM194P 1306 - - Show AFM194 Library AF (Link to library) Clone ID AFM194 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFM...1-D/AFM194Q.Seq.d/ Representative seq. ID AFM194P (Link to... Original site) Representative DNA sequence >AFM194 (AFM194Q) /CSM/AF/AFM1-D/AFM194Q.Seq.d/ ATTTTATAATCACTGT

  12. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  13. Multiparticle excitations in 194Pb

    International Nuclear Information System (INIS)

    High-spin states of 194Pb have been populated by the reaction 184W(16O, 6n) at 113 MeV beam energy and studied using the EUROGAM-1 array. The level scheme has been extended up to spin of 33 ℎ and excitation energy of 11.1 MeV. The high-spin part of the level scheme is dominated by bands of dipole transitions. New dipole bands have been observed and the configurations of their band heads are discussed. Besides the well-known coupling of the Kπ=11- two-proton state to several νi13/2 rotation-aligned neutron states, the Kπ=8+ two-proton state is also involved. Such a coupling is identified for the first time in a lead isotope. Moreover, the Kπ=11- two-proton state is coupled to the rotation-aligned proton pair (πh11/2)2. Thus many multiparticle configurations involving all the high-j subshells located around the proton and neutron Fermi levels, πh11/2, πh9/2, πi13/2, and νi13/2 have been identified in this nucleus

  14. Labelling prospects of astatine-211 with immunoglobulins (IgG): some general considerations

    International Nuclear Information System (INIS)

    The tumour therapeutic potential of the short lived alpha emitting radiohalogen 211At has been already been well recognised in the field of radioimmuno therapy. There is no evidence as such to show that astatine itself is a tumour seeking isotope. Therefore it has to be tagged to tumour seeking compound such as a drug or a protein preferably an antibody (IgG). In this communication, the labelling parameters which are required to be investigated for obtaining a stable product which could be useful as radioimmuno therapeutic agent, are described. (author). 6 refs

  15. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron anity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photodetachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral linewidth of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in o-line tests by the clear observation of the photodetachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148 [1].

  16. Dicty_cDB: CHR194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR194 (Link to dictyBase) - - - Contig-U16433-1 CHR194P (Link to Original site) CHR...194F 144 CHR194Z 570 CHR194P 694 - - Show CHR194 Library CH (Link to library) Clone ID CHR... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHR1-D/CHR194Q.Seq.d/ Representative seq. ID CHR...194P (Link to Original site) Representative DNA sequence >CHR194 (CHR194Q) /CSM/CH/CHR1-D/CHR1...A sequence from clone RP11-475L16 on chromosome 10. 48 0.25 1 CR940353 |CR940353.

  17. Extraction of 211At-astatine from hydrochloric acid solutions by means of TOPO, TBP, and triphenylphosphine

    International Nuclear Information System (INIS)

    The extraction behaviour of astatine was studied under defined conditions from hydrochloride acid solutions (cHCl>0.1 M or 1 and 2M). Therefore other effects like adsorption, reduction or hydrolysis can be excluded. The present work describes the extraction with tri- n- octylphosphinoxide (TOPO), tri- n-butylphosphate (TBP) and tri-phenylphosphine in chloroform. (orig.)

  18. No-carrier-added astatination of N-succinimidyl-3-(tri-n-butylstannyl) benzoate (ATE) via electrophilic destannylation

    International Nuclear Information System (INIS)

    The no-carrier-added synthesis of N-succinimidyl 3-[211At]astato-benzoate from N-succinimidyl 3-(tri-n-butylstannyl)benzoate (ATE) is described. The nature of the solvent in which the 211At was isolated from the target was an important factor influencing both the radiochemical yields and the nature of the incorporated astatine activity. (orig.)

  19. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    211At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At- to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At- anions, but first of all because of the kinetic inertness of low spin rhodium(III) d6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh3+. The experiments related to optimization of the reaction conditions were performed with the 131I, basing on a chemical similarity of I- to At-. The experiments with 211At were then carried out under the conditions found optimal for I-. The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211At-Rh(16-S4-diol) complex

  20. Linear clusters of galaxies - A194

    Science.gov (United States)

    Chapman, G. N. F.; Geller, M. J.; Huchra, J. P.

    1988-01-01

    New measurements for 160 redshifts and previous measurements for 108 other redshifts are presented for galaxies within 5 deg of A194. The galaxy distribution in A194 is shown to be inconsistent with a spherically symmetric King model. A mass-to-light ratio is derived using the virial theorem which is lower than the mean for the groups in the CfA redshift survey (Huchra and Geller, 1982; Geller, 1984). A nonparametric test for galaxy-cluster alignment and a Chi-squared test are used to search for alignment of galaxy major axes with the axis of A194. Evidence for neither luminosity segregation nor significant differences in the velocity or surface distributions of galaxies as a function of morphological type is found.

  1. Rotational bands and chirality in 194Tl

    International Nuclear Information System (INIS)

    The high-spin states in 194Tl were studied using the 181Ta(18O, 5n) reaction and the AFRODITE γ -ray spectrometer at iThemba LABS. The level scheme of 194Tl was considerably extended with several new bands. Three negative-parity 4-quasiparticle bands were observed and associated with πh9/2 x νi13/2-3 configurations. Two of these form a candidate chiral pair with excellent near-degeneracy. In addition two new positive-parity bands were found. (orig.)

  2. 46 CFR 194.15-1 - General.

    Science.gov (United States)

    2010-10-01

    ... EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Chemistry Laboratory and Scientific Laboratory § 194.15-1 General. (a) Chemical and scientific laboratories shall be considered service areas, and as such shall be..., such as desks, file and storage cabinets, waste paper baskets, work benches, chair frames, etc....

  3. 46 CFR 194.15-11 - Flushing systems.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Flushing systems. 194.15-11 Section 194.15-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS HANDLING, USE... § 194.15-11 Flushing systems. (a) Working spaces in which chemical stores are used shall be...

  4. 49 CFR Appendix B to Part 194 - High Volume Areas

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false High Volume Areas B Appendix B to Part 194... Pt. 194, App. B Appendix B to Part 194—High Volume Areas As of January 5, 1993 the following areas are high volume areas: Major rivers Nearest town and state Arkansas River N. Little Rock, AR....

  5. Possible chiral bands in 194Tl

    International Nuclear Information System (INIS)

    High spin states in 194Tl, excited through the 181Ta(18O,5n) fusion evaporation reaction, were studied using the AFRODITE array at iThemba LABS. Candidate chiral bands built on the πh9/2 x νi13/21 configuration were found. Furthermore these bands were observed through a band crossing caused by the excitation of a νi13/2 pair. Above the band crossing the excitation energies remain close, suggesting that chirality may persist for the four quasiparticle configuration too.

  6. Dicty_cDB: CHI194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 58.1 V112D8 mTn-3xHA/lacZ Insertion Library, strain Y2278 Saccharomyces cerevisiae genomic 5', genomic survey se...) Frame A: ksnfi*ii*knk*ynikndiisnylmy*gn*ndlktstrsi*kkyknsnkeiisinwfsd nwyifsictsmvfvtnwmdiygysmlwiilcwvcmw...uolar 4.0 %: nuclear 4.0 %: vesicles of secretory system >> prediction for CHI194 is end 5' end seq. ID CHI194F 5' end se...CTTT TAATGGTTTAGTTTATAATCATTCATTTGCTGCTAGAAATTATTTGGATCTTTATAGAGT TGCTTTATTATCAAANNAATAAAATTAAATCATT Length of 3' end se...q. 754 Connected seq. ID CHI194P Connected seq. >CHI194P.Seq AAATCAAA

  7. Dicty_cDB: CFG194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ces producing significant alignments: (bits) Value N L16578 |L16578.1 Dictyostelium discoideum HIV1 TAT-bindin...CF (Link to library) CFG194 (Link to dictyBase) - - - Contig-U15589-1 CFG194F (Link to Original site...ctyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15589-1 Original site URL http://dict...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFG1-D/CFG194Q.Seq.d/ Representative seq. ID CFG194F (Link to Original site...svifvffffxkx--- Frame C: ff*fliflyiyiniyfyfyffl*fsnitisnynlvliv

  8. Unexpected Behavior of the Heaviest Halogen Astatine in the Nucleophilic Substitution of Aryliodonium Salts.

    Science.gov (United States)

    Guérard, François; Lee, Yong-Sok; Baidoo, Kwamena; Gestin, Jean-François; Brechbiel, Martin W

    2016-08-22

    Aryliodonium salts have become precursors of choice for the synthesis of (18) F-labeled tracers for nuclear imaging. However, little is known on the reactivity of these compounds with heavy halides, that is, radioiodide and astatide, at the radiotracer scale. In the first comparative study of radiohalogenation of aryliodonium salts with (125) I(-) and (211) At(-) , initial experiments on a model compound highlight the higher reactivity of astatide compared to iodide, which could not be anticipated from the trends previously observed within the halogen series. Kinetic studies indicate a significant difference in activation energy (Ea =23.5 and 17.1 kcal mol(-1) with (125) I(-) and (211) At(-) , respectively). Quantum chemical calculations suggest that astatination occurs via the monomeric form of an iodonium complex whereas iodination occurs via a heterodimeric iodonium intermediate. The good to excellent regioselectivity of halogenation and high yields achieved with diversely substituted aryliodonium salts indicate that this class of compounds is a promising alternative to the stannane chemistry currently used for heavy radiohalogen labeling of tracers in nuclear medicine. PMID:27305065

  9. 49 CFR 194.101 - Operators required to submit plans.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Operators required to submit plans. 194.101... PLANS FOR ONSHORE OIL PIPELINES Response Plans § 194.101 Operators required to submit plans. (a) Except... Coordinator (FOSC) to require an operator of a pipeline in paragraph (b) to submit a response plan,...

  10. 28 CFR 19.4 - Cost and percentage estimates.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Cost and percentage estimates. 19.4... RECOVERY OF MISSING CHILDREN § 19.4 Cost and percentage estimates. It is estimated that this program will cost DOJ $78,000 during the initial year. This figure is based on estimates of printing, inserting,...

  11. 46 CFR 194.20-11 - Flushing systems.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Flushing systems. 194.20-11 Section 194.20-11 Shipping... Flushing systems. (a) Provision shall be made for flushing away chemical spills. (b) If a drainage system is installed, it shall be separate from any other drainage system....

  12. 26 CFR 1.194-1 - Amortization of reforestation expenditures.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Amortization of reforestation expenditures. 1....194-1 Amortization of reforestation expenditures. (a) In general. Section 194 allows a taxpayer to elect to amortize over an 84-month period, up to $10,000 of reforestation expenditures (as defined...

  13. 22 CFR 194.1 - Authority and scope of application.

    Science.gov (United States)

    2010-04-01

    ... Section 194.1 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL COMMERCIAL ARBITRATION INTER-AMERICAN COMMERCIAL ARBITRATION COMMISSION RULES OF PROCEDURE § 194.1 Authority and scope of application. In... State has determined that the amended Rules of Procedures of the Inter-American Commercial...

  14. Dicty_cDB: SLJ194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ycdb.biol.tsukuba.ac.jp/CSM/SL/SLJ1-D/SLJ194Q.Seq.d/ Representative seq. ID SLJ19...4Z (Link to Original site) Representative DNA sequence >SLJ194 (SLJ194Q) /CSM/SL/SLJ1-D/SLJ194Q.Seq.d/ XXXXX...hqlstenvs ks**kcft*k****ynnnni*mynki*llff*wllifirp*kkknkt Frame B: ---fstinhen*nhcstrt*ilcldwwiyfsftlnfptnvd...SLI574 (SLI574Q) /CSM/SL/SLI5-D/SLI574Q.Seq.d/ 387 e-107 own update 2002.12.11 Homology vs DNA Score E Sequences pr...18423-1684967 strain AX4, complete sequence. 287 4e-76 3 dna update 2003. 7.15 Homology vs Protein Score E Sequences pr

  15. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  16. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  17. Multiparticle excitations in {sup 194}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Kaci, M. E-mail: kaci@evala4.ific.uv.es; Porquet, M.-G.; Deloncle, I.; Aiche, M.; Azaiez, F.; Bastin, G.; Beausang, C.W.; Bourgeois, C.; Clark, R.M.; Duffait, R.; Duprat, J.; Gall, B.J.P.; Hannachi, F.; Hauschild, K.; Joyce, M.J.; Korichi, A.; Le Coz, Y.; Meyer, M.; Paul, E.S.; Perrin, N.; Poffe, N.; Redon, N.; Schueck, C.; Sergolle, H.; Sharpey-Schafer, J.F.; Simpson, J.; Smith, A.G.; Wadsworth, R

    2002-01-14

    High-spin states of {sup 194}Pb have been populated by the reaction {sup 184}W({sup 16}O, 6n) at 113 MeV beam energy and studied using the EUROGAM-1 array. The level scheme has been extended up to spin of 33 {Dirac_h} and excitation energy of 11.1 MeV. The high-spin part of the level scheme is dominated by bands of dipole transitions. New dipole bands have been observed and the configurations of their band heads are discussed. Besides the well-known coupling of the K{sup {pi}}=11{sup -} two-proton state to several {nu}i{sub 13/2} rotation-aligned neutron states, the K{sup {pi}}=8{sup +} two-proton state is also involved. Such a coupling is identified for the first time in a lead isotope. Moreover, the K{sup {pi}}=11{sup -} two-proton state is coupled to the rotation-aligned proton pair ({pi}h{sub 11/2}){sup 2}. Thus many multiparticle configurations involving all the high-j subshells located around the proton and neutron Fermi levels, {pi}h{sub 11/2}, {pi}h{sub 9/2}, {pi}i{sub 13/2}, and {nu}i{sub 13/2} have been identified in this nucleus.

  18. 41 CFR 102-194.35 - Should I create electronic Standard or Optional forms?

    Science.gov (United States)

    2010-07-01

    ... electronic Standard or Optional forms? 102-194.35 Section 102-194.35 Public Contracts and Property Management... PROGRAMS 194-STANDARD AND OPTIONAL FORMS MANAGEMENT PROGRAM § 102-194.35 Should I create electronic Standard or Optional forms? Yes, you should create electronic Standard or Optional forms, especially...

  19. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  20. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  1. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  2. Population of the yrast superdeformed band in 194Pb

    International Nuclear Information System (INIS)

    The yrast superdeformed (so) band in 194Pb has been populated by means of four fusion-evaporation reactions (184W+16O, 184W+17O, 164Dy+34S, 162Dy+36S) lending to different angular momenta and excitation energies in the various compound nuclei. The yields measured for the so band relative to the total yield of the 194Pb channel do not show any dependence on excitation energies and show only a very weak increase with angular momentum. The feeding pattern of the so band in 194Pb is-compared to similar data for so bands in neighbouring nuclei. All these results can be interpreted by the fission process (an important exit channel for all fusion reactions leading to Pb isotopes) which imposes a very low limit in the angular momentum of the Pb residual nuclei. (author). Letter-to-the-editor

  3. Population of the yrast superdeformed band in {sup 194}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Deloncle, I.; Gall, B.J.P.; Porquet, M.G.; Hannachi, F.; Aiche, M.; Kaci, M.; Schuck, C.; Smith, A.G.; Azaiez, F.; Bourgeois, C.; Duprat, J.; Hojman, D.; Korichi, A.; Sergolle, H.; Perrin, N.; Poffe, N.; Astier, A.; Beraud, R.; Duffait, R.; Le Coz, Y.; Meyer, M.; Redon, N.; Ali, I.; Beausang, C.W.; Dagnall, P.; Joyce, M.J.; Paul, E.S.; Sharpey-Schafer, J.F.; Timmers, H.; Simpson, J.; Clark, R.M.; Hauschild, K.; Wadsworth, R.; Fant, B.; Hubel, H. [CNRS, Orsay (France)

    1995-06-01

    The yrast superdeformed (so) band in {sup 194}Pb has been populated by means of four fusion-evaporation reactions ({sup 184}W+{sup 16}O, {sup 184}W+{sup 17}O, {sup 164}Dy+{sup 34}S, {sup 162}Dy+{sup 36}S) lending to different angular momenta and excitation energies in the various compound nuclei. The yields measured for the so band relative to the total yield of the {sup 194}Pb channel do not show any dependence on excitation energies and show only a very weak increase with angular momentum. The feeding pattern of the so band in {sup 194}Pb is-compared to similar data for so bands in neighbouring nuclei. All these results can be interpreted by the fission process (an important exit channel for all fusion reactions leading to Pb isotopes) which imposes a very low limit in the angular momentum of the Pb residual nuclei. (author). Letter-to-the-editor.

  4. Direct mass measurements of 194Hg and 194Au: A new route to the neutrino mass determination?

    International Nuclear Information System (INIS)

    The study of nuclear electron capture (EC) offers an exciting alternative for the determination of the neutrino mass. Whereas only tritium and 187Re can be used in the case of β-decay experiments involving the anti-neutrino, a potentially large number of EC-nuclides can be used in experiments involving the monochromatic neutrino. This alternative to β-decay experiments requires an accurate measurement of QEC-values of appropriate candidates. In the present work we initiate a search for such a candidate and determined the QEC-value of the electron capture in 194Hg by direct mass measurements of 194Hg and 194Au. The new QEC-value of 29(4) keV determined by the ISOLTRAP Penning-trap mass spectrometer at ISOLDE/CERN forbids the K-capture for 194Hg. However, it allows a determination of the neutrino mass by a combination of a micro-calorimetric measurement of the de-excitation spectrum from L-capture in 194Hg and a comparable QEC-value remeasurement by high-precision Penning trap mass spectrometry.

  5. Direct mass measurements of {sup 194}Hg and {sup 194}Au: A new route to the neutrino mass determination?

    Energy Technology Data Exchange (ETDEWEB)

    Eliseev, S., E-mail: sergey.eliseev@mpi-hd.mpg.d [MPI fuer Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Boehm, Ch. [MPI fuer Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Beck, D. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Planckstrasse 1, 64291 Darmstadt (Germany); Blaum, K. [MPI fuer Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Physikalisches Institut, Ruprecht-Karls-Universitaet, 69120 Heidelberg (Germany); Breitenfeldt, M. [Institut fuer Physik, Ernst-Moritz-Arndt-Universitaet, 17487 Greifswald (Germany); Fedosseev, V.N. [CERN, 1211 Geneva 23 (Switzerland); George, S. [MPI fuer Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Herfurth, F. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Planckstrasse 1, 64291 Darmstadt (Germany); Herlert, A. [CERN, 1211 Geneva 23 (Switzerland); Kluge, H.-J. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Planckstrasse 1, 64291 Darmstadt (Germany); Physikalisches Institut, Ruprecht-Karls-Universitaet, 69120 Heidelberg (Germany); Kowalska, M. [CERN, 1211 Geneva 23 (Switzerland); Lunney, D.; Naimi, S. [CSNSM-IN2P3-CNRS, Universite de Paris Sud, 91406 Orsay (France); Neidherr, D. [Institut fuer Physik, Johannes Gutenberg-Universitaet, 55099 Mainz (Germany); Novikov, Yu.N. [PNPI, Gatchina, 188300 St. Petersburg (Russian Federation); Rosenbusch, M.; Schweikhard, L. [Institut fuer Physik, Ernst-Moritz-Arndt-Universitaet, 17487 Greifswald (Germany); Schwarz, S. [NSCL, Michigan State University, East Lansing, MI 48824-1321 (United States); Seliverstov, M. [Institut fuer Physik, Johannes Gutenberg-Universitaet, 55099 Mainz (Germany); Zuber, K. [Institut fuer Kern- und Teilchenphysik, Technische Universitaet, 01069 Dresden (Germany)

    2010-10-11

    The study of nuclear electron capture (EC) offers an exciting alternative for the determination of the neutrino mass. Whereas only tritium and {sup 187}Re can be used in the case of {beta}-decay experiments involving the anti-neutrino, a potentially large number of EC-nuclides can be used in experiments involving the monochromatic neutrino. This alternative to {beta}-decay experiments requires an accurate measurement of Q{sub EC}-values of appropriate candidates. In the present work we initiate a search for such a candidate and determined the Q{sub EC}-value of the electron capture in {sup 194}Hg by direct mass measurements of {sup 194}Hg and {sup 194}Au. The new Q{sub EC}-value of 29(4) keV determined by the ISOLTRAP Penning-trap mass spectrometer at ISOLDE/CERN forbids the K-capture for {sup 194}Hg. However, it allows a determination of the neutrino mass by a combination of a micro-calorimetric measurement of the de-excitation spectrum from L-capture in {sup 194}Hg and a comparable Q{sub EC}-value remeasurement by high-precision Penning trap mass spectrometry.

  6. Studies of {sup 194,195,197}Po

    Energy Technology Data Exchange (ETDEWEB)

    Carpenter, M.P.; Ahmad, I.; Crowell, B. [and others

    1995-08-01

    The energy systematics of low-lying polonium states show sudden changes near N = 114. The observed drops in the low-lying levels of {sup 196,198}Po relative to the heavier isotopes indicate significant changes in the underlying structure of these nuclei. It is thought that this change is due to the onset of vibrational collectivity brought about by the quadrupole interaction between neutron and proton-pairs. In order to extend the Po systematics even further, we measured, for the first time, states in {sup 194,195,197}Po using the {sup 28}Si + {sup 170}Yb reaction at a beam energy of 142 MeV. The beam was supplied by ATLAS, and the data were taken with 10 Compton-suppressed Ge detectors placed at the target position of the Fragment Mass Analyzer. Preliminary level schemes were constructed for {sup 194,195,197}Po based on {gamma}-{gamma} and {gamma}-FMA coincidences. The results for {sup 194}Po show that the 2{sup +} - 0{sup +} transition energy decreased in energy by 140 keV relative to {sup 196}Po suggesting that this nucleus moved beyond the vibrational limit to more collective motion. An extrapolation of the systematics predicts that the 2{sup +} energy could drop another 140 keV between {sup 194}Po and {sup 192}Po which would indicate the onset of rotational motion. Currently, we have an approved experiment to investigate the decay of yrast isomers in {sup 194}Po which will allow us to (1) confirm our earlier level scheme of {sup 194}Po, and (2) assess the experimental conditions needed for a future study of {sup 192}Po.

  7. Rotational bands and chirality in {sup 194}Tl

    Energy Technology Data Exchange (ETDEWEB)

    Masiteng, P.L. [National Research Foundation, iThemba LABS, P.O. Box 722, Somerset West (South Africa); University of the Western Cape, Bellville (South Africa); University of Johannesburg, P.O. Box 524, Auckland Park (South Africa); Lawrie, E.A.; Lawrie, J.J.; Bark, R.A.; Mullins, S.M.; Murray, S.H.T. [National Research Foundation, iThemba LABS, P.O. Box 722, Somerset West (South Africa); Ramashidzha, T.M.; Maine, P.; Maliage, S.M.; Sharpey-Schafer, J.F.; Shirinda, O.; Vymers, P.A. [National Research Foundation, iThemba LABS, P.O. Box 722, Somerset West (South Africa); University of the Western Cape, Bellville (South Africa); Lindsay, R. [University of the Western Cape, Bellville (South Africa); Komati, F.; Kau, J. [National Research Foundation, iThemba LABS, P.O. Box 722, Somerset West (South Africa); University of North West, Mmabatho (South Africa); Matamba, I. [University of Venda for Science and Technology, Thohoyandou (South Africa); Mutshena, K.P. [National Research Foundation, iThemba LABS, P.O. Box 722, Somerset West (South Africa); University of Venda for Science and Technology, Thohoyandou (South Africa); Pasternak, A.A. [A.F. Ioffe Physical-Technical Institute, St.-Petersburg (Russian Federation); Roux, D.G. [University of the Western Cape, Bellville (South Africa); Rhodes University, P.O. Box 94, Grahamstown (South Africa)

    2014-07-15

    The high-spin states in {sup 194}Tl were studied using the {sup 181}Ta({sup 18}O, 5n) reaction and the AFRODITE γ -ray spectrometer at iThemba LABS. The level scheme of {sup 194}Tl was considerably extended with several new bands. Three negative-parity 4-quasiparticle bands were observed and associated with πh{sub 9/2} x νi{sub 13/2}{sup -3} configurations. Two of these form a candidate chiral pair with excellent near-degeneracy. In addition two new positive-parity bands were found. (orig.)

  8. High spin band structures in doubly-odd $^{194}$Tl

    CERN Document Server

    Pai, H; Bhattacharyya, S; Gohil, M R; Bhattacharjee, T; Bhattacharya, C; Palit, R; Saha, S; Sethi, J; Trivedi, T; Thakur, Shital; Naidu, B S; Jadav, S K; Donthi, R; Goswami, A; Chanda, S

    2012-01-01

    The high-spin states in odd-odd $^{194}$Tl nucleus have been studied by populating them using the $^{185,187}$Re($^{13}$C, xn) reactions at 75 MeV of beam energy. $\\gamma-\\gamma$ coincidence measurement has been performed using the INGA array with a digital data acquisition system to record the time stamped data. Definite spin-parity assignment of the levels was made from the DCO ratio and the IPDCO ratio measurements. The level scheme of $^{194}$Tl has been extended up to 4.1 MeV in excitation energy including 19 new gamma ray transitions. The $\\pi h_{9/2} \\otimes \

  9. 27 CFR 41.194 - Articles of partnership or association.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Articles of partnership or... AND TUBES, AND PROCESSED TOBACCO Tobacco Products Importers § 41.194 Articles of partnership or..., must furnish with its application for permit required by § 41.191 a true copy of the articles...

  10. 29 CFR 19.4 - Contents of request.

    Science.gov (United States)

    2010-07-01

    ... Secretary of Labor RIGHT TO FINANCIAL PRIVACY ACT § 19.4 Contents of request. The formal written request... of the customer or customers to whom the records pertain; (b) A reasonable description of the records... cases where customer notice is delayed by a court order, a copy of the court order shall be attached...

  11. 40 CFR 194.46 - Removal of waste.

    Science.gov (United States)

    2010-07-01

    ... PROGRAMS CRITERIA FOR THE CERTIFICATION AND RE-CERTIFICATION OF THE WASTE ISOLATION PILOT PLANT'S COMPLIANCE WITH THE 40 CFR PART 191 DISPOSAL REGULATIONS Compliance Certification and Re-certification... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Removal of waste. 194.46 Section...

  12. 26 CFR 1.194-4 - Time and manner of making election.

    Science.gov (United States)

    2010-04-01

    ... section, an election to amortize reforestation expenditures under section 194 shall be made by entering... for which reforestation expenditures are being amortized under section 194. The election may only be... election to amortize reforestation expenditures under section 194 may be made by a statement on,...

  13. Stability and in vivo behavior of Rh[16aneS4-diol]211At complex: A potential precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Introduction: The heavy halogen 211At is of great interest for targeted radiotherapy because it decays by the emission of short-range, high-energy α-particles. However, many astatine compounds that have been synthesized are unstable in vivo, providing motivation for seeking other 211At labeling strategies. One relatively unexplored approach is to utilize prosthetic groups based on astatinated rhodium (III) complex stabilized with a tetrathioether macrocyclic ligand – Rh[16aneS4-diol]211At. The purpose of the current study was to evaluate the in vitro and in vivo stability of this complex in comparison to its iodine analog – Rh[16aneS4-diol]131I. Methods: Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I complexes were synthesized and purified by HPLC. The stability of both complexes was evaluated in vitro by incubation in phosphate-buffered saline (PBS) and human serum at different temperatures. The in vivo behavior of the two radiohalogenated complexes was assessed by a paired-label biodistribution study in normal Balb/c mice. Results: Both complexes were synthesized in high yield and purity. Almost no degradation was observed for Rh[16aneS4-diol]131I in PBS over a 72 h incubation. The astatinated analog exhibited good stability in PBS over 14 h. A slow decline in the percentage of intact complex was observed for both tracers in human serum. In the biodistribution study, retention of 211At in most tissues was higher than that of 131I at all time points, especially in spleen and lungs. Renal clearance of Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I predominated, with 84.1 ± 2.3% and 94.6 ± 0.9% of injected dose excreted via the urine at 4 h. Conclusions: The Rh[16aneS4-diol]211At complex might be useful for constructing prosthetic groups for the astatination of biomolecules and further studies are planned to evaluate this possibility

  14. New features of superdeformed bands in 194Hg

    International Nuclear Information System (INIS)

    A striking difference between superdeformed (SD) nuclei near A = 190 and those in the other regions is the behavior of the dynamic moment of inertia (lm) with the rotational frequency hω. While the (lm) patterns of the SD bands near A = 130 and A = 150 show pronounced variations, the majority of the SD bands near A = 190 display the same large, smooth increase of (lm) within the frequency range 0.15 194Hg were populated with the reaction 150Nd(48Ca,4n) 194Hg at a beam energy of 206 MeV. The gamma rays emitted in the reaction were detected with the Gammasphere detector array (32 detectors for this experiment)

  15. Study of the superdeformed band in 194Pb with EUROGAM

    International Nuclear Information System (INIS)

    An experiment has been carried out using a subset of the EUROGAM array to investigate the decay out of the superdeformed (SD) band in 194Pb. Two new band members and a new decay pattern into the low lying states at normal deformation (ND) have been established for this band. New spectroscopic information about the level scheme at normal deformation has also been extracted. (author). 9 refs., 1 tab., 4 figs

  16. Decay from the superdeformed bands in {sup 194}Hg

    Energy Technology Data Exchange (ETDEWEB)

    Henry, R.G.; Khoo, T.L.; Carpenter, M.P. [and others

    1995-08-01

    Superdeformed bands in {sup 194}H g were studied using the early implementation of Gammasphere. The response functions for the Ge detectors were measured for the first time as part of this experiment. Experiments were performed with both a backed target (where the residue stopped in the Au backing) and a thin target (where the residue recoiled into vacuum). This will permit measurements of the decay times of the quasicontinuum {gamma}rays. The spectrum in coincidence with the yrast SD band in {sup 194}Hg reveals the same features as found in the quasicontinuum structure in {sup 192}Hg. These features include: statistical {gamma}rays feeding the SD band, a pronounced E2 peak from transitions feeding the SD band, a Ml/E2 bump at low energies that is associated with the last stages of feeding of the superdeformed band, and a quasicontinuous distribution from {gamma}rays linking SD and normal states, including a sizable clustering of strength around 1.7 MeV. The remarkable similarity of the spectra coincident with SD bands in {sup 192,194}Hg provides additional support for a statistical process for decay out of the SD states. This similarity contrasts with differences observed in the spectrum coincident with the SD band in the odd-even {sup 191}Hg, confirming the predictions about the role of pairing (in normal states) in influencing the shape of the decay-out spectrum.

  17. MicroRNA-194 promotes osteoblast differentiation via downregulating STAT1

    Energy Technology Data Exchange (ETDEWEB)

    Li, Jun [Department of Emergency, Shannxi Province People' s Hospital, Third Affiliated Hospital of Xi' an Jiaotong University, Xi' an 710052 (China); He, Xijing [Department of Orthopaedics, Second Affiliated Hospital of Xi' an Jiaotong University, Xi' an 710004 (China); Wei, Wenzhi [Department of Emergency, Shannxi Province People' s Hospital, Third Affiliated Hospital of Xi' an Jiaotong University, Xi' an 710052 (China); Zhou, Xiaobo, E-mail: xiaobozhouxa@163.com [Department of Immunology and Pathogenic Biology, Medical School, Xi' an Jiaotong University, Xi' an 710061 (China)

    2015-05-01

    Osteoblast differentiation is a vital process in maintaining bone homeostasis in which various transcriptional factors, signaling molecules, and microRNAs (miRNAs) are involved. Recently, signal transducer and activator of transcription 1 (STAT1) has been found to play an important role in regulating osteoblast differentiation. Here, we identified that STAT1 expression was regulated by miR-194. Using mouse bone mesenchymal stem cells (BMSCs), we found that miR-194 expression was significantly increased following osteoblast differentiation induction. Overexpression of miR-194 by lentivirus-mediated gene transfer markedly increased osteoblast differentiation, whereas inhibition of miR-194 significantly suppressed osteoblast differentiation of BMSCs. Using a dual-luciferase reporter assay, a direct interaction between miR-194 and the 3′-untranslated region (UTR) of STAT1 was confirmed. Additionally, miR-194 regulated mRNA and protein expression of STAT1 in BMSCs. Further analysis showed that miR-194 overexpression promoted the nuclear translocation of runt-related transcription factor 2 (Runx2), which is critical for osteoblast differentiation. In contrast, inhibition of miR-194 blocked the nuclear translocation of Runx2. Moreover, overexpression of STAT1 significantly blocked Runx2 nuclear translocation and osteoblast differentiation mediated by miR-194 overexpression. Taken together, our data suggest that miR-194 regulates osteoblast differentiation through modulating STAT1-mediated Runx2 nuclear translocation. - Highlights: • Overexpression of miR-194 significantly increased osteoblast differentiation. • miR-194 directly targeted the 3′- UTR of STAT1. • miR-194 regulated the expression of STAT1. • Overexpression of miR-194 promoted the nuclear translocation of Runx2.

  18. Dicty_cDB: SLE194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available E Sequences producing significant alignments: (bits) Value N ( AU034692 ) Dictyostelium discoideum slug cDNA..., clone SLE194. 268 2e-91 2 ( AU033787 ) Dictyostelium discoideum slug cDNA, clon...e SLB438. 260 1e-86 2 ( AU040025 ) Dictyostelium discoideum slug cDNA, clone SLH472. 260 1e-86 2 ( AU033785 ...) Dictyostelium discoideum slug cDNA, clone SLB436. 260 1e-86 2 ( AU033617 ) Dictyostelium discoideum slug c...DNA, clone SLB234. 260 1e-86 2 ( AU039989 ) Dictyostelium discoideum slug cDNA, clone SLH386. 260 1e-86 2 (

  19. DSAM lifetime measurements for the chiral pair in 194Tl

    International Nuclear Information System (INIS)

    Most important for the identification of chiral symmetry in atomic nuclei is to establish a pair of bands that are near-degenerate in energy, but also in B(M1) and B(E2) transition probabilities. Dedicated lifetime measurements were performed for four bands of 194Tl, including the pair of four-quasiparticle chiral bands with close near-degeneracy, considered as a prime candidate for best chiral symmetry pair. The lifetime measurements confirm the excellent near-degeneracy in this pair and indicate that a third band may be involved in the chiral symmetry scenario. (orig.)

  20. Production of tungsten-188 and osmium-194 in a nuclear reactor for new clinical generators

    International Nuclear Information System (INIS)

    Rhenium-188 and iridium-194 are potential candidates for radioimmunotherapy with monoclonal antibodies directed against tumor-associated antigens. Both nuclei are short-lived and decay by high energy β- emission. In addition, both nuclei emit γ-rays with energy suitable for imaging. An important characteristic is availability of 188Re and 194Ir from decay of reactor-produced parents (188W and 194Os, respectively) in covenient generator systems. The 188W and 194Os are produced by double neutron capture of 186W and 192Os, respectively. The large scale production yields of 188W in several nuclear reactors will be presented. We also report a new measurement for the cross-section of 193Os(n, γ)194Os reaction and discuss the feasibility of producing sufficient quantities of 194Os. (orig.)

  1. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D., Scott

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  2. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    International Nuclear Information System (INIS)

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET α-emitter astatine-211 (211At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 (123I), 340-fold for technetium-99m pertechnetate (99mTcO4-) and 60-fold for 211At. Cellular 211At accumulation was found to be dependent on extracellular Na+ ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and 99mTcO4- uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated 211At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and 211At were rapidly (apparent t1/2 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times (123I), 25 times (99mTcO4-) and 10 times (211At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of 123I and 211At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for 123I, 5.2 h for 211At) and preliminary dosimetric calculations indicate high tumour absorbed doses (3.5 Gy/MBqtumour for 131I and 50.3 Gy/MBqtumour for 211At). In

  3. MicroRNA-194 is a Marker for Good Prognosis in Clear Cell Renal Cell Carcinoma.

    Science.gov (United States)

    Nofech-Mozes, Roy; Khella, Heba W Z; Scorilas, Andreas; Youssef, Leza; Krylov, Sergey N; Lianidou, Evi; Sidiropoulos, Konstantinos G; Gabril, Manal; Evans, Andrew; Yousef, George M

    2016-04-01

    Clear cell renal cell carcinoma (ccRCC) is the most prevalent adult kidney cancer. Prognostic markers are needed to guide patient management toward aggressive versus more conservative approaches, especially for small tumors ≤4 cm. miR-194 was reported to be downregulated in several cancers and is involved in epithelial to mesenchymal transition. We evaluated miR-194 as a prognostic marker in ccRCC. In a cohort of 234 patients with primary ccRCC, we correlated miR-194 expression level with multiple clinicopathological features including disease-free and overall survival, tumor size, clinical stage, and histological grade. Our results shows a stepwise decrease in miR-194 expression from normal kidney to primary ccRCC (P = 0.0032) and a subsequent decrease from primary to metastatic lesions. Additionally, patients with higher miR-194 expression has significantly longer disease-free survival (P = 0.041) and overall survival (P = 0.031) compared to those with lower expression. In multivariate analysis, miR-194-positive tumors retain significance in disease-free survival and overall survival, suggesting miR-194 is an independent marker for good prognosis in ccRCC. Moreover, miR-194 is a marker for good prognosis for patients with small renal masses (P = 0.014). These findings were validated on an independent data set from The Cancer Genome Atlas. We also compared miR-194 expression between RCC subtypes. ccRCC had the highest levels, whereas chromophobe RCC and oncocytoma had comparable lower levels. Target prediction coupled with pathway analysis show that miR-194 is predicted to target key molecules and pathways involved in RCC progression. miR-194 represents a prognostic biomarker in ccRCC. PMID:26860079

  4. Dicty_cDB: VSJ194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VSJ194 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12017-1 Original site URL http://dictycdb.bio.../SSJ749Q.Seq.d/ 686 0.0 own update 2001.11.13 Homology vs DNA Score E Sequences producing significant alignments: (bi...ts) Value N AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 m..._L4_25G06 5' similar to Y48B6A.2 CE22117 locus:rpl-43 status:Confirmed TR:Q9U2A8, mRNA sequence. 44 1.7 1 BM..... 32 6.8 S38381_1( S38381 |pid:none) AMY=alpha-amylase [Schwanniomyces occi... 3

  5. 33 CFR 110.194a - Mobile Bay, Ala., and Mississippi Sound, Miss.

    Science.gov (United States)

    2010-07-01

    ... Sound, Miss. 110.194a Section 110.194a Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Mississippi Sound, Miss. (a) The anchorage grounds. (1) The waters of lower Mobile Bay, near Cedar Point... south by latitude 30°20′00″, and on the west by longitude 88°06′00″. (2) The waters of Mississippi...

  6. 41 CFR 102-194.20 - What is an electronic Standard or Optional form?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is an electronic... 194-STANDARD AND OPTIONAL FORMS MANAGEMENT PROGRAM § 102-194.20 What is an electronic Standard or Optional form? An electronic Standard or Optional form is an officially prescribed set of data residing...

  7. 34 CFR Appendix B to Part 403 - Examples for 34 CFR 403.194-Comparability Requirements

    Science.gov (United States)

    2010-07-01

    ... TECHNOLOGY EDUCATION PROGRAM Pt. 403, App. B Appendix B to Part 403—Examples for 34 CFR 403.194—Comparability... 34 Education 3 2010-07-01 2010-07-01 false Examples for 34 CFR 403.194-Comparability Requirements B Appendix B to Part 403 Education Regulations of the Offices of the Department of...

  8. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    Energy Technology Data Exchange (ETDEWEB)

    Petrich, T.; Helmeke, H.-J.; Meyer, G.J.; Knapp, W.H.; Poetter, E. [Department of Nuclear Medicine, Medizinische Hochschule Hannover (Germany)

    2002-07-01

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET {alpha}-emitter astatine-211 ({sup 211}At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 ({sup 123}I), 340-fold for technetium-99m pertechnetate ({sup 99m}TcO{sub 4}{sup -}) and 60-fold for {sup 211}At. Cellular {sup 211}At accumulation was found to be dependent on extracellular Na{sup +} ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and {sup 99m}TcO{sub 4}{sup -} uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated {sup 211}At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and {sup 211}At were rapidly (apparent t{sub 1/2} 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times ({sup 123}I), 25 times ({sup 99m}TcO{sub 4}{sup -}) and 10 times ({sup 211}At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of {sup 123}I and {sup 211}At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for {sup 123}I, 5.2 h for {sup 211}At) and

  9. INTEGRAL Observations of MAXI J1836-194

    DEFF Research Database (Denmark)

    Del Santo, M.; Kuulkers, E.; Rodriguez, J.;

    2011-01-01

    ATEL #3626. Our findings are consistent with the nature of black-hole candidate proposed for this source, definitely strengthened by the last radio (ATEL #3628) and optical (ATEL #3640) observations. Follow-up observations at multi-wavelengths are strongly encouraged. Further INTEGRAL observations are...... on 2011-09-18 since 03:11:34.0 until 14:48:56.0. MAXI 1836-194 was detected by IBIS/ISGRI at a significance level of 32 sigma and 19 sigma in the 20-40 keV and 40-80 keV bands, respectively (~23 ks effective exposure time). The corresponding fluxes are roughly 48 mCrab and 44 mCrab, respectively. The...... source was also clearly detected by JEM-X at 23 sigma level in the 3-10 keV energy band with a flux of about 38 mCrab (~5 ks effective exposure time). The simultaneous IBIS/ISGRI+JEM-X 4-300 keV spectrum can be well described (chi2_red/d.o.f=1.0/18) by a power-law model with photon index 2...

  10. Properties of superdeformed bands in the A = 194 region

    International Nuclear Information System (INIS)

    At least eighteen superdeformed (SD) bands have been identified in mercury, thallium, and lead nuclei since the report of a SD band in 191Hg. Systematic information is beginning to emerge on the properties of the SD bands in this mass region, and comparisons with SD bands in the A = 150 region are now possible. Recently, data were obtained with the HERA spectrometer at the Lawrence Berkeley Laboratory 88'' Cyclotron on SD bands in 194Pb and 196Pb. In these experiments, we bombarded 176Yb with 24Mg and 26Mg. The cross bombardment was necessary to make the assignment of the band to 196Pb certain. These bands are typical of other SD bands in the region in many ways. The gamma rays have energies that range from about 200 to 800 keV. The gamma-ray spacing decreases from about 40 to 30 keV as the transition energy increases. Their intensities gradually increase as the gamma-ray energies decrease over the upper half of of the sequence, and then sustain a constant value until the one or two lowest energy transitions. 18 refs., 4 figs

  11. miR-194 targets RBX1 gene to modulate proliferation and migration of gastric cancer cells.

    Science.gov (United States)

    Chen, Xiaonan; Wang, Yuanyuan; Zang, Wenqiao; Du, Yuwen; Li, Min; Zhao, Guoqiang

    2015-04-01

    RING box protein1 (RBX1), an essential component of SCF E3 ubiquitin ligases, plays an important role in gastric cancer. In the study, miR-194 and RBX1 expression was evaluated in 76 pairs of gastric tumor and non-tumor tissue samples by qRT-PCR, and clinicopathological characteristics were analyzed. CCK8, transwell assay, wound healing assay, and flow cytometry assay were performed to evaluate the effect of miR-194 on gastric cancer (GC) cellular proliferation, invasion, migration, apoptosis, and cell cycle, respectively. Luciferase reporter assays and Western blotting were used to evaluate whether RBX1 is a direct target of miR-194. The Kaplan-Meier method and log-rank test were used to evaluate the correlation between miR-194 or RBX1 expression and patient survival. Then, we found that miR-194 was significantly downregulated and RBX1 upregulated in GC tissues; both of which showed significant association with tumor size, location, invasion, and tumor node metastasis. Cell proliferation, invasion, and migration were significantly restricted with miR-194 overexpression. miR-194 downregulated RBX1 protein expression, and luciferase assays showed that binding sites in the RBX1 3'UTR were required for miR-194-mediated repression of RBX1, indicating that RBX1 was a direct target of miR-194. Transfection of RBX1 without the 3'UTR restored the miR-194-inhibiting migration function. miR-194 overexpression or RBX1 lowexpression was associated with prolonged survival of GC patients. In conclusion, upregulation of miR-194 can inhibit proliferation, migration, and invasion of GC cells, possibly by targeting RBX1. Aberrant expression of miR-194 and RBX1 is correlated to GC patient survival time. PMID:25412959

  12. Removal of Acid Black 194 dye from water by electrocoagulation with aluminum anode.

    Science.gov (United States)

    Vidal, Jorge; Villegas, Loreto; Peralta-Hernández, Juan M; Salazar González, Ricardo

    2016-01-01

    Application of an electrocoagulation process (EC) for the elimination of AB194 textile dye from synthetic and textile wastewater (effluent) contaminated with AB194 dye, was carried out using aluminum anodes at two different initial pH values. Tafel studies in the presence and absence of the dye were performed. The aluminum species formed during the electrolysis were quantified by atomic absorption, and the flocs formed in the process were analyzed by HPLC-MS. Complete removal of AB194 from 1.0 L of solution was achieved applying low densities current at initial pH values of 4.0 and 8.0. The removal of AB194 by EC was possible with a short electrolysis time, removing practically 100% of the total organic carbon content and chemical oxygen demand. The final result was completely discolored water lacking dye and organic matter. An effluent contaminated with 126 mg L(-1) AB194 dye from a Chilean textile industry was also treated by EC under optimized experimental conditions, yielding discolored water and considerably decreasing the presence of organic compounds (dye + dyeing additives), with very low concentrations of dissolved Al(3+). Analysis of flocs showed the presence of the original dye without changes in its chemical structure. PMID:26745322

  13. RDDS lifetime measurements of low-lying superdeformed states in {sup 194}Hg

    Energy Technology Data Exchange (ETDEWEB)

    Kuehn, R.; Dewald, A.; Kruecken, R. [Universitaet Koeln (Germany)] [and others

    1996-12-31

    The lifetimes of three low-lying states in the superdeformed (SD) yrast band of {sup 194}Hg were measured by the recoil-distance Doppler-shift method. The deduced transition quadrupole moments, Q{sub t}, equal those extracted from a DSAM measurement for the high-lying states of the band corroborate the assumption that the decay out of SD bands does not strongly affect the structure of the corresponding states. By a simple mixing-model the decay can be described assuming a very small admixture of normal-deformed (ND) states to the decaying SD states. The deduced ND mixing amplitudes for the yrast SD bands in {sup 192,194}Hg and {sup 194}Pb are presented along with average transition quadrupole moments for the lower parts of the excited SD bands.

  14. A new route for neutrino mass determination using the electron capture of {sup 194}Hg

    Energy Technology Data Exchange (ETDEWEB)

    Beck, Dietrich; Herfurth, Frank [GSI, Darmstadt (Germany); Blaum, Klaus; Boehm, Christine [MPI fuer Kernphysik, Heidelberg (Germany); Ruprecht-Karls-Universitaet, Heidelberg (Germany); Breitenfeldt, Martin; Schweikhard, Lutz [Ernst-Moritz-Arndt-Universitaet, Greifswald (Germany); Eliseev, Sergey; George, Sebastian [MPI fuer Kernphysik, Heidelberg (Germany); Fedosseev, Valentin; Herlert, Alexander; Kowalska, Magdalena; Seliverstov, Maxim [CERN, Geneve (Switzerland); Lunney, David; Naimi, Sarah [Universite de Paris Sud, Orsay (France); Neidherr, Dennis [Johannes Gutenberg-Universitaet, Mainz (Germany); Novikov, Yuri [PNPI, Gatchina, St. Petersburg (Russian Federation); Schwarz, Stefan [NSCL, MSU, East Lansing, Michigan (United States); Zuber, Kai [Technische Universitaet, Dresden (Germany)

    2010-07-01

    The electron neutrino mass is of highest importance for many fields of physics. To measure the neutrino mass, beta-decay spectra are typically used. Here an alternative way to determine the neutrino mass, using an electron capture in {sup 194}Hg will be presented. Direct mass measurements of {sup 194}Hg and its daughter nucleus {sup 194}Au were performed at the high-precision Penning trap mass spectrometer ISOLTRAP at the ISOLDE facility (CERN). The Q{sub EC}-value obtained by the mass difference of these nuclei leads to the conclusion that the K-capture is forbidden, thus an L-capture is assumed. For further investigations a measurement using a cryogenic micro-calorimeter is suggested. From this, a de-excitation spectrum is obtained which can be compared to the Q{sub EC}-value in order to determine the neutrino mass.

  15. To construct the eukaryotic expression plasmid PIRESneo3/miR-194 and establish a miR-194 highly expressed MCF-7 cell%真核表达质粒PIRESneo3/miR-194的构建及其在乳腺癌细胞MCF-7中的表达

    Institute of Scientific and Technical Information of China (English)

    李佳; 王本忠

    2012-01-01

    目的 构建含miR-194基因的真核表达质粒,建立miR-194稳定表达的MCF-7乳腺癌细胞株.方法 设计合成miR-194引物序列,PCR法从乳腺癌231细胞中扩增出目的片段,经双酶切后定向连入PIRESneo3载体,构建PIRESneo3/miR-194真核表达质粒,经酶切、测序检测其构建的正确性.脂质体法将重组质粒转入MCF-7细胞,G418药物筛选出稳定转染的细胞,实时荧光定量PCR法检测稳定转染MCF-7细胞中miR-194基因的表达水平.结果 构建的PIRESneo3/miR-194质粒经酶切、测序等检验表明质粒构建成功,筛选获得稳定高表达miR-194的MCF-7乳腺癌细胞株.结论 成功构建了PIRESneo3/miR-194真核表达质粒以及稳定高表达miR-194的MCF-7细胞株.为进一步观察该基因对乳腺癌细胞的体外效应和以miR-194为靶点的乳腺癌基因治疗研究提供实验基础.%Objective To construct the eukaryotic expression plasmid containing miR-194 genes and establish breast cancer cell lines( MCF-7 ) with stabilized expression of miR-194. Methods MiR-194 primers were designed and miR-194 gene was amplified from cDNA of 231 breast cancer cells by reverse transcription polymerase chain re-action ( PCR ). The miR-194 gene was cloned into PIRESneo3 vector directionally after enzyme cut thus constructing the eukaryotic expression plasmid of PIRESneo3/miR-194. Then the recombinant PIRESneo3/miR-194 plasmid was transfected into the MCF-7 cell line by Lipofectamine, and miR-194 highly expressed cells was selected by G418 ( 600 μg/ml ). The expression level of miR-194 was detected by real-time quantitative PCR. Results The recombinant PIRESneo3/miR-194 plasmid was constructed, and the MCF-7 cell line with highly miR-194 gene was screened. Conclusion miR-194 highly expressed MCF-7 cell line is established sucessfully, which will be a perfect target of miR-194 gene therapy and for observing its function in breast cancer cells.

  16. Analysis of the generator coordinate method in a study of shape isomerism in 194Hg

    International Nuclear Information System (INIS)

    We investigate the properties of the Generator Coordinate Method (GCM) on a collective basis of BCS states. The method is applied to a study of large amplitude quadrupole dynamics in the nucleus 194Hg. Among the GCM levels, we discuss candidates for a possible shape isomerism associated with a secondary deformed minimum at large deformation (Q ∼ 45b). We also analyze standard approximation schemes based on the gaussian overlap approximation which lead to a collective Schrodinger equation. We compare their predictions with the exact GCM results for the particular case of 194Hg

  17. Durable donor engraftment after radioimmunotherapy using α-emitter astatine-211-labeled anti-CD45 antibody for conditioning in allogeneic hematopoietic cell transplantation.

    Science.gov (United States)

    Chen, Yun; Kornblit, Brian; Hamlin, Donald K; Sale, George E; Santos, Erlinda B; Wilbur, D Scott; Storer, Barry E; Storb, Rainer; Sandmaier, Brenda M

    2012-02-01

    To reduce toxicity associated with external γ-beam radiation, we investigated radioimmunotherapy with an anti-CD45 mAb labeled with the α-emitter, astatine-211 ((211)At), as a conditioning regimen in dog leukocyte antigen-identical hematopoietic cell transplantation (HCT). Dose-finding studies in 6 dogs treated with 100 to 618 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) without HCT rescue demonstrated dose-dependent myelosuppression with subsequent autologous recovery, and transient liver toxicity in dogs treated with (211)At doses less than or equal to 405 μCi/kg. Higher doses of (211)At induced clinical liver failure. Subsequently, 8 dogs were conditioned with 155 to 625 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) before HCT with dog leukocyte antigen-identical bone marrow followed by a short course of cyclosporine and mycophenolate mofetil immunosuppression. Neutropenia (1-146 cells/μL), lymphopenia (0-270 cells/μL), and thrombocytopenia (1500-6560 platelets/μL) with prompt recovery was observed. Seven dogs had long-term donor mononuclear cell chimerism (19%-58%), whereas 1 dog treated with the lowest (211)At dose (155 μCi/kg) had low donor mononuclear cell chimerism (5%). At the end of follow-up (18-53 weeks), only transient liver toxicity and no renal toxicity had been observed. In conclusion, conditioning with (211)At-labeled anti-CD45 mAb is safe and efficacious and provides a platform for future clinical trials of nonmyeloablative transplantation with radioimmunotherapy-based conditioning. PMID:22134165

  18. 41 CFR 102-194.40 - For what Standard or Optional forms should an electronic version not be made available?

    Science.gov (United States)

    2010-07-01

    ... Optional forms should an electronic version not be made available? 102-194.40 Section 102-194.40 Public... For what Standard or Optional forms should an electronic version not be made available? All forms should include an electronic version unless it is not practicable to do so. Areas where it may not...

  19. Fission fragment angular distribution measurements in 18O+194Pt reaction

    International Nuclear Information System (INIS)

    Fission fragment angular distributions were measured for 18O + 194Pt in energy range 78.2 - 87.3 MeV. The normal nature of angular anisotropy suggests that the reaction proceeded through true CN formation. The present results are consistent with result obtained from fission fragment mass distribution measurements carried out for reaction using other isotopes of platinum

  20. 46 CFR 194.05-19 - Combustible liquids as chemical stores-Detail requirements.

    Science.gov (United States)

    2010-10-01

    ... combustible liquids shall be regulated by the appropriate portions of 49 CFR parts 172, 173, and 176 or part... 46 Shipping 7 2010-10-01 2010-10-01 false Combustible liquids as chemical stores-Detail... and Marking § 194.05-19 Combustible liquids as chemical stores—Detail requirements. (a)...

  1. 46 CFR 194.05-9 - Flammable liquid chemical stores-Detail requirements.

    Science.gov (United States)

    2010-10-01

    ... regulated by the appropriate portions of 49 CFR parts 172, 173, and 176 or part 147 of Subchapter N... 46 Shipping 7 2010-10-01 2010-10-01 false Flammable liquid chemical stores-Detail requirements... and Marking § 194.05-9 Flammable liquid chemical stores—Detail requirements. (a) Flammable liquids...

  2. 46 CFR 194.05-15 - Compressed gases as chemical stores-Detail requirements.

    Science.gov (United States)

    2010-10-01

    ... gases are regulated in accordance with the appropriate portions of 49 CFR parts 172, 173, and 176 or... 46 Shipping 7 2010-10-01 2010-10-01 false Compressed gases as chemical stores-Detail requirements... and Marking § 194.05-15 Compressed gases as chemical stores—Detail requirements. (a) Compressed...

  3. 46 CFR 194.05-11 - Flammable solids and oxidizing materials-Detail requirements.

    Science.gov (United States)

    2010-10-01

    ... 49 CFR parts 172, 173, and 176. ... 46 Shipping 7 2010-10-01 2010-10-01 false Flammable solids and oxidizing materials-Detail... and Marking § 194.05-11 Flammable solids and oxidizing materials—Detail requirements. (a)...

  4. 46 CFR 194.05-17 - Poisonous articles as chemical stores-Detail requirements.

    Science.gov (United States)

    2010-10-01

    ... poisonous articles shall be regulated by the appropriate portions of 49 CFR parts 172, 173, and 176 or part... 46 Shipping 7 2010-10-01 2010-10-01 false Poisonous articles as chemical stores-Detail... and Marking § 194.05-17 Poisonous articles as chemical stores—Detail requirements. (a)...

  5. 46 CFR 194.05-13 - Corrosive liquids as chemical stores-Detail requirements.

    Science.gov (United States)

    2010-10-01

    ... liquids are regulated by the appropriate portions of 49 CFR parts 172, 173, and 176 or part 147 of... 46 Shipping 7 2010-10-01 2010-10-01 false Corrosive liquids as chemical stores-Detail requirements... and Marking § 194.05-13 Corrosive liquids as chemical stores—Detail requirements. (a)...

  6. 46 CFR 194.05-5 - Chemicals in the chemistry laboratory.

    Science.gov (United States)

    2010-10-01

    ... labeled as required by 49 CFR part 172. Reagent containers in the laboratory shall be marked to show at... 46 Shipping 7 2010-10-01 2010-10-01 false Chemicals in the chemistry laboratory. 194.05-5 Section....05-5 Chemicals in the chemistry laboratory. (a) Small working quantities of chemical stores in...

  7. Generation of continuous-wave 194 nm laser for mercury ion optical frequency standard

    Science.gov (United States)

    Zou, Hongxin; Wu, Yue; Chen, Guozhu; Shen, Yong; Liu, Qu; Precision measurement; atomic clock Team

    2015-05-01

    194 nm continuous-wave (CW) laser is an essential part in mercury ion optical frequency standard. The continuous-wave tunable radiation sources in the deep ultraviolet (DUV) region of the spectrum is also serviceable in high-resolution spectroscopy with many atomic and molecular lines. We introduce a scheme to generate continuous-wave 194 nm radiation with SFM in a Beta Barium Borate (BBO) crystal here. The two source beams are at 718 nm and 266 nm, respectively. Due to the property of BBO, critical phase matching (CPM) is implemented. One bow-tie cavity is used to resonantly enhance the 718 nm beam while the 266 nm makes a single pass, which makes the configuration easy to implement. Considering the walk-off effect in CPM, the cavity mode is designed to be elliptical so that the conversion efficiency can be promoted. Since the 266 nm radiation is generated by a 532 nm laser through SHG in a BBO crystal with a large walk-off angle, the output mode is quite non-Gaussian. To improve mode matching, we shaped the 266 nm beam into Gaussian modes with a cylindrical lens and iris diaphragm. As a result, 2.05 mW 194 nm radiation can be generated. As we know, this is the highest power for 194 nm CW laser using SFM in BBO with just single resonance. The work is supported by the National Natural Science Foundation of China (Grant No. 91436103 and No. 11204374).

  8. Yeast Interacting Proteins Database: YER081W, YDR194C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YDR194C MSS116 DEAD-box protein required for efficient splicing of mitochondrial Group I and II introns; non...e name MSS116 Prey description DEAD-box protein required for efficient splicing of mitochondrial Group I and

  9. Identification of miR-194-5p as a potential biomarker for postmenopausal osteoporosis

    Directory of Open Access Journals (Sweden)

    Jia Meng

    2015-05-01

    Full Text Available The incidence of osteoporosis is high in postmenopausal women due to altered estrogen levels and continuous calcium loss that occurs with aging. Recent studies have shown that microRNAs (miRNAs are involved in the development of osteoporosis. These miRNAs may be used as potential biomarkers to identify women at a high risk for developing the disease. In this study, whole blood samples were collected from 48 postmenopausal Chinese women with osteopenia or osteoporosis and pooled into six groups according to individual T-scores. A miRNA microarray analysis was performed on pooled blood samples to identify potential miRNA biomarkers for postmenopausal osteoporosis. Five miRNAs (miR-130b-3p, -151a-3p, -151b, -194-5p, and -590-5p were identified in the microarray analysis. These dysregulated miRNAs were subjected to a pathway analysis investigating whether they were involved in regulating osteoporosis-related pathways. Among them, only miR-194-5p was enriched in multiple osteoporosis-related pathways. Enhanced miR-194-5p expression in women with osteoporosis was confirmed by quantitative reverse transcription–polymerase chain reaction analysis. For external validation, a significant correlation between the expression of miR-194-5p and T-scores was found in an independent patient collection comprised of 24 postmenopausal women with normal bone mineral density, 30 postmenopausal women with osteopenia, and 32 postmenopausal women with osteoporosis (p < 0.05. Taken together, the present findings suggest that miR-194-5p may be a viable miRNA biomarker for postmenopausal osteoporosis.

  10. MicroRNA-194 Modulates Glucose Metabolism and Its Skeletal Muscle Expression Is Reduced in Diabetes

    Science.gov (United States)

    Latouche, Celine; Natoli, Alaina; Reddy-Luthmoodoo, Medini; Heywood, Sarah E.; Armitage, James A.; Kingwell, Bronwyn A.

    2016-01-01

    Background The regulation of microRNAs (miRNAs) at different stages of the progression of type 2 diabetes mellitus (T2DM) and their role in glucose homeostasis was investigated. Methods Microarrays were used to assess miRNA expression in skeletal muscle biopsies taken from healthy individuals and patients with pre-diabetes or T2DM, and insulin resistant offspring of rat dams fed a high fat diet during pregnancy. Results Twenty-three miRNAs were differentially expressed in patients with T2DM, and 7 in the insulin resistant rat offspring compared to their controls. Among these, only one miRNA was similarly regulated: miR-194 expression was significantly reduced by 25 to 50% in both the rat model and in human with pre-diabetes and established diabetes. Knockdown of miR-194 in L6 skeletal muscle cells induced an increase in basal and insulin-stimulated glucose uptake and glycogen synthesis. This occurred in conjunction with an increased glycolysis, indicated by elevated lactate production. Moreover, oxidative capacity was also increased as we found an enhanced glucose oxidation in presence of the mitochondrial uncoupler FCCP. When miR-194 was down-regulated in vitro, western blot analysis showed an increased phosphorylation of AKT and GSK3β in response to insulin, and an increase in expression of proteins controlling mitochondrial oxidative phosphorylation. Conclusions Type 2 diabetes mellitus is associated with regulation of several miRNAs in skeletal muscle. Interestingly, miR-194 was a unique miRNA that appeared regulated across different stages of the disease progression, from the early stages of insulin resistance to the development of T2DM. We have shown miR-194 is involved in multiple aspects of skeletal muscle glucose metabolism from uptake, through to glycolysis, glycogenesis and glucose oxidation, potentially via mechanisms involving AKT, GSK3 and oxidative phosphorylation. MiR-194 could be down-regulated in patients with early features of diabetes as an

  11. Test of ΔI = 2 staggering in the superdeformed bands of 194Hg

    International Nuclear Information System (INIS)

    The presence of ΔI = 2 staggering in the three known superdeformed bands of 194Hg has been reexamined in a new experiment with Gammasphere. A relative accuracy of better than 30 eV was achieved for most transition energies. No statistically significant oscillations in the transition energies were found for band 1 while staggering patterns were observed in bands 2 and 3. The statistical significance of the observed effects was analyzed. The patterns display some similarities with expectations based on a band crossing picture, even though such a picture cannot reproduce the observations in a straightforward way. No evidence was found for additional superdeformed bands in 194Hg which could account for possible band-crossings

  12. Two-proton high-K oblate structures in 194Pb

    International Nuclear Information System (INIS)

    The new γ-spectrometer EUROGAM has enabled us to establish the linking transitions between the band heads and the low-energy states already known from previous experiments for 194Pb. Dipole γ-ray cascades have been observed and a partial level scheme is presented, some particular points are analysed. A discussion fed on previous results and on similarities with other nuclei is led in order to get information about rotational bands, deformation and multiparticle configurations. (A.C.)

  13. Test of ΔI = 2 staggering in the superdeformed bands of 194Hg

    International Nuclear Information System (INIS)

    Superdeformed (SD) states in 194Hg were populated in 150Nd(48Ca,4n) using a 201 MeV 48Ca beam from the 88- inch cyclotron. A high statistics experiment was done to test for the previously reported evidence for a ΔI = 2 staggering in the three SD bands in 194Hg. The transition energies were determined with a precision of at least 60 eV for most transitions. From this improvement, we cannot confirm evidence for an extended regular ΔI = 2 staggering in any of the three SD bands of 194Hg. However, we observe deviations from a smooth reference in the SD bands 2 and 3 which differ from previous results. Oscillation patterns of the γ-ray energies that can be induced by a simple band crossing or level shift are discussed. Even though such level shifts would explain the observed effects, other experimental signatures, such as a crossing band, are needed to fully understand the results of the present work; no such band was found

  14. Analysis of clinical characteristics of 194 HIV positive pregnant women%194名HIV阳性孕妇临床特征分析

    Institute of Scientific and Technical Information of China (English)

    于兰; 唐志荣; 刘丽芬; 刘燕芬; 杨睿侃; 李繁; 张福杰

    2011-01-01

    Objectives To analyze the demographic, epidemiological, clinical and laboratmy characteristics of 194 HIV positive pregnant women visiting prenatal clinics in Guangxi and to explore the impact of HIV on pregnant women. Methods The data of demographic,epidemiology, clinical and laboratory characteristics of 194 HIV positive pregnant women diagnosed in four cities and counties of Guangxi from October 2008 to February 2009 were analyzed. Results The average age of 194 HIV pregnant women was 26 ± 4.4 years. A majoriiy of them were infected through sexual behavior. 14.4% and 45.9% of them were found at first and third trimester, respectively. Median CD4 count was 317/mL and HIV viral load was 23 600copies/mL when enrolled. There were 54% patients whose CD4 was lower than 350/mL and 19% whose viral load over 100 000 copies/mL. Anemia was common in 61.9% pregnant women, and opportunity infection ( OI ) was found in 16% pregnant women, the main manifestations of which included recmrent fever, skin lesion, respiratory infection,tuberculosis and chronic diarrhea. There were 4.61% and 67.01% HIV positive pregnant women receiving HAART before pregnancy and during pregnancy, and 9.28% of them received cotrimoxazole prophylaxis for OI prevention. Conclusion Early detecting of HIV positive pregnant women and understanding the epidemiological, demographic, clinical and laboratory characteristics of them are the priority strategies of implementing intervention and care for HIV positive pregnant women.%目的 对广西4个市、县在产前门诊发现的194例艾滋病病毒(HIV)阳性孕产妇的人口学、流行病学临床及实验室特征进行描述性分析,了解HIV对孕产妇的影响.方法 针对在2006年10月到2009年2月广西省4个市、县发现的194例HIV阳性孕产妇人口学、流行病学、临床和实验室特征进行分析.结果 194名HIV阳性的孕妇的平均年龄(26±4.4)岁,大部分经性感染,其中孕早期和孕晚

  15. MicroRNA-194 restrains the cell progression of non-small cell lung cancer by targeting human nuclear distribution protein C.

    Science.gov (United States)

    Zhou, Lirong; Di, Qingguo; Sun, Baohua; Wang, Xiaosheng; Li, Min; Shi, Jian

    2016-06-01

    NSCLC accounts for over 80% of all lung cancers and is associated with poor prognosis. Human nuclear distribution C (hNUDC) was predicted to be the target gene of microRNA-194 (miR-194). The present study was designed to demonstrate the mechanism of miR-194 in the regulation of non-small cell lung cancer (NSCLC) via targeting the hNUDC. The hNUDC expression was found to strongly be increased while the miR-194 decreased significantly in the NSCLC cell lines when compared with the healthy controls. Moreover, the luciferase report confirmed the targeting reaction between miR-194 and hNUDC. After transfection with miR-194 mimic into NSCLC cells, we found that the miR-194 overexpression resulted in abnormal nuclear division, decreased cell proliferation and inhibited the expression of hNUDC and Mpl/ERK pathway proteins. Furthermore, the hNUDC overexpression affected the suppression effect of miR-194 in 95D cells, indicating that miR-194 suppresses tumor cell process by inhibiting the hNUDC expression. In brief, the present study suggests that the upregulation of miR-194 affects the hNUDC expression, leading to a downregulated expression of Mpl/ERK pathway proteins, and suppresses the mitosis and proliferation of NSCLC cells. These results offer a potential therapeutic strategy for the treatment of lung cancer. PMID:27035759

  16. Multiple superdeformed bands in 194Hg and their dynamical moments of inertia

    International Nuclear Information System (INIS)

    Three superdeformed bands have been observed in 194Hg. The dynamical moment of inertia J(2) of all three bands is observed to increase by 30-40% over the frequency range ℎω=0.1-0.4 MeV. This phenomena can be understood in terms of the gradual alignment of pairs of high-j intruder orbitals within the framework of the cranked Woods-Saxon and Nilsson models including pairing. The calculations together with the observed J(2) behaviour of the three bands indicate that pairing correlations in the superdeformed minimum are rather weak. (orig.)

  17. Two-proton high-K oblate structures in {sup 194}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Porquet, M.G.; Hannachi, F.; Bastin, G.; Brindejonc, V.; Deloncle, I.; Gall, B.; Schuck, C.; Smith, A.G. [Centre National de la Recherche Scientifique (CSNSM, IN2P3-CNRS), 91 - Orsay (France); Hannachi, F.; Simpson, J. [Daresbury Lab. (United Kingdom); Azaiez, F.; Bourgeois, C.; Duprat, J.; Korichi, A.; Perrin, N.; Poffe, N.; Sergolle, H. [Paris-11 Univ., 91 - Orsay (France). Inst. de Physique Nucleaire; Poffe, N. [Oxford Univ. (United Kingdom). Dept. of Physics; Astier, A.; Le Coz, Y.; Meyer, M.; Redon, N. [Lyon-1 Univ., 69 - Villeurbanne (France). Inst. de Physique Nucleaire; Sharpey-Shafer, J.F.; Joyce, M.J.; Beausang, C.M. [Liverpool Univ. (United Kingdom). Oliver Lodge Lab; Wadsworth, R.; Clark, R.M. [York-Univ., Dept. of Physics (United Kingdom)

    1995-12-31

    The new {gamma}-spectrometer EUROGAM has enabled us to establish the linking transitions between the band heads and the low-energy states already known from previous experiments for {sup 194}Pb. Dipole {gamma}-ray cascades have been observed and a partial level scheme is presented, some particular points are analysed. A discussion fed on previous results and on similarities with other nuclei is led in order to get information about rotational bands, deformation and multiparticle configurations. (A.C.) 27 refs.

  18. Study of the superdeformed band in [sup 194]Pb and [sup 192]Hg with EUROGAM

    Energy Technology Data Exchange (ETDEWEB)

    Hannachi, F.; Schueck, C.; Bastin, G.; Deloncle, I.; Gall, B.; Porquet, M.G.; Smith, A.G.; Azaiez, F.; Bourgeois, C.; Duprat, J.; Korichi, A.; Perrin, N.; Poffe, N.; Sergolle, H.; Astier, A.; Coz, Y. le; Meyer, M.; Redon, N.; Bentley, M.; Simpson, J.; Sharpey-Schafer, J.F.; Joyce, M.J.; Beausang, C.W.; Fallon, P.; Paul, E.S.; Dagnall, P.J.; Forbes, S.A.; Gale, S.; Jones, P.M.; Wadsworth, R.; Clark, R.M.; Aleonard, M.M.; Curien, D.; Defrance, G.; Carpenter, M.; Henry, R.; Lauritsen, T.; Willsau, P. (SERC, Daresbury Lab., Warrington (United Kingdom) C.S.N.S.M., IN2P3-CNRS, 91 Orsay (France) I.P.N., Orsay (France) Univ. of Oxford, Dept. of Physics (United Kingdom) I.P.N., Univ. Lyon-1, 69 Villeurbanne (France) Staffordshire Polytechnic, Stoke-on-Trent (United Kingdom) Oliver Lodge Lab., Univ. of Liverpool (United Kingdom) Univ. of York, Dept. of Physics, Helsington, York (United Kingdom) C.E.N.B.G., 33 Gradignan (France) C.R.N., 67 Strasbourg (France) Argonne National Lab., IL (United St

    1993-05-31

    A subset of the Eurogam array has been used to investigate the decay out of the superdeformed (SD) band in [sup 194]Pb. Two new band members and a new decay pattern into the low lying states at normal deformation (ND) have been established for this band. In the level scheme at normal deformation, the linking transitions between the previously known floating [Delta] I=1 sequence and the lower states have been established for the first time. In this talk we will also report on the preliminary results of the search for the linking transitions between the SD and ND states in [sup 192]Hg with the fully operational EUROGAM array. (orig.)

  19. Study of the superdeformed band in 194Pb and 192Hg with EUROGAM

    International Nuclear Information System (INIS)

    A subset of the Eurogam array has been used to investigate the decay out of the superdeformed (SD) band in 194Pb. Two new band members and a new decay pattern into the low lying states at normal deformation (ND) have been established for this band. In the level scheme at normal deformation, the linking transitions between the previously known floating Δ I=1 sequence and the lower states have been established for the first time. In this talk we will also report on the preliminary results of the search for the linking transitions between the SD and ND states in 192Hg with the fully operational EUROGAM array. (orig.)

  20. DSAM lifetime measurements for the chiral pair in {sup 194}Tl

    Energy Technology Data Exchange (ETDEWEB)

    Masiteng, P.L.; Bvumbi, S.P. [National Research Foundation, iThemba LABS, PO Box 722, Somerset West (South Africa); University of the Western Cape, Private Bag X17, Bellville (South Africa); University of Johannesburg, PO Box 524, Auckland Park (South Africa); Pasternak, A.A. [A.F. Ioffe Physical-Technical Institute, St.-Petersburg (Russian Federation); Lawrie, E.A.; Shirinda, O.; Lawrie, J.J.; Bark, R.A.; Kheswa, N.Y.; Lieder, E.O.; Lieder, R.M.; Mullins, S.M.; Murray, S.H.T. [National Research Foundation, iThemba LABS, PO Box 722, Somerset West (South Africa); Lindsay, R. [University of the Western Cape, Private Bag X17, Bellville (South Africa); Madiba, T.E.; Sharpey-Schafer, J.F. [National Research Foundation, iThemba LABS, PO Box 722, Somerset West (South Africa); University of the Western Cape, Private Bag X17, Bellville (South Africa); Ndayishimye, J.; Papka, P. [National Research Foundation, iThemba LABS, PO Box 722, Somerset West (South Africa); University of Stellenbosch, Department of Physics, Private Bag X1, Matieland (South Africa); Ntshangase, S.S. [National Research Foundation, iThemba LABS, PO Box 722, Somerset West (South Africa); University of Cape Town, Department of Physics, Private Bag, Rondebosch (South Africa)

    2016-02-15

    Most important for the identification of chiral symmetry in atomic nuclei is to establish a pair of bands that are near-degenerate in energy, but also in B(M1) and B(E2) transition probabilities. Dedicated lifetime measurements were performed for four bands of {sup 194}Tl, including the pair of four-quasiparticle chiral bands with close near-degeneracy, considered as a prime candidate for best chiral symmetry pair. The lifetime measurements confirm the excellent near-degeneracy in this pair and indicate that a third band may be involved in the chiral symmetry scenario. (orig.)

  1. Close near-degeneracy in a pair of four-quasiparticle bands in 194Tl

    International Nuclear Information System (INIS)

    A pair of rotational bands associated with the πh9/2⊗νi13/2−1 configuration at lower spins and with the πh9/2⊗νi13/2−3 configuration at higher spins is found in 194Tl. The two 4-quasiparticle bands show exceptionally close near-degeneracy in the excitation energies. Furthermore close similarity is also found in their alignments and B(M1)/B(E2) reduced transition probability ratios. Such close near-degeneracy probably indicates chiral geometry in the angular momentum space

  2. 3C 40 in Abell 194: can tail radio galaxies exist in a quiescent cluster?

    CERN Document Server

    Sakelliou, I; Jetha, N N

    2007-01-01

    The nearby cluster Abell 194 hosts two luminous, distorted radio galaxies. Both reside within the cluster's core region, being separated in projection by only 100 kpc. It is often suggested that tailed radio galaxies such as these reside in clusters that are under formation and are accreting new material from their outskirts. In this paper we study the intriguing appearance of Abell 194, and test whether the cluster and radio source dynamics are consistent with the cluster formation/merger model. We analyse data from the XMM-Newton satellite and previously unpublished observations with the Very Large Array (VLA), as well as presenting new data from the Giant Metre-Wave Radio Telescope (GMRT). The shape of the jets, and the lack of significant stripping of the galaxies' interstellar media, indicate that the radio galaxies are not moving at the large velocities they would have had if they were falling into the cluster from its outskirts; galaxy velocities of <=300 km s^-1 are adequate instead. A plausible sc...

  3. Evaporation residue excitation function measurement for 19F + 194,198Pt reactions

    International Nuclear Information System (INIS)

    Nuclear dissipation is one of the active fields in the present day nuclear physics research. Experimental signatures for dissipation are observed through large excess in pre-fission neutrons, γ-ray multiplicities from the compound nucleus, giant dipole resonance (GDR) γ-rays, light charged particles and evaporation residues in comparison to standard statistical model, for the heavy-ion induced fusion-fission or fusion-evaporation reactions (ERs). From the analysis of a large set of experimental data, it is well established that there exists a large dissipation at nuclear temperature above 1 MeV. But most of these probes are not sensitive to the dissipation within saddle. The ER cross-section is a probe which is sensitive to dissipation within the saddle point. Hence, the study of ER cross-section can be helpful in estimating the dissipation effects inside the saddle point. Also the other motivation for these measurements is to see the effect of shell closure on dissipation. With this motivation the evaporation cross-sections for 19F + 194,198Pt are measured at beam energy of 101 to 137.3 MeV. Of the above systems 19F + 194Pt populates 213Fr (N = 126) shell closed compound nucleus (CN) whereas, other system populate 217Fr (N = 130) non-shell closed CN

  4. Compliance of the Waste Isolation Pilot Plant with 40 CFR 194.24(b)

    International Nuclear Information System (INIS)

    This paper presents aspects of DOE's demonstration of compliance with the EPA regulation of the Waste Isolation Pilot Plant (WIPP). The WIPP, a geologic repository for transuranic (TRU) waste, is located 2150 feet below the ground surface in a bedded salt formation about 20 miles east of Carlsbad, NM. Performance of the WIPP as a repository requires that releases to the accessible environment not exceed the limits of the regulation 40 CFR Part 191(1) either when the WIPP is undisturbed, or if there is intrusion into the repository by drilling. In 1996, the EPA promulgated 40 CFR Part 194(2): the implementing regulation for 40 CFR Part 191. The regulatory subsection addressed here, 40 CFR 194.24(b), directs the DOE to identify and analyze the components and characteristics of the TRU waste that can impact performance of the WIPP repository, and thereby possibly impact waste containment. DOE must also analyze those waste characteristics and components that will not affect repository performance

  5. Imunogenicidade da cepa avirulenta RV194-2 do vírus rábico em camundongos

    Directory of Open Access Journals (Sweden)

    Rugimar Marcovistz

    1996-12-01

    Full Text Available O vírus rábico RV194-2, uma variante avirulenta da cepa CVS (Challenge Vírus Standard, produz uma infecção inaparente quando inoculado intracerebralmente em camundongos adultos. Sugerindo que a resposta imunológica do hospedeiro permite a eliminação do vírus do sistema nervoso central. Por esta razão foram estudadas a indução de interferon e a resposta imune humoral em camundongos BALB/c inoculados com vírus RV194-2. Durante a infecção, estes camundongos apresentaram elevados níveis de interferon no plasma e no cérebro com altos títulos de anticorpos neutralizantes anti-rábicos. A 2-5A sintetase. um marcador da ação dos interferons,foi também analisada no cérebro destes animais. Sua atividade, aumentou, paralelamente, á produção de interferon, demonstrando que este interferon é bioquímicamente ativo. O vírus RV194-2 também induziu, 45 dias após sua inoculação, proteção aos animais quando desafiados com a cepa virulenta CVS. Estes resultados demonstram que a cepa RV194-2possui um alto nível imunogênico.RV194-2 rabies virus, an avirulent mutant of CVS strain, induces an inapparent infection limited to the central nervous system (CNS in adult mice inoculated intracerebrally. This fact suggest that immune response of the host is able to eliminate the virus in CNS. For this reason, we have studied the induction of interferon and the humoral immune responses in BALB/c mice after RV194-2 inoculation. These mice presented high levels of interferon in the plasma and in the brain, with elevated levels of neutralizing antirabies antibodies. The 2-5A synthetase, an enzyme marker of interferon action, was analyzed in the brain of inoculated animals. Its enhancement in parallel to the interferon production in the brain, showed biochemical evidence that this interferon is active. Forty five days after RV194-2 virus inoculation, mice were protected against a challenge with the CVS virulent strain. The results presented

  6. 194,198Pt(p vector,p') reaction and the interacting boson model

    International Nuclear Information System (INIS)

    Angular distributions of dσ/dΩ and Ay were measured for low-lying collective states, Jπ=01+, 21+, 22+, 41+, 42+, 43+ in 194,198Pt using 135 MeV polarized protons. Coupled-channels analysis of the data indicates large E4 moments for the 4i (i=1, 2, 3) states in both the isotopes. These data have been analyzed in the framework of the interacting boson model (IBM). Although the standard IBM-1 scheme with only s- and d-bosons can describe the E2 properties of both isotopes quite well, a more generalized version which also includes a g-boson is needed to correctly reproduce simultaneously both the E2 and E4 data. Another model using the 'projected IBM-2' parameters gives similar results. (orig.)

  7. Numerical Simulation of Horizontal Continuous Casting Process of C194 Copper Alloy

    Science.gov (United States)

    Huang, Guojie; Xie, Shuisheng; Cheng, Lei; Cheng, Zhenkang

    2007-05-01

    Horizontal Continuous Casting (H.C.C) is an important method to cast C194 copper ingot. In this paper, numerical simulation is adopted to investigate the casting process in order to optimize the H.C.C technical parameters, such as the casting temperature, casting speed and cooling intensity. According to the numerical results, the reasonable parameters are that the casting temperature is between 1383K˜1463K, the casting speed is between 7.2m/h˜10.8m/h and the speed of cooling water is between 3.6m/s˜4.6m/s. The results of numerical simulation provide the significant reference to the subsequent experiments.

  8. Numerical Simulation of Horizontal Continuous Casting Process of C194 Copper Alloy

    International Nuclear Information System (INIS)

    Horizontal Continuous Casting (H.C.C) is an important method to cast C194 copper ingot. In this paper, numerical simulation is adopted to investigate the casting process in order to optimize the H.C.C technical parameters, such as the casting temperature, casting speed and cooling intensity. According to the numerical results, the reasonable parameters are that the casting temperature is between 1383K∼1463K, the casting speed is between 7.2m/h∼10.8m/h and the speed of cooling water is between 3.6m/s∼4.6m/s. The results of numerical simulation provide the significant reference to the subsequent experiments

  9. Spectral and Temporal Properties of MAXI J1836-194 during 2011 Outburst

    CERN Document Server

    Jana, A; Mondal, S; Chakrabarti, S K; Molla, A A; Chatterjee, D

    2015-01-01

    We study black hole candidate (BHC) MAXI~J1836-194 during its 2011 outburst with Two Component Advective Flow (TCAF) model using RXTE/PCU2 data in $2.5-25$~keV band. From spectral fit, accretion flow parameters such as Keplerian disk rate ($\\dot{m_d}$), sub-Keplerian halo rate ($\\dot{m_h}$), shock location ($X_{s}$) and compression ratio (R) are extracted directly. During the entire phase of the outburst, quasi-periodic oscillations (QPOs) are observed sporadically. From the nature of the variation of accretion rate ratio (ARR=$\\dot{m_h}$ / $\\dot{m_d}$) and QPOs, entire period of the outburst is classified in two spectral states, such as, hard (HS), hard-intermediate (HIMS). Unlike other transient BHCs, no signature of soft (SS) and soft-intermediate (SIMS) spectral states are observed during entire phase of the outburst

  10. RXTE observations and state transition in MAXI J1836-194

    CERN Document Server

    Radhika, D; Seetha, S

    2014-01-01

    We present the results of analysis of the X-ray transient source MAXI J1836-194 during its outburst in August 2011. MAXI GSC detected the source on 30th August 2011, when it started rising from the quiescence. We have studied the source using the observations of RXTE. In this paper, we study the temporal and spectral evolution of the source during the outburst. Spectral analysis shows that the source exhibits state transition to Hard Intermediate state(HIMS) and decays back to a Low/Hard state. The temporal analysis indicates the presence of QPOs during the hard intermediate state. We also observe correlation between the evolution of break frequency with respect to the spectral characteristics. We conclude that this is probably the second source after H 1743-322 which exhibits transition to HIMS but does not reach soft spectral state.

  11. Inelastic proton scattering from 194,198Pt isotopes and the interacting boson model

    International Nuclear Information System (INIS)

    The purpose of this study was to obtain the direct excitation E4 matrix elements from the ground state to the first three 4+ states in 194,198Pt and analyze these results in the framework of the Interacting Boson Model (IBM). Specifically, the role played by g-bosons in the IBM has been investigated. Inelastic scattering using 135 MeV polarized protons was performed on 194,198Pt targets. Angular distributions of the cross section and analyzing power have been measured for the excitation of several low-lying levels: 01+, 21+, 22+, 31-, 41+, 42+, 43+, 51-, and 71- in both these isotopes. Coupled-channels analyses of the data revealed large negative hexadecapole moments for the first three 4+ states. The sign of only the 01+ → 41+ transition matrix element was unambiguously determined in these experiments. The first measurements of the magnitude of the matrix element for the transition, 01+ → 43+ are reported. The data for 198Pt has also provided a more accurate determination of the sign and magnitude of the matrix element for the transition, 01+ → 22+. These data were next analyzed using the IBM. Although the conventional form of the model, which includes only s- (L = 0) and d-(L = 2) bosons could describe the E2 properties adequately, this form failed badly in describing the observed E4 properties. However, when the model was extended to include a g- (L = 4) boson, both E2 and E4 properties of these nuclei were quite well reproduced. The parameters required for such calculations were reasonable in the context of this being an extension of the conventional IBM

  12. Treatment of cultured glioma cells with the EGFR-TKI gefitinib (''Iressa'', ZD1839) increases the uptake of astatinated EGF despite the absence of gefitinib-mediated growth inhibition

    International Nuclear Information System (INIS)

    The EGFR-TKI (epidermal growth factor receptor tyrosine kinase inhibitor) gefitinib (''Iressa'', ZD1839), a reversible growth inhibitor of EGFR-expressing tumour cells, has been shown to enhance the antitumour effect of ionising radiation, and also to increase the uptake of radioiodinated EGF. Thus, combination of gefitinib treatment and radionuclide targeting is an interesting option for therapy of brain tumours that are difficult to treat with conventional methods. The aim of this study was to evaluate how pre-treatment with gefitinib affects binding of astatinated EGF (211At-EGF) to cultured glioma U343 cells, which express high levels of EGFR. The growth of U343 cells in the presence of gefitinib was investigated, and it was found that gefitinib does not significantly inhibit the growth of these cells. Nevertheless, the uptake of 211At-EGF in U343 cells was markedly increased (up to 3.5 times) in cells pre-treated with gefitinib (1 μM). This indicates that a combination of gefitinib treatment and radionuclide targeting to EGFR might be a useful therapeutic modality, even for patients who do not respond to treatment with gefitinib alone. (orig.)

  13. MicroRNA-194 promotes the growth, migration, and invasion of ovarian carcinoma cells by targeting protein tyrosine phosphatase nonreceptor type 12

    Science.gov (United States)

    Liang, Tian; Li, Liru; Cheng, Yan; Ren, Chengcheng; Zhang, Guangmei

    2016-01-01

    Ovarian carcinoma is the most lethal gynecologic malignancy among women. Ovarian cancer metastasis is the main reason for poor prognosis. MicroRNAs (miRNAs) have been shown to play an important role in tumorigenesis and metastasis in various cancers by affecting the expression of their targets. In this study, we explored the role of miR-194 in ovarian cancer. Real-time polymerase chain reaction assays showed that miR-194 was significantly upregulated in ovarian cancer tissues. Overexpression of miR-194 in ovarian cancer cells promotes cell proliferation, migration, and invasion; in contrast, inhibition of the expression of miR-194 has the opposite effects. Meanwhile, bioinformatics tools were used to identify protein tyrosine phosphatase nonreceptor type 12 (PTPN12) as a potential target of miR-194. The luciferase assay showed that miR-194 directly binds to the 3′-untranslated region of PTPN12. Western blot analysis and quantitative real-time polymerase chain reaction assay revealed that PTPN12 expression was negatively associated with miR-194 expression in both ovarian cancer tissues and cells. Thus, we conclude that miR-194 targets PTPN12 and functions as an oncogene in ovarian cancer cells. This novel pathway may provide a new insight to explain ovarian cancer development and metastasis. PMID:27486333

  14. 22 CFR Appendix A to Part 194 - Inter-American Commercial Arbitration Commission Rules of Procedure (As Amended April 1, 2002)

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Inter-American Commercial Arbitration... DEPARTMENT OF STATE INTERNATIONAL COMMERCIAL ARBITRATION INTER-AMERICAN COMMERCIAL ARBITRATION COMMISSION RULES OF PROCEDURE Pt. 194, App. A Appendix A to Part 194—Inter-American Commercial...

  15. Primary transitions between the yrast superdeformed band and low-lying normal deformed states in {sup 194}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Hauschild, K.; Bernstein, L.A.; Becker, J.A. [Lawrence Livermore National Lab., CA (United States)] [and others

    1996-12-31

    The observation of one-step `primary` gamma-ray transitions directly linking the superdeformed (SD) states to the normal deformed (ND) low-lying states of known excitation energies (E{sub x}), spins and parities (J{sup {pi}}) is crucial to determining the E{sub x} and J{sup {pi}} of the SD states. With this knowledge one can begin to address some of the outstanding problems associated with SD nuclei, such as the identical band issue, and one can also place more stringent restrictions on theoretical calculations which predict SD states and their properties. Brinkman, et al., used the early implementation of the GAMMASPHERE spectrometer array (32 detectors) and proposed a single, candidate {gamma} ray linking the {sup 194}Pb yrast SD band to the low-lying ND states in {sup 194}Pb. Using 55 detectors in the GAMMASPHERE array Khoo, et al., observed multiple links between the yrast SD band in {sup 194}Hg and the low-lying level scheme and conclusively determined E{sub x} and J of the yrast SD states. Here the authors report on an experiment in which Gammasphere with 88 detectors was used and the E{sub x} and J{sup {pi}} values of the yrast SD states in {sup 194}Pb were uniquely determined. Twelve one-step linking transitions between the yrast SD band and low-lying states in {sup 194}Pb have been identified, including the transition proposed by Brinkman. These transitions have been placed in the level scheme of {sup 194}Pb using coincidence relationships and agreements between the energies of the primary transitions and the energy differences in level spacings. Furthermore, measurements of angular asymmetries have yielded the multipolarities of the primaries which have allowed J{sup {pi}} assignments of the {sup 194}Pb SD states to be unambiguously determined for the first time without a priori assumptions about the character of SD bands. A study performed in parallel to this work using the EUROGAM-II array reports similar, but somewhat less extensive, results.

  16. Regulation of nucleolin expression by miR-194, miR-206, and HuR.

    Science.gov (United States)

    Bose, Sudeep; Tholanikunnel, Tracy E; Reuben, Adrian; Tholanikunnel, Baby G; Spicer, Eleanor K

    2016-06-01

    Nucleolin is a proliferation-associated protein that is overexpressed in multiple types of cancer. The mechanisms leading to overexpression of nucleolin in specific cancers are not fully understood. This study found that nucleolin is notably elevated in breast cancer cell lines MCF-7 and MDA-231 compared to nonmalignant breast epithelial MCF-10A cells. In silico analyses revealed the presence of putative binding sites for microRNAs miR-194 and miR-206 in the 3'-untranslated region (3'-UTR) of Ncl mRNA. Transfection of the three cell lines with pre-miR-194 or pre-miR-206 specifically decreased the Ncl mRNA and protein expression. Treatments of the cells with antagomiR-194 or antagomiR-206 upregulated nucleolin expression ~2- to 3-fold. Co-transfection of cells with a reporter vector containing the Ncl 3'-UTR downstream from the Renilla luciferase gene and pre-miR-194 or pre-miR-206 led to a ~3-fold decrease in Renilla/firefly luciferase activity. Cytoplasmic levels of the RNA-binding protein HuR were higher in MCF-7 and MDA-231 cells than those in MCF-10A cells. RNA immunoprecipitation assays demonstrated that HuR binds to Ncl mRNA in all the three cell types. ShRNA-mediated knock-down of HuR induced a decrease in nucleolin expression, while exogenous expression of HuR led to upregulation of nucleolin expression. Analysis of the polysome-monosome distribution of Ncl mRNA in HuR knock-down cells demonstrated that HuR enhances the translation efficiency of Ncl mRNA. These findings demonstrate that nucleolin expression is down-regulated by miR-194 and miR-206 and upregulated by HuR. PMID:27221739

  17. Overexpression of OsCYP19-4 increases tolerance to cold stress and enhances grain yield in rice (Oryza sativa).

    Science.gov (United States)

    Yoon, Dae Hwa; Lee, Sang Sook; Park, Hyun Ji; Lyu, Jae Il; Chong, Won Seog; Liu, Jang Ryol; Kim, Beom-Gi; Ahn, Jun Cheul; Cho, Hye Sun

    2016-01-01

    AtCYP19-4 (also known as CYP5) was previously identified as interacting in vitro with GNOM, a member of a large family of ARF guanine nucleotide exchange factors that is required for proper polar localization of the auxin efflux carrier PIN1. The present study demonstrated that OsCYP19-4, a gene encoding a putative homologue of AtCYP19-4, was up-regulated by several stresses and showed over 10-fold up-regulation in response to cold. The study further demonstrated that the promoter of OsCYP19-4 was activated in response to cold stress. An OsCYP19-4-GFP fusion protein was targeted to the outside of the plasma membrane via the endoplasmic reticulum as determined using brefeldin A, a vesicle trafficking inhibitor. An in vitro assay with a synthetic substrate oligomer confirmed that OsCYP19-4 had peptidyl-prolyl cis-trans isomerase activity, as was previously reported for AtCYP19-4. Rice plants overexpressing OsCYP19-4 showed cold-resistance phenotypes with significantly increased tiller and spike numbers, and consequently enhanced grain weight, compared with wild-type plants. Based on these results, the authors suggest that OsCYP19-4 is required for developmental acclimation to environmental stresses, especially cold. Furthermore, the results point to the potential of manipulating OsCYP19-4 expression to enhance cold tolerance or to increase biomass. PMID:26453745

  18. p194ar.m77t and p194ar.h77t: MGD77T data and header files for single-beam bathymetry data for field activity P-1-94-AR in Arctic Ocean from 07/25/1994 to 08/30/1994

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with SINS navigation data was collected as part of the U.S. Geological Survey cruise P-1-94-AR. The cruise was conducted in...

  19. k194hw.m77t and k194hw.h77t: MGD77T data and header files for single-beam bathymetry data for field activity K-1-94-HW in Mamala Bay, Offshore Honolulu, Oahu, Hawaii from 05/10/1994 to 05/16/1994

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of the U.S. Geological Survey cruise K-1-94-HW. The cruise was conducted in Oahu,...

  20. a194yb.m77t and a194yb.h77t: MGD77T data and header files for single-beam bathymetry for field activity A-1-94-YB in Yakutat Bay and Yakutat Sea Valley, Alaska from 08/05/1994 to 08/08/1994

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with GPS navigation data was collected as part of the U.S. Geological Survey cruise A-1-94-YB. The cruise was conducted in Yakutat...

  1. a194gb.m77t and a194gb.h77t: MGD77T data and header files for single-beam bathymetry data for field activity A-1-94-GB in Prince William Sound, Yakutat Bay, Glacier Bay and Icy Strait, Alaska from 08/08/1994 to 08/17/1994

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with GPS navigation data was collected as part of the U.S. Geological Survey cruise A-1-94-GB. The cruise was conducted in Prince...

  2. Tidal bridge and tidal dwarf candidates in the interacting system Arp194

    CERN Document Server

    Zasov, Anatoly; Egorov, Oleg; Afanasiev, Viktor

    2016-01-01

    Arp194 is a system of recently collided galaxies, where the southern galaxy (S) passed through the gaseous disc of the northern galaxy (N) which in turn consists of two close components. This system is of special interest due to the presence of regions of active star-formation in the bridge between galaxies, the brightest of which (the region A) has a size of at least 4 kpc. We obtained three spectral slices of the system for different slit positions at the 6-m telescope of SAO RAS. We estimated the radial distribution of line-of-sight velocity and velocity dispersion as well as the intensities of emission lines and oxygen abundance $12+\\log(\\mathrm{O/H})$. The gas in the bridge is only partially mixed chemically and spatially: we observe the O/H gradient with the galactocentric distances both from S and N galaxies and a high dispersion of O/H in the outskirts of N-galaxy. Velocity dispersion of the emission-line gas is the lowest in the star-forming sites of the bridge and exceeds 50-70 km/s in the disturbed...

  3. [Experience acquired in application of Law No. 194 for a period of 18 months].

    Science.gov (United States)

    Canfora, A; Costa, V; Giannoni, M; Pollastro, M

    1981-12-01

    After the promulgation of law 194, legalizing abortion in Italy, 455 pregnancy terminations were done at the Hospital of Saluzzo. In 98% of cases the technique used was dilatation and curettage under general anesthesia; most patients were hospitalized for 2 days; there was 1 case of uterine perforation, 2 cases of hemorrhage, and 4 cases of fever. Almost half of the patients came from other provinces, over 50% were in the age group 26-36, 78.72% were married, 53.19% were housewives, and 33.68% had 2 children. About 53.19% had elementary school education only, and about 28.01% were in the 8th week of gestation. Most requests for abortion were for economic reasons; 21.03% were because of contraceptive failure. The most important and striking information from this study is the lack of contraceptive information on the part of most patients; information on family planning is an absolute necessity to safeguard a woman's health, and should be made available to all women. PMID:7335243

  4. Oblate L = 1 bands in 194,196-201Pb, and 193Hg

    International Nuclear Information System (INIS)

    Reports of recent experiments have included observations of regular and irregular bands in neutron deficient Pb isotopes with A=194, 196--201. The bands are populated strongly in HI,xn reactions. The shared characteristics of the bands include: (1) Bandhead energies of few MeV; (2) High bandhead spin; (3) Large alignments; (4) Small dynamic moments of inertia, and (5) Strong L = 1 transitions and weaker L = 2 crossover transitions, with B(Ml/B(E2)) ∼ 20 μ2/e2b2. Lifetimes of band members in the 198Pb regular band are B(Ml) ∼ 1 W.u., and B(E2) ∼ 10 W.u. (with large errors). These observations are consistent with an interpretation of the regular structures as collective oblate bands with both proton and neutron excitations involved; the closed proton shell at Z = 82 is broken, and coupled to v(il3/2)-n excitations. The irregular structures may correspond to triaxial shapes, with similar orbits involved. A similar structure has been also found in 193Hg

  5. The face-on disk of MAXI J1836-194

    CERN Document Server

    Russell, T D; Motch, C; Pakull, M W; Torres, M A P; Curran, P A; Jonker, P G; Miller-Jones, J C A

    2013-01-01

    We present Very Large Telescope optical spectra of the black hole candidate X-ray binary MAXI J1836-194 at the onset of its 2011 outburst. Although the spectrum was taken at the beginning of the outburst and contains a significant contribution from the optically-thin synchrotron emission that originates in the radio jet, we find that the accretion disk was already large and bright. Single-peaked, narrow H$\\alpha$ and He II $\\lambda$4686 lines imply the most face-on accretion disk observed in a black hole low-mass X-ray binary to date, with an inclination angle between 4$^{\\circ}$ and 15$^{\\circ}$, assuming a black hole mass of between 5 M$_\\odot$ and 12 M$_\\odot$, for distances of between 4 and 10 kpc. We use New Technology Telescope observations of the system in quiescence to place strong upper limits on the mass and radius of the donor star and the orbital period. The donor is a main sequence star with a mass 1.9 M$_{\\odot}$ if the system is located 4 kpc away and >7.0 M$_{\\odot}$ at 10 kpc.

  6. Accretion flow dynamics of MAXI J1836-194 during its 2011 outburst from TCAF solution

    CERN Document Server

    Jana, Arghajit; Chakrabarti, Sandip K; Mondal, Santanu; Molla, Aslam Ali

    2016-01-01

    The Galactic transient X-ray binary MAXI J1836-194 was discovered on 29th Aug. 2011. Here we make a detailed study of the spectral and timing properties of its 2011 outburst using archival data of RXTE Proportional Counter Array instrument. The evolution of accretion flow dynamics of the source during the outburst through spectral analysis with Chakrabarti-Titarchuk's two-component advective flow (TCAF) solution as a local table model in XSPEC. We also fitted spectra with combined disk blackbody and power-law models and compare it with that of the TCAF model fitted results. The source is found to be in hard and hard-intermediate spectral states only during entire phase of this outburst. No soft and soft-intermediate spectral states are observed. This could be due to the fact that this object belongs to a special class of sources (with, e.g., MAXI J1659-152, Swift J1753.5-0127, etc.) having very short orbital periods and the companion is profusely mass losing or the disk is immersed inside an excretion disk. I...

  7. Long noncoding RNA H19 contributes to gallbladder cancer cell proliferation by modulated miR-194-5p targeting AKT2.

    Science.gov (United States)

    Wang, Shou-Hua; Wu, Xiao-Cai; Zhang, Ming-Di; Weng, Ming-Zhe; Zhou, Di; Quan, Zhi-Wei

    2016-07-01

    Gallbladder cancer (GBC) is a highly malignant cancer with poor prognosis. Although long noncoding RNA (lncRNA) H19 has been reported to play vital role in many human cancers, whether it is involved in GBC proliferation is still unknown. This study was designed to explore the effect of H19 in GBC cell proliferation. The expression of H19 and AKT2 were significantly elevated in GBC tissues, and the level of miR-194-5p is markedly decreased. Moreover, the RNA levels of H19 and AKT2 were positively correlated, and H19 elevation was significantly associated with tumor size. Cell proliferation decreased significantly after knockdown of H19 in GBC-SD and NOZ cells and after knockdown of AKT2 in NOZ cells. Results from cell cycle studies indicated that the S phase were significantly decreased after knockdown of H19 in NOZ cells but significantly elevated after overexpression of H19 in GBC-SD cells. Furthermore, knockdown of H19 upregulated miR-194-5p levels, yet significantly decreased miR-194-5p targeting AKT2 gene expression in NOZ cells. Inhibitor against miR-194-5p reversed these effects. In addition, overexpression of H19 in GBC-SD cells downregulated miR-194-5p and markedly increased AKT2 expression, and miR-194-5p mimic reversed these effects. Eventually, GBC cells were arrested in G0/G1-phase after H19 knockdown, inhibition of miR-194-5p markedly promoted cells into S-phase and co-transfection of siH19, and miR-194-5p inhibitor exerted mutually counter-regulated effects on cell cycle. These results suggested that H19/miR-194-5p/AKT2 axis regulatory network might modulate cell proliferation in GBC. PMID:26803515

  8. SUZAKU OBSERVATION OF THE BLACK HOLE CANDIDATE MAXI J1836-194 IN A HARD/INTERMEDIATE SPECTRAL STATE

    International Nuclear Information System (INIS)

    We report on a Suzaku observation of the newly discovered X-ray binary MAXI J1836-194. The source is found to be in the hard/intermediate spectral state and displays a clear and strong relativistically broadened iron emission line. We fit the spectra with a variety of phenomenological, as well as physically motivated disk reflection models, and find that the breadth and strength of the iron line are always characteristic of emission within a few gravitational radii around a black hole. This result is independent of the continuum used and strongly points toward the central object in MAXI J1836-194 being a stellar mass black hole rotating with a spin of a = 0.88 ± 0.03 (90% confidence). We discuss this result in the context of spectral state definitions, physical changes (or lack thereof) in the accretion disk, and on the potential importance of the accretion disk corona in state transitions.

  9. Study of the strength distribution of primary γ-transitions in the decay from superdeformed states in 194Hg

    International Nuclear Information System (INIS)

    The strength distribution of the primary γ rays in the decay from superdeformed (SD) states is investigated by applying the maximum likelihood method. For the 194Hg nucleus, 41 primary transitions are identified above 2600 keV. It is concluded that they represent the strongest 10% of the transitions selected stochastically from a Porter-Thomas distribution. This would support the scenario of a statistical decay of SD states via coupling to a compound state at normal deformation. However, the occurrence of several very strong 'one-step linking' transitions is found to have a very small probability. Based on the absence of strong primary transitions from SD states in adjacent nuclei, the situation in 194Hg is viewed as a very lucky incidence

  10. 194例婴幼儿麻疹临床及流行病学特征的分析%An analysis of clinical and epidemiological features of 194 cases of infants with measles

    Institute of Scientific and Technical Information of China (English)

    刘杰兵

    2015-01-01

    Objective To explore the clinical and epidemiological features of 194 cases of infants with measles in Huadu. Methods Retrospective analysis of clinical data of 194 cases of infants with measles in Huadu from 2010 to 2014 were made,and it was analyzed by descriptive epidemiological methods. Results 194 infants with measles were diagnosed in Huadu from 2010 to 2014.Morbidity in the infants under 1 years old was highest (P < 0.05),and the onset of the disease were mainly in March and April.Morbidity of floating population was significantly higher than that of local population (P < 0.05),and Morbidity of people without history of vaccination and people with measles contact was significantly higher (P < 0.05). Conclusion Measures can be taken to control the morbidity of measles effectively including good seasonal prevention,expanding measles immunization timely,raising the vaccination rate of floating and rural population and strengthening vaccination of high-risk population.%目的:探讨花都区婴幼儿麻疹临床及流行病学特点。方法回顾性分析花都区2010~2014年194例婴幼儿麻疹的临床资料,并进行描述性流行病学分析。结果2010年~2014花都区共出现婴幼儿麻疹194例,年龄<1岁发病率最高(P <0.05),发病时间主要集中于3、4月份,流动人口发病率明显高于本地户籍人口(P <0.05),无免疫接种史和有麻疹接触史者发病率明显要高(P <0.05)。结论做好季节性预防,及时扩大麻疹免疫接种范围,提高流动人口和农村人口的接种率,加强对高危人群免疫接种,可达到有效控制麻疹发病率的作用。

  11. Accretion Flow Dynamics of MAXI J1836-194 During Its 2011 Outburst from TCAF Solution

    Science.gov (United States)

    Jana, Arghajit; Debnath, Dipak; Chakrabarti, Sandip K.; Mondal, Santanu; Molla, Aslam Ali

    2016-03-01

    The Galactic transient X-ray binary MAXI J1836-194 was discovered on 2011 August 29. Here we make a detailed study of the spectral and timing properties of its 2011 outburst using archival data from the RXTE Proportional Counter Array instrument. The evolution of accretion flow dynamics of the source during the outburst through spectral analysis with Chakrabarti-Titarchuk’s two-component advective flow (TCAF) solution as a local table model in XSPEC. We also fitted spectra with combined disk blackbody and power-law models and compared it with the TCAF model fitted results. The source is found to be in hard and hard-intermediate spectral states only during the entire phase of this outburst. No soft or soft-intermediate spectral states are observed. This could be due to the fact that this object belongs to a special class of sources (e.g., MAXI J1659-152, Swift J1753.5-0127, etc.) that have very short orbital periods and that the companion is profusely mass-losing or the disk is immersed inside an excretion disk. In these cases, flows in the accretion disk are primarily dominated by low viscous sub-Keplerian flow and the Keplerian rate is not high enough to initiate softer states. Low-frequency quasi-periodic oscillations (QPOs) are observed sporadically although as in normal outbursts of transient black holes, monotonic evolutions of QPO frequency during both rising and declining phases are observed. From the TCAF fits, we find the mass of the black hole in the range of 7.5-11 M⊙, and from time differences between peaks of the Keplerian and sub-Keplerian accretion rates we obtain a viscous timescale for this particular outburst, ˜10 days.

  12. Major impacts of the 40 CFR 194 final rule on the WIPP performance assessment

    International Nuclear Information System (INIS)

    After some 20 years of site-specific studies in the United States of America (USA), the US Department of Energy (DOE) Carlsbad Area Office (CAO) is on schedule to open a deep geological repository for the safe disposal of transuranic (TRU) waste at the Waste Isolation Pilot Plant (WIPP) in April 1998. A focused organization, well-defined mission, early and iterative interactions with the regulators, oversight groups, and stakeholders in the regulatory process, and strong local support are some of the keys to this progress. The remaining activities, which will be completed prior to the initiation of disposal at the WIPP, include a formal integrated system checkout, readiness review and evaluation, and the required regulatory approvals. The Environmental Protection Agency (EPA) has now defined the path forward for the WIPP with respect to one of the major regulatory hurdles. With the promulgation of Title 40 of the Code of Federal Regulations (CFR), Part 194, in February 1996 entitled open-quotes Criteria for the Certification and Re-Certification of the Waste Isolation Pilot Plant's Compliance with the 40 CFR Part 191 Disposal Regulations,close quotes the format and content for the DOE's Compliance Certification Application (CCA) is now clearly defined. Along with the much needed definition of the required format and content for the CCA, the final criteria included a few unforeseen challenges for the DOE. Among these challenges are new requirements that jeopardize the timely completion of the performance assessment (PA) calculations and submittal of the CCA to the EPA in October 1996

  13. XRCC1 Arg194Trp and Arg399Gln polymorphisms and arsenic methylation capacity are associated with urothelial carcinoma

    International Nuclear Information System (INIS)

    The association between DNA repair gene polymorphisms and bladder cancer has been widely studied. However, few studies have examined the correlation between urothelial carcinoma (UC) and arsenic or its metabolites. The aim of this study was to examine the association between polymorphisms of the DNA repair genes, XRCC1 Arg194Trp, XRCC1 Arg399Gln, XRCC3 Thr241Met, and XPD Lys751Gln, with urinary arsenic profiles and UC. To this end, we conducted a hospital-based case–control study with 324 UC patients and 647 age- and gender-matched non-cancer controls. Genomic DNA was used to examine the genotype of XRCC1 Arg194Trp, XRCC1 Arg399Gln, XRCC3 Thr241Met, and XPD Lys751Gln by PCR-restriction fragment length polymorphism analysis (PCR-RFLP). Urinary arsenic profiles were measured by high performance liquid chromatography (HPLC) linked with hydride generator and atomic absorption spectrometry. The XRCC1 399 Gln/Gln and 194 Arg/Trp and Trp/Trp genotypes were significantly related to UC, and the odds ratio (OR) and 95% confidence interval (95%CI) were 1.68 (1.03–2.75) and 0.66 (0.48–0.90), respectively. Participants with higher total urinary arsenic levels, a higher percentage of inorganic arsenic (InAs%) and a lower percentage of dimethylarsinic acid (DMA%) had a higher OR of UC. Participants carrying XRCC1 risk diplotypes G-C/G-C, A-C/A-C, and A-T/G-T, and who had higher total arsenic levels, higher InAs%, or lower DMA% compared to those with other XRCC1 diplotypes had a higher OR of UC. Our results suggest that the XRCC1 399 Gln/Gln and 194 Arg/Arg DNA repair genes play an important role in poor arsenic methylation capacity, thereby increasing the risk of UC in non-obvious arsenic exposure areas. - Highlights: • The XRCC1 399Gln/Gln genotype was significantly associated with increased OR of UC. • The XRCC1 194 Arg/Trp and Trp/Trp genotype had a significantly decreased OR of UC. • Combined effect of the XRCC1 genotypes and poor arsenic methylation capacity on

  14. XRCC1 Arg194Trp and Arg399Gln polymorphisms and arsenic methylation capacity are associated with urothelial carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Chiang, Chien-I [School of Public Health, College of Public Health and Nutrition, Taipei Medical University, Taipei, Taiwan (China); Huang, Ya-Li [Department of Public Health, School of Medicine, College of Medicine, Taipei Medical University, Taipei, Taiwan (China); Chen, Wei-Jen [School of Public Health, College of Public Health and Nutrition, Taipei Medical University, Taipei, Taiwan (China); Shiue, Horng-Sheng [Department of Chinese Medicine, Chang Gung Memorial Hospital and Chang Gung University College of Medicine, Taoyuan, Taiwan (China); Huang, Chao-Yuan; Pu, Yeong-Shiau [Department of Urology, National Taiwan University Hospital, College of Medicine National Taiwan University, Taipei, Taiwan (China); Lin, Ying-Chin [Department of Family Medicine, Shung Ho Hospital, Taipei Medical University, New Taipei, Taiwan (China); Department of Health Examination, Wan Fang Hospital, Taipei Medical University, Taipei, Taiwan (China); Division of Family Medicine, School of Medicine, Taipei Medical University, Taipei, Taiwan (China); Hsueh, Yu-Mei, E-mail: ymhsueh@tmu.edu.tw [School of Public Health, College of Public Health and Nutrition, Taipei Medical University, Taipei, Taiwan (China); Department of Public Health, School of Medicine, College of Medicine, Taipei Medical University, Taipei, Taiwan (China)

    2014-09-15

    The association between DNA repair gene polymorphisms and bladder cancer has been widely studied. However, few studies have examined the correlation between urothelial carcinoma (UC) and arsenic or its metabolites. The aim of this study was to examine the association between polymorphisms of the DNA repair genes, XRCC1 Arg194Trp, XRCC1 Arg399Gln, XRCC3 Thr241Met, and XPD Lys751Gln, with urinary arsenic profiles and UC. To this end, we conducted a hospital-based case–control study with 324 UC patients and 647 age- and gender-matched non-cancer controls. Genomic DNA was used to examine the genotype of XRCC1 Arg194Trp, XRCC1 Arg399Gln, XRCC3 Thr241Met, and XPD Lys751Gln by PCR-restriction fragment length polymorphism analysis (PCR-RFLP). Urinary arsenic profiles were measured by high performance liquid chromatography (HPLC) linked with hydride generator and atomic absorption spectrometry. The XRCC1 399 Gln/Gln and 194 Arg/Trp and Trp/Trp genotypes were significantly related to UC, and the odds ratio (OR) and 95% confidence interval (95%CI) were 1.68 (1.03–2.75) and 0.66 (0.48–0.90), respectively. Participants with higher total urinary arsenic levels, a higher percentage of inorganic arsenic (InAs%) and a lower percentage of dimethylarsinic acid (DMA%) had a higher OR of UC. Participants carrying XRCC1 risk diplotypes G-C/G-C, A-C/A-C, and A-T/G-T, and who had higher total arsenic levels, higher InAs%, or lower DMA% compared to those with other XRCC1 diplotypes had a higher OR of UC. Our results suggest that the XRCC1 399 Gln/Gln and 194 Arg/Arg DNA repair genes play an important role in poor arsenic methylation capacity, thereby increasing the risk of UC in non-obvious arsenic exposure areas. - Highlights: • The XRCC1 399Gln/Gln genotype was significantly associated with increased OR of UC. • The XRCC1 194 Arg/Trp and Trp/Trp genotype had a significantly decreased OR of UC. • Combined effect of the XRCC1 genotypes and poor arsenic methylation capacity on

  15. Considerations for guidance for radioactive waste disposal arising from rules under 40 CFR 191 and 40 CFR 194

    International Nuclear Information System (INIS)

    Preliminary performance assessments (PAs) have been conducted for the Waste Isolation Pilot Plant (WIPP) in southeastern New Mexico. These PAs assess the ability of the WIPP, a proposed disposal facility for defense-generated nuclear waste, to comply with EPA's requirements at 40 CFR 191. The experience in conducting PAs has provided insights into guidance that would facilitate the conduct of studies and analyses required by the regulation. Guidance topics and suggested directions are discussed for possible inclusion in EPA rulemaking for WIPP-specific compliance criteria to be found at 40 CFR 194

  16. Upregulation of miRNA-143, -145, -192, and -194 in esophageal epithelial cells upon acidic bile salt stimulation.

    Science.gov (United States)

    Bus, P; Siersema, P D; Verbeek, R E; van Baal, J W P M

    2014-08-01

    Barrett's esophagus (BE) is a metaplastic condition of the distal esophagus that occurs because of chronic gastroesophageal reflux. Previous studies have identified BE-specific microRNAs (miRNAs) in comparison with normal squamous epithelium (SQ). We hypothesized that BE-specific miRNAs could be induced in esophageal SQ cells by exposure to acid and/or bile salts. We aimed to determine whether BE-specific miRNAs are upregulated in an esophageal SQ cell line (Het-1A) in an environment with acid and/or bile salts and whether this is nuclear factor-κB (NF-κB) dependent. Acid and/or bile salt incubations were performed in Het-1A cells. Experiments were performed with or without inhibiting the NF-κB pathway. Quantitative reverse transcriptase polymerase chain reaction was performed to determine expression of miRNA-143, -145, -192, -194, cyclo-oxygenase-2 (COX2), mucin 2 (MUC2), and sex determining region Y-box 9. For validation, we determined levels of these miRNAs in biopsies from patients with reflux esophagitis and normal SQ. Significantly increased expression levels of miRNA-143 (2.7-fold), -145 (2.6-fold), -192 (2.0-fold), -194 (2.2-fold), COX2, MUC2, and sex determining region Y-box 9 were found upon acidic bile salt incubation, but not upon acid or bile salt alone. NF-κB pathway inhibition significantly decreased miRNA-143, -192, -194, COX2, and MUC2 expression. Additionally, miRNA-143, -145 and -194 expression was increased in reflux esophagitis biopsies compared with normal SQ, but no changes were found in miRNA-192 expression. Our findings suggest that upregulation of BE-specific miRNAs by acidic bile may be an early event in the transition of SQ to BE and that their expression is partly regulated by the NF-κB pathway. PMID:24006894

  17. Adverse allergic reactions to linear ionic gadolinium-based contrast agents: experience with 194, 400 injections

    International Nuclear Information System (INIS)

    Aim: To report the authors' experience with the administration of four gadolinium-based contrast agents (GBCA; gadopentetate dimeglumine, gadofosveset trisodium, gadoxetate disodium and gadobenate dimeglumine) in a large study population at a single, large academic medical centre. Materials and methods: The institutional review board approved this retrospective study in which data in the electronic incident reporting system were searched. A total of 194, 400 intravenous administrations of linear ionic GBCAs were assessed for the incidence of adverse reactions and risk factors from 1 January 2007 to 14 January 2014. The severity of reactions (mild, moderate, and severe), patient type (outpatients, inpatients, and emergency), examination type, and treatment options were also investigated. Results: In total, 204/194400 (0.1%) patients (mean age 45.7 ± 14.9) showed adverse reactions, consisting of 6/746 (0.80%), 10/3200 (0.31%), 14/6236 (0.22%) and 174/184218 (0.09%), for gadofosveset trisodium, gadoxetate disodium, gadobenate dimeglumine, and gadopentetate dimeglumine, respectively. An overall significant difference was found between different GBCAs regarding the total number of reactions (p < 0.0001). When comparing the GBCAs together, significant differences were found between gadofosveset trisodium versus gadopentetate dimeglumine (p < 0.0001), gadofosveset trisodium versus gadobenate dimeglumine (p = 0.0051), gadoxetate disodium versus gadopentetate dimeglumine (p < 0.0001) and gadopentetate dimeglumine versus gadobenate dimeglumine (p = 0.0013). Rate of reaction was higher in females (F: 146/113187, 0.13%/M: 58/81213, 0.07%; p < 0.0001). Rate of reactions was higher in outpatient (180/158885, 0.11%), emergency (10/10413, 0.10%), and inpatients (14/25102, 0.05%), respectively (p < 0.0001). Most of the patients had mild symptoms 171/204 (83.8%). Abdomen–pelvis, liver, and thoracic examinations had highest rates of reactions (0.17 versus 0

  18. M1 transitions between superdeformed states in 194,195Tl: The fingerprint of the i13/2 proton intruder orbital

    International Nuclear Information System (INIS)

    Recent data from the EUROGAM array have revealed dipole transitions linking signature partner superdeformed bands in 194Tl and 195Tl nuclei. Measurements of the decay branching ratios, taken together with the average quadrupole moment of the neighboring superdeformed nuclei, enable the absolute M1 strengths to be determined. From these data and using the strong coupling model, we find that two SD bands in 195Tl are due to the 81st proton being in the [642]5/2+ orbital and four from the six SD bands in 194Tl correspond to a configuration where the intrinsic spins of the single proton and single neutron are aligned. (orig.)

  19. Fission excitation function for 19F + 194,196,198Pt at near and above barrier energies

    Directory of Open Access Journals (Sweden)

    Singh Varinderjit

    2015-01-01

    Full Text Available Fission excitation functions for 19F + 194,196,198Pt reactions populating 213,215,217Fr compound nuclei are reported. Out of these three compound nuclei, 213Fr is a shell closed (N=126 compound nucleus and the other two are away from the shell closure. From a comparison of the experimental fission cross-sections with the statistical model predictions, it is observed that the fission cross-sections are underestimated by the statistical model predictions using shell corrected finite range rotating liquid drop model (FRLDM fission barriers. Further the FRLDM fission barriers are reduced to fit the fission cross-sections over the entire measured energy range.

  20. Novel cost-effective bifacial silicon solar cells with 19.4% front and 18.1% rear efficiency

    Science.gov (United States)

    Hübner, Andreas; Aberle, Armin G.; Hezel, Rudolf

    1997-02-01

    Bifacial solar cells are a promising possibility to lower the costs of solar electricity compared to conventional monofacial solar cells. These devices utilize the sunlight more efficiently since they are able to convert light incident on both sides of the cell. In this letter, a novel, cost-effective bifacial silicon solar cell structure is presented. On float-zone silicon, the cells exhibit conversion efficiencies of 19.4% and 16.5% under 1-sun front and rear illumination, respectively. Furthermore, a "symmetrical" version of the cells is presented demonstrating front and rear efficiencies of 18.4% and 18.1%. In spite of the simplicity of the cell fabrication process, these are the highest independently confirmed efficiencies ever reported for bifacial silicon solar cells.

  1. Determination of effective resonance energy for the 193Ir(n,γ)194Ir reaction by the cadmium ratio method

    Science.gov (United States)

    Budak, Mustafa Guray; Karadag, Mustafa; Yücel, Haluk

    2016-04-01

    In this work, the effective resonance energy, Ebarr -value for the 193Ir(n,γ)194Ir reaction was measured using cadmium ratio method. A dual monitor (197Au-98Mo), which has convenient resonance properties, was employed for characterization of the irradiation sites. Then analytical grade iridium oxide samples diluted with CaCO3 to lower neutron self-shielding effect stacked in small cylindrical Teflon boxes were irradiated once with a 1 mm thick Cd cylindrical box placed in a thermalized neutron field of an 241Am-Be neutron source then without it. The activities produced in samples during 193Ir(n,γ)194Ir reaction were measured using a p-type HPGe detector γ-ray spectrometer with a 44.8% relative efficiency. The correction factors for thermal, epithermal neutron self-shielding (Gth, Gepi), true coincidence summing (Fcoi) and gamma-ray self-absorption (Fs) effects were determined with appropriate approaches and programs. Thus, the experimental Ebarr -value was determined to be 2.65 ± 0.61 eV for 193Ir target nuclide. The recent data for Q0 and FCd values for Ebarr determination were based on k0-NAA online database. The present experimental Ebarr value was calculated and compared with more recent values for Q0 and FCd for 193Ir. Additionally, the Ebarr -values was theoretically calculated from the up-to-date resonance data obtained from ENDF/B VII library using two different approaches. Since there is no experimentally determined Ebarr -value for the 193Ir isotope, the results are compared with the calculated ones given in the literature.

  2. A Clinical Analysis of 194 Cases of Diffuse Large B-cell Lymphoma%弥漫大B细胞淋巴瘤194例临床分析

    Institute of Scientific and Technical Information of China (English)

    敬小梅; 吴萍; 李力; 熊竹娟; 任苑蓉; 魏雯; 张智慧

    2015-01-01

    Objective:To analyze the clinical chracteristics,therapeutic approach of diffuse large B-cell lymphoma (DLBCL),and to explore the influence factors on the therapeutic effect and prognosis of DLBCL.Methods:A total of 194 DLBCL patients treated in Sichuan Cancer Hospital from 2009 to 2014 were selected,the general clinical characteristics were analyzed to determine the relationship of relevant factors with therapeutic effect and prognosis.The patients were trea-ted with chemotherapy or chemoradiotherapy.The chemotherapy regimens included CHOP and R-CHOP.Results:The me-dian age of the 194 patients was 53 years.The ratio of male:female was 1.66:1.Among 184 patients who accepted treat-ment,68 cases(37.0%)got complete remission (CR)and 72 cases(39.1%)got partial remission (PR)after treatment with an effective rate of 76.1% in all.Univariate analysis showed that the complications of patients、extranodal involve-ment、the serum level of LDH、B symptom、bulky disease、the level of hemoglobin、the clinical stage and cell origins were im-portant influence factors for curative effect.The extranodal involvement、bulky disease and the clinical stage had significant influence on the survival rate of patients (P <0.05).In Cox multivariable analysis,the clinical factors including clinical stage and bulky disease were independent predicting factors for overall survival(OS)(P <0.05).R-CHOP can extend the OS of patients remarkably(P <0.05).Conclusion:DLBCL commonly occurs in male patients at middle ages.The clinical stage and bulky disease are independent factors for the OS of DLBCL.R-CHOP may be the best effective approach for treat-ment of this disease.%目的:分析弥漫大 B 细胞淋巴瘤(DLBCL)的临床特征和治疗方法,探讨 DLBCL 的疗效及预后影响因素。方法:对我院2009~2014年收治的194例 DLBCL 的临床资料进行回顾性分析,以确定相关因素与疗效及预后的关系。治疗方法包括单纯化疗及

  3. 产后早期盆底功能恢复情况194例分析%Analysis of early pelvic function recovery condition after delivery in 194 puerperae

    Institute of Scientific and Technical Information of China (English)

    折瑞莲; 魏晓萍; 汪杨; 苏放明

    2011-01-01

    Objective To discuss the situation and feature of early pelvic function recovery after delivery. Methods One hundred and ninety-four puerperae after delivery 6 - 8 weeks who outpatients in department of obsietrics from 2010 october to november and inpatient delivery in department of obstetrics in Shenzhen People's Hospital were selected , pelvic function was checked by the specialist,including conventional gynaecological check-up,pelvic floor muscle strength assessment by hand and pelvic organ prolapsed quantitative score, the urine mat experiment made for had history of urinary leakage person. Results Among the 194 puerperae,146 puerperae ( 75.26% ) had pelvic organ prolapse,42 puerperae (21.65% ) had postpartum stress urinary incontinence. All the patients who had pelvic organ prolapse suffered from anterior vaginal wall prolapse , in which 66.44% (97/146) were of grade Ⅰ ,33.56% (49/146) were of grade Ⅱ . Anterior vaginal wall prolapse combined with pos terior vaginal wall prolapse accounted for 4.79% ( 7/146) , all were grade Ⅰ ;Anterior vaginal prolapse combined with uterine prolapse accounted for 11.64% ( 17/146) , all were grade Ⅰ . One puerperae ( 0.68% ) had anterior vaginal wall prolapse combined with posterior vaginal wall prolapse and uterine prolapse,for Ⅰ degree of prolapse. Conclusion The incidence of female pelvic floor dysfunction is high on the early postpartum,especially anterior vaginal wall prolapse and stress urinary in continence. Luckily,most of them are mild. Therefore,emphasis should be put on pelvic floor reeducation on the early postpar tum , in order to improve quality of their lives.%目的 探讨女性产后早期盆底功能恢复的情况及特点.方法 选择在深圳市人民医院产科住院分娩,且于2010年10月至11月在产科门诊就诊的产后6~8周产妇194例,由专人负责行盆底功能检查,包括常规妇科检查、手测盆底肌力评定及盆腔器官脱垂定量评分,有漏尿

  4. Quantitative assessment of the association between XRCC1 Arg399Gln and Arg194Trp polymorphisms and risk of cutaneous melanoma.

    Science.gov (United States)

    Jiang, Huayong; Xu, Weidong; Zhang, Fuli; Wei, Li; Wang, Yajie; Wang, Yadi; Liu, Chuan

    2016-06-01

    Accumulating evidence has suggested that the XRCC1 Arg399Gln and Arg194Trp polymorphisms might be related to cutaneous melanoma susceptibility. However, epidemiologic findings have been inconsistent. We have assessed reported studies by meta-analysis to perform a more precise estimation of the association between the XRCC1 two polymorphisms (Arg399Gln, Arg194Trp) and risk of cutaneous melanoma. A total of seven eligible articles were selected for this meta-analysis, including 3454 cases and 3811 controls for the XRCC1 Arg399Gln polymorphism and 1256 cases and 1575 controls for the XRCC1 Arg194Trp polymorphism. Overall, no significant associations were found in all genetic models when the studies were pooled into the meta-analysis for the Arg399Gln and Arg194Trp polymorphisms. When stratified by source of control, significant associations were found for the Arg399Gln polymorphism in the population-based subgroup under AA versus GG [odds ratio (OR)=1.43, 95% confidence interval (CI)=1.08-1.88]; the dominant model AA/GA versus GG (OR=1.25, 95% CI=1.04-1.51); and the recessive model AA versus GA/GG (OR=1.31, 95% CI=1.01-1.68). No significant associations were found for the Arg194Trp polymorphism in the subgroup analysis. This meta-analysis suggested that the XRCC1 Arg399Gln polymorphism was a risk factor for cutaneous melanoma in population-based subgroup. PMID:26967970

  5. Astatination of closo-dodecaborate(2-) anion

    Czech Academy of Sciences Publication Activity Database

    Orlova, A.; Lebeda, Ondřej; Tolmachev, V.; Lundquist, H.; Carlsson, J.; Sjöberg, S.

    Cambridge : The Royal Society of Chemistry , 2000 - (Davidson, M.; Hughes, A.; Marder, T.; Wade , K.), s. 144-147 [Conference "Contemporary Boron Chemistry ". Durham (GB), 11.07.1999-15.07.1999] Institutional research plan: CEZ:AV0Z1048901 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  6. Radio monitoring of the hard state jets in the 2011 outburst of MAXI J1836-194

    CERN Document Server

    Russell, T D; Curran, P A; Soria, R; Altamirano, D; Corbel, S; Coriat, M; Moin, A; Russell, D M; Sivakoff, G R; Slaven-Blair, T J; Belloni, T M; Fender, R P; Heinz, S; Jonker, P G; Krimm, H A; Kording, E G; Maitra, D; Markoff, S; Middleton, M; Migliari, S; Remillard, R A; Rupen, M P; Sarazin, C L; Tetarenko, A J; Torres, M A P; Tudose, V; Tzioumis, A K

    2015-01-01

    MAXI J1836-194 is a Galactic black hole candidate X-ray binary that was discovered in 2011 when it went into outburst. In this paper, we present the full radio monitoring of this system during its `failed' outburst, in which the source did not complete a full set of state changes, only transitioning as far as the hard intermediate state. Observations with the Karl G. Jansky Very Large Array (VLA) and Australia Telescope Compact Array (ATCA) show that the jet properties changed significantly during the outburst. The VLA observations detected linearly polarised emission at a level of ~1% early in the outburst, increasing to ~3% as the outburst peaked. High-resolution images with the Very Long Baseline Array (VLBA) show a ~15 mas jet along the position angle $-21 \\pm 2^\\circ$, in agreement with the electric vector position angle found from our polarisation results ($-21 \\pm 4^\\circ$), implying that the magnetic field is perpendicular to the jet. Astrometric observations suggest that the system required an asymme...

  7. The accretion-ejection coupling in the black hole candidate X-ray binary MAXI J1836-194

    CERN Document Server

    Russell, T D; Miller-Jones, J C A; Curran, P A; Markoff, S; Russell, D M; Sivakoff, G R

    2013-01-01

    We present the results of our quasi-simultaneous radio, sub-mm, infrared, optical and X-ray study of the Galactic black hole candidate X-ray binary MAXI J1836-194 during its 2011 outburst. We consider the full multi-wavelength spectral evolution of the outburst, investigating whether the evolution of the jet spectral break (the transition between optically-thick and optically-thin synchrotron emission) is caused by any specific properties of the accretion flow. Our observations show that the break does not scale with the X-ray luminosity or with the inner radius of the accretion disk, and is instead likely to be set by much more complex processes. We find that the radius of the acceleration zone at the base of the jet decreases from ~10$^6$ gravitational radii during the hard intermediate state to ~10$^3$ gravitational radii as the outburst fades (assuming a black hole mass of 8 M$_{\\odot}$), demonstrating that the electrons are accelerated on much larger scales than the radius of the inner accretion disk and...

  8. M1 transitions between superdeformed states in {sup 194,195}Tl: The fingerprint of the i{sub 13/2} proton intruder orbital

    Energy Technology Data Exchange (ETDEWEB)

    Azaiez, F.; Duprat, J.; Sharpey-Schafer, J.F.; Aiche, M.; Bastin, G.; Beausang, C.W.; Bourgeois, C.; Clark, R.M.; Deloncle, I.; Duffait, R.; Gale, S.J.; Gall, B.; Hannachi, F.; Hibbert, I.; Joyce, M.J.; Kaci, A.; Kelly, W.H.; Korichi, A.; Le Coz, Y.; Meyer, M.; Perrin, N.; Poffe, N.; Porquet, M.G.; Redon, N.; Sergolle, H.; Schuck, C.; Simpson, J.; Wadsworth, R. [Inst. de Physique Nucleaire, 91 Orsay (France)]|[Oliver Lodge Lab., Univ. of Liverpool (United Kingdom)]|[C.S.N.S.M., IN2P3-CNRS, 91 Orsay (France)]|[Nuclear Structure Facility, Daresbury Lab., Daresbury, Warrington (United Kingdom)]|[Inst. de Physique Nucleaire de Lyon, IN2P3-CNRS, Univ. Claude Bernard, 69 Villeurbanne (France)]|[Dept. of Physics, Univ. of York (United Kingdom)]|[Iowa State Univ., Ames, IA (United States)]|[Univ. of Oxford, Dept. of Physics (United Kingdom)

    1995-12-31

    Recent data from the EUROGAM array have revealed dipole transitions linking signature partner superdeformed bands in {sup 194}Tl and {sup 195}Tl nuclei. Measurements of the decay branching ratios, taken together with the average quadrupole moment of the neighboring superdeformed nuclei, enable the absolute M1 strengths to be determined. From these data and using the strong coupling model, we find that two SD bands in {sup 195}Tl are due to the 81st proton being in the [642]5/2{sup +} orbital and four from the six SD bands in {sup 194}Tl correspond to a configuration where the intrinsic spins of the single proton and single neutron are aligned. (orig.).

  9. 78 FR 19985 - Modification of VOR Federal Airways V-68, V-76, V-194, and V-548 in the Vicinity of Houston, TX

    Science.gov (United States)

    2013-04-03

    ... published in FAA Order 7400.9W (77 FR 50907, August 23, 2012), the FAA is amending the V-68, V-76, V-194... Transportation (DOT) Regulatory Policies and Procedures (44 FR 11034; February 26, 1979); and (3) does not... follows: Authority: 49 U.S.C. 106(g), 40103, 40113, 40120; E.O. 10854, 24 FR 9565, 3 CFR, 1959-1963...

  10. Synergetic Integration of Cu1.94S-ZnxCd1-xS Heteronanorods for Enhanced Visible-Light-Driven Photocatalytic Hydrogen Production.

    Science.gov (United States)

    Chen, Yueguang; Zhao, Shu; Wang, Xian; Peng, Qing; Lin, Rui; Wang, Yu; Shen, Rongan; Cao, Xing; Zhang, Libo; Zhou, Gang; Li, Jun; Xia, Andong; Li, Yadong

    2016-04-01

    In this Communication, we present the integration of synergetic designs into high-quality, well-defined Cu1.94S-ZnxCd1-xS heteronanorods (0 ≤ x ≤ 1) for enhanced photocatalytic hydrogen evolution. These heteronanorods possess two light absorbers, intimate heterointerfaces, tunable band gaps over a wide range, and uniform one-dimensional morphology. As verified by experimental and density functional theory studies, these heteronanorods with continuous composition adjustment fully exploit the benefits of both interfacial charge separation and optimized band alignments. Even without any cocatalysts, Cu1.94S-Zn0.23Cd0.77S heteronanorods exhibit efficient hydrogen production activity (7735 μmol h(-1) g(-1)) under visible-light irradiation (λ > 420 nm), representing a 59-fold enhancement compared with the pristine CdS catalyst. Meanwhile, deposition of a Pt cocatalyst on the Cu1.94S-ZnxCd1-xS surface substantially enhances the hydrogen production performance (13 533 μmol h(-1) g(-1)) with an apparent quantum efficiency of 26.4% at 420 nm, opening up opportunities to promote the overall photocatalytic performance using rationally designed nanostructures. PMID:26998730

  11. Radio monitoring of the hard state jets in the 2011 outburst of MAXI J1836-194

    Science.gov (United States)

    Russell, T. D.; Miller-Jones, J. C. A.; Curran, P. A.; Soria, R.; Altamirano, D.; Corbel, S.; Coriat, M.; Moin, A.; Russell, D. M.; Sivakoff, G. R.; Slaven-Blair, T. J.; Belloni, T. M.; Fender, R. P.; Heinz, S.; Jonker, P. G.; Krimm, H. A.; Körding, E. G.; Maitra, D.; Markoff, S.; Middleton, M.; Migliari, S.; Remillard, R. A.; Rupen, M. P.; Sarazin, C. L.; Tetarenko, A. J.; Torres, M. A. P.; Tudose, V.; Tzioumis, A. K.

    2015-06-01

    MAXI J1836-194 is a Galactic black hole candidate X-ray binary that was discovered in 2011 when it went into outburst. In this paper, we present the full radio monitoring of this system during its `failed' outburst, in which the source did not complete a full set of state changes, only transitioning as far as the hard intermediate state. Observations with the Karl G. Jansky Very Large Array (VLA) and Australia Telescope Compact Array (ATCA) show that the jet properties changed significantly during the outburst. The VLA observations detected linearly polarized emission at a level of ˜1 per cent early in the outburst, increasing to ˜3 per cent as the outburst peaked. High-resolution images with the Very Long Baseline Array (VLBA) show an ˜15 mas jet along the position angle -21 ± 2°, in agreement with the electric vector position angle found from our polarization results (-21 ± 4°), implying that the magnetic field is perpendicular to the jet. Astrometric observations suggest that the system required an asymmetric natal kick to explain its observed space velocity. Comparing quasi-simultaneous X-ray monitoring with the 5 GHz VLA observations from the 2011 outburst shows an unusually steep hard-state radio/X-ray correlation of L_R ∝ L_X^{1.8± 0.2}, where LR and LX denote the radio and X-ray luminosities, respectively. With ATCA and Swift monitoring of the source during a period of re-brightening in 2012, we show that the system lay on the same steep correlation. Due to the low inclination of this system, we then investigate the possibility that the observed correlation may have been steepened by variable Doppler boosting.

  12. AN EVOLVING COMPACT JET IN THE BLACK HOLE X-RAY BINARY MAXI J1836–194

    International Nuclear Information System (INIS)

    We report striking changes in the broadband spectrum of the compact jet of the black hole transient MAXI J1836–194 over state transitions during its discovery outburst in 2011. A fading of the optical-infrared (IR) flux occurred as the source entered the hard-intermediate state, followed by a brightening as it returned to the hard state. The optical-IR spectrum was consistent with a power law from optically thin synchrotron emission, except when the X-ray spectrum was softest. By fitting the radio to optical spectra with a broken power law, we constrain the frequency and flux of the optically thick/thin break in the jet synchrotron spectrum. The break gradually shifted to higher frequencies as the source hardened at X-ray energies, from ∼1011 to ∼4 × 1013 Hz. The radiative jet luminosity integrated over the spectrum appeared to be greatest when the source entered the hard state during the outburst decay (although this is dependent on the high-energy cooling break, which is not seen directly), even though the radio flux was fading at the time. The physical process responsible for suppressing and reactivating the jet (neither of which are instantaneous but occur on timescales of weeks) is uncertain, but could arise from the varying inner accretion disk radius regulating the fraction of accreting matter that is channeled into the jet. This provides an unprecedented insight into the connection between inflow and outflow, and has implications for the conditions required for jets to be produced, and hence their launching process.

  13. Search for signatures of the supersymmetry in 193Pt and mixed-symmetric states in 194Pt by means of γ spectroscopy

    International Nuclear Information System (INIS)

    After the general renovation of the experimental halls at the Institute for Nuclear Physics in Cologne, the HORUS-Spectrometer was rebuilt within the scope of this thesis. Following this, two experiments were performed to conduct a γγ-angular correlation analysis. The nuclei 194Pt and 193Pt were measured to complete existing data and the results are presented in this thesis. Both nuclei were measured in β-decay experiments. The mother nuclei were produced in fusion evaporation reactions. In case of 194Pt 10 spins were determined experimentally for the first time. 57 multipole mixing ratios were determined. For the nucleus 193Pt three spins were measured for the first time. After the general renovation a new data acquisition system was set up for experimental measurements. During the measurement of 194Pt two data acquisitions were used, the ''old'' analog data acquistion and the ''new'' digital data acquisition. A short comparison of those two data acquistion systems for nuclear-physical measurements are shown in this thesis. The aim is to measure permanently with the new digital data acquistion. In the region of the gold and platin isotopes there exist even-even nuclei, which can be described via the Interacting-Boson-Model (IBM) and Interacting-Boson-Model-2 (IBM-2). Odd-A nuclei can be illustrated with the Interacting-Boson-Fermion-Model (IBFM). An application of the IBFM is the Uν(6/12) x Uπ(6/4) supersymmetry, consisting of the nuclei that are described by the same Hamiltonian and one set of parameters. To test predictions of 194Pt and 193Pt, multipole-mixing-ratios of γ-transitions and spins were determined. The IBM describes the complex structure of a nucleus in a very simplified way. Very good fits of 194Pt and 193Pt in the O(6)-Limits of the IBM could be made. In addition fits of the even-even platin isotopes are shown to discuss the systematics of the platin isotopes.

  14. 194例甲基苯丙胺滥用者卡特尔16项人格特征分析%194 cases of methamphetamine abusers Cattell 16 Personality Characteristics

    Institute of Scientific and Technical Information of China (English)

    吴幼华; 沈慧丽; 苏俊义

    2014-01-01

    目的:探讨甲基苯丙胺(“冰毒”)滥用人员的人格特征。方法:使用卡特尔16项人格因素问卷(16PF),对194例冰毒滥用人员进行测查。结果:被调查者男性居多,为134例(69.07%)。平均年龄34.1a ± s7.5a。以初中文化程度为主,共149例(76.80%)。职业以无业者居多,为178例(91.75%)。滥用的毒品以冰毒为主,但该群体中还有部分人员滥用其他毒品,如海洛因,氯胺酮(“K 粉”)等。滥用冰毒人员在乐群性,聪慧性,恃强性,兴奋性,敢为性,敏感性,怀疑性,幻想性,世故性,忧虑性,独立性和紧张性等均显著低于中国常模,而有恒性和实验性则显著高于常模。男性滥用者在乐群性,敏感性,独立性和自律性等均显著低于女性滥用者。结论:冰毒滥用人员有其特异的人格特征,其人格明显偏离正常,男女之间存在差异。在对该人群进行脱毒治疗,管理教育,心理康复时,应充分考虑到其特异的人格特征,做到有的放矢,加强沟通和交流,做好健康教育和心理辅导,提高该群体对药物滥用的阈值,防止或减少吸毒行为的反复发生,降低复吸率。%Objective:To investigate methamphetamine(“ ice”)abuse personality traits personnel. Methods:Questionnaire Cattell 16 Personality Factor(16PF)on 194 cases of methamphetamine abuse testing personnel investigation. Results:Respondents males for 134 cases(69. 07% ). The average age 34. 1a ± s7. 5a. In junior high school education based,total 149 cases(76. 80% ). Career mostly with unemployed for 178 cases(91. 75% ). Drug abuse in methamphetamine-based,but there are some people in the population abuse other drugs,such as heroin,ketamine(“K powder”)and so on. Methamphetamine abuse in gregarious person, intelligence,aggressiveness

  15. Application of artificial neural networks for the prediction of lymph node metastases to the ipsilateral axilla - initial experience in 194 patients using magnetic resonance mammography

    International Nuclear Information System (INIS)

    Background: In breast MRI (bMRI), prediction of lymph node metastases (N+) on the basis of dynamic and morphologic descriptors of breast cancers remains a complex task. Purpose: To predict N+ using an artificial neural network (ANN) on the basis of 17 previously published descriptors of breast lesions in bMRI. Material and Methods: Standardized protocol and study design were applied in this study (T1w-FLASH; 0.1 mmol/kg body weight Gd-DTPA; T2w-TSE; histological verification after bMRI). All lesions were evaluated by two experienced radiologists in consensus. In every lesion 17 previously published descriptors were assessed. Matched subgroups with (N+; n=97) and without N+ were created (N-; n=97), forming the dataset of this study (n=194). An ANN was constructed ('Multilayer Perceptron'; training: 'Batch'; activation function of hidden/output layer: 'Hyperbolic Tangent'/'Softmax') to predict N+ using all descriptors in combination on a randomly chosen training sample (n=123/194) and optimized on the corresponding test sample (n=71/194) using dedicated software. The discrimination power of this ANN was quantified by area under the curve (AUC) comparison (vs AUC=0.5). Training and testing cycles were repeated 20 times to quantify the robustness of the ANN (median-AUC; confidence intervals, CIs). Results: The ANN demonstrated highly significant discrimination power to classify N+ vs N- (P<0.001). Diagnostic accuracy reached 'moderate' AUC (median-AUC=0.74; CI 0.70-0.76). Conclusion: Application of ANNs for the prediction of lymph node metastases in breast MRI is feasible. Future studies should evaluate the clinical impact of the presented model

  16. Study of muon pair production in 194 GeV/c π--tungsten collisions. Deviation of Drell-Yan model

    International Nuclear Information System (INIS)

    The results of an experiment of muon pair production in π--nucleon interactions on tungsten target at 194 GeV/c are presented. This experiment is realized at the CERN laboratories with a very strong (>109π-/sec) pion beam, with a good acceptance and a good resolution in mass of muon pairs. The production cross section deviate of the Drell-Yan model. The leading logarithm approximation of QCD describe more closely the differential behaviour of the cross section but with little deviations in rapidity distribution by mass intervals. These deviations can be traducing the contribution of the multiple soft gluon emission

  17. VLBI FOR GRAVITY PROBE B. II. MONITORING OF THE STRUCTURE OF THE REFERENCE SOURCES 3C 454.3, B2250+194, AND B2252+172

    International Nuclear Information System (INIS)

    We used 8.4 GHz very long baseline interferometry images obtained at up to 35 epochs between 1997 and 2005 to examine the radio structures of the main reference source, 3C 454.3, and two secondary reference sources, B2250+194 and B2252+172, for the guide star for the NASA/Stanford relativity mission Gravity Probe B (GP-B). For one epoch in 2004 May, we also obtained images at 5.0 and 15.4 GHz. The 35 8.4 GHz images for quasar 3C 454.3 confirm a complex, evolving, core-jet structure. We identified at each epoch a component, C1, near the easternmost edge of the core region. Simulations of the core region showed that C1 is located, on average, 0.18 ± 0.06 mas west of the unresolved 'core' identified in 43 GHz images. We also identified in 3C 454.3 at 8.4 GHz several additional components that moved away from C1 with proper motions ranging in magnitude between 0.9 c and 5 c. The detailed motions of the components exhibit two distinct bends in the jet axis located ∼3 and ∼5.5 mas west of C1. The spectra between 5.0 and 15.4 GHz for the 'moving' components are steeper than those for C1. The 8.4 GHz images of B2250+194 and B2252+172, in contrast to those of 3C 454.3, reveal compact structures. The spectrum between 5.0 and 15.4 GHz for B2250+194 is inverted while that for B2252+172 is flat. Based on its position near the easternmost edge of the 8.4 GHz radio structure, close spatial association with the 43 GHz core, and relatively flat spectrum, we believe 3C 454.3 component C1 to be the best choice for the ultimate reference point for the GP-B guide star. The compact structures and inverted-to-flat spectra of B2250+194 and B2252+172 make these objects valuable secondary reference sources.

  18. Detection of moisture and moisture related phenomena from Skylab. [correlation of S-194 antenna temperature and soil moisture content measurements for Kansas and Texas

    Science.gov (United States)

    Eagleman, J. R.; Pogge, E. C.; Moore, R. K. (Principal Investigator); Hardy, N.; Lin, W.; League, L.

    1973-01-01

    The author has identified the following significant results. Correlations between the S-194 antenna temperature and soil moisture have been obtained for three sets of data; one for Skylab 2 and two for Skylab 3. The best correlations were obtained for the surface to one inch depth in two cases and for the surface to two inches for the third case. Correlation coefficients for the surface to one inch depth were -0.98, -0.95, and -0.82. The lowest correlation coefficient was obtained with total soil moisture variations less than 4% across the test site.

  19. Search for signatures of the supersymmetry in {sup 193}Pt and mixed-symmetric states in {sup 194}Pt by means of γ spectroscopy; Suche nach Signaturen der Supersymmetrie in {sup 193}Pt und gemischt-symmetrischer Zustaende in {sup 194}Pt mittels γ-Spektroskopie

    Energy Technology Data Exchange (ETDEWEB)

    Friessner, Gunnar

    2013-10-14

    After the general renovation of the experimental halls at the Institute for Nuclear Physics in Cologne, the HORUS-Spectrometer was rebuilt within the scope of this thesis. Following this, two experiments were performed to conduct a γγ-angular correlation analysis. The nuclei {sup 194}Pt and {sup 193}Pt were measured to complete existing data and the results are presented in this thesis. Both nuclei were measured in β-decay experiments. The mother nuclei were produced in fusion evaporation reactions. In case of {sup 194}Pt 10 spins were determined experimentally for the first time. 57 multipole mixing ratios were determined. For the nucleus {sup 193}Pt three spins were measured for the first time. After the general renovation a new data acquisition system was set up for experimental measurements. During the measurement of {sup 194}Pt two data acquisitions were used, the ''old'' analog data acquistion and the ''new'' digital data acquisition. A short comparison of those two data acquistion systems for nuclear-physical measurements are shown in this thesis. The aim is to measure permanently with the new digital data acquistion. In the region of the gold and platin isotopes there exist even-even nuclei, which can be described via the Interacting-Boson-Model (IBM) and Interacting-Boson-Model-2 (IBM-2). Odd-A nuclei can be illustrated with the Interacting-Boson-Fermion-Model (IBFM). An application of the IBFM is the U{sub ν}(6/12) x U{sub π}(6/4) supersymmetry, consisting of the nuclei that are described by the same Hamiltonian and one set of parameters. To test predictions of {sup 194}Pt and {sup 193}Pt, multipole-mixing-ratios of γ-transitions and spins were determined. The IBM describes the complex structure of a nucleus in a very simplified way. Very good fits of {sup 194}Pt and {sup 193}Pt in the O(6)-Limits of the IBM could be made. In addition fits of the even-even platin isotopes are shown to discuss the systematics

  20. Sequence of pNL194, a 79.3-Kilobase IncN Plasmid Carrying the blaVIM-1 Metallo-β-Lactamase Gene in Klebsiella pneumoniae▿

    Science.gov (United States)

    Miriagou, V.; Papagiannitsis, C. C.; Kotsakis, S. D.; Loli, A.; Tzelepi, E.; Legakis, N. J.; Tzouvelekis, L. S.

    2010-01-01

    The nucleotide sequence of pNL194, a VIM-1-encoding plasmid, is described in this study. pNL194 (79,307 bp) comprised an IncN-characteristic segment (38,940 bp) and a mosaic structure (40,367 bp) including blaVIM-1, aacA7, aadA1, aadA2, dfrA1, dfrA12, aphA1, strA, strB, and sul1. Tn1000 or Tn5501 insertion within fipA probably facilitated recruitment of additional mobile elements carrying resistance genes. PMID:20660690

  1. Sequence of pNL194, a 79.3-kilobase IncN plasmid carrying the blaVIM-1 metallo-beta-lactamase gene in Klebsiella pneumoniae.

    Science.gov (United States)

    Miriagou, V; Papagiannitsis, C C; Kotsakis, S D; Loli, A; Tzelepi, E; Legakis, N J; Tzouvelekis, L S

    2010-10-01

    The nucleotide sequence of pNL194, a VIM-1-encoding plasmid, is described in this study. pNL194 (79,307 bp) comprised an IncN-characteristic segment (38,940 bp) and a mosaic structure (40,367 bp) including bla(VIM-1), aacA7, aadA1, aadA2, dfrA1, dfrA12, aphA1, strA, strB, and sul1. Tn1000 or Tn5501 insertion within fipA probably facilitated recruitment of additional mobile elements carrying resistance genes. PMID:20660690

  2. Sequence of pNL194, a 79.3-Kilobase IncN Plasmid Carrying the blaVIM-1 Metallo-β-Lactamase Gene in Klebsiella pneumoniae▿

    OpenAIRE

    Miriagou, V.; Papagiannitsis, C. C.; Kotsakis, S. D.; Loli, A; Tzelepi, E.; Legakis, N. J.; Tzouvelekis, L. S.

    2010-01-01

    The nucleotide sequence of pNL194, a VIM-1-encoding plasmid, is described in this study. pNL194 (79,307 bp) comprised an IncN-characteristic segment (38,940 bp) and a mosaic structure (40,367 bp) including blaVIM-1, aacA7, aadA1, aadA2, dfrA1, dfrA12, aphA1, strA, strB, and sul1. Tn1000 or Tn5501 insertion within fipA probably facilitated recruitment of additional mobile elements carrying resistance genes.

  3. Description of E4 Transitions in A = 192, 194,196, 198 Platinum Isotopes in a Microscopic sdgIBM- 1

    Institute of Scientific and Technical Information of China (English)

    ZHANG ZhanJun; YANG Jie; WANG Xin; LIU Yong

    2001-01-01

    Influence of the effective fermion hexadecapole force newly incorporated in a microscopic sdgIBM-1 on spectra, reduced E2 and E4 transition matrix elements (T(E2)s and T(E4)s) in the even-even platinum isotopes (A = 192,194,196,198) is investigated in terms of numerical calculations. It is found that the introduced interaction causes only limited modification to the spectrum and T(E2)s, apart from a few exceptions. However, it plays an essential role in describing E4 transitions. Thus in the case that the interaction is incorporated with certain strength, a reasonable description of all the E4 transitions in the platinum isotopes is reached in the microscopic sdgIBM-1 in comparing both to experimental data and the results calculated in phenomenological boson model.``

  4. Molecular Desorption of a NEG St 707 Irradiated at Room Temperature with Synchrotron Radiation of 194 eV Critical Photon Energy

    CERN Document Server

    Le Pimpec, F; Laurent, Jean Michel

    2002-01-01

    Photon stimulated molecular desorption from a NEG St 707 (SAES Getters$^{TM}$) surface after conditioning and after saturation with isotopic carbon monoxide, 13C18O, has been studied on a dedicated beam line at the EPA ring at CERN. The synchrotron radiation of 194 eV critical energy and with an average photon intensity of ~1 10**17 photons.s**-1 was impinging on the sample at perpendicular incidence. It is found that the desorption yields h molecules/photon) of the characteristic gases in an UHV system (hydrogen, methane, carbon monoxide and carbon dioxide) for a freshly activated NEG and for a NEG fully saturated with 13C18O are lower than that of 300 C baked stainless steel.

  5. Evidenced Formal Coverage Index and universal healthcare enactment: A prospective longitudinal study of economic, social, and political predictors of 194 countries.

    Science.gov (United States)

    Feigl, Andrea B; Ding, Eric L

    2013-11-01

    Determinants of universal healthcare (UHC) are poorly empirically understood. We undertook a comprehensive study of UHC development using a novel Evidenced Formal Coverage (EFC) index that combines three key UHC elements: legal framework, population coverage, and accessibility. Applying the EFC index measures (legislation, ≥90% skilled birth attendance, ≥85% formal coverage) to 194 countries, aggregating time-varying data from 1880-2008, this study investigates which macro-economic, political, and social indicators are major longitudinal predictors of developing EFC globally, and in middle-income countries. Overall, 75 of 194 countries implemented legal-text UHC legislation, of which 51 achieved EFC. In a country-year prospective longitudinal analysis of EFC prediction, higher GDP-per-capita (per GDP-per-capita doubling, relative risk [RR]=1.77, 95% CI: 1.49-2.10), higher primary school completion (per +20% completion, RR=2.30, 1.65-3.21), and higher adult literacy were significantly associated with achieving EFC. Results also identify a GDP-per-capita of I$5000 as a minimum level for development of EFC. GDP-per-capita and education were each robust predictors in middle-income countries, and education remained significant even controlling for time-varying GDP growth. For income-inequality, the GINI coefficient was suggestive in its role in predicting EFC (p=0.024). For social and political indicators, a greater degree of ethnic fractionalization (per +25%, RR=0.51, 0.38-0.70), proportional electoral system (RR=2.80, 1.22-6.40), and dictatorships (RR=0.10, 0.05-0.27) were further associated with EFC. The novel EFC index and this longitudinal prospective study together indicate that investment in both economic growth and education should be seen of equal importance for development of UHC. Our findings help in understanding the social and political drivers of universal healthcare, especially for transitioning countries. PMID:23906506

  6. Molecular desorption of a nonevaporable getter St 707 irradiated at room temperature with synchrotron radiation of 194 eV critical photon energy

    CERN Document Server

    Le Pimpec, F; Laurent, Jean Michel

    2003-01-01

    Photon stimulated molecular desorption from a nonevaporable getter (NEG) St 707(R) (SAES Getters TM ) surface after conditioning and after saturation with isotopic carbon monoxide Ýcf. nomenclature in Handbook of Chemistry and Physics, 74th edition, edited by D. R. Lide (CRC Press, Boca Raton, 1994)¿ /sup 13/C/sup 18/O, has been studied on a dedicated beamline at the EPA ring at CERN. The synchrotron radiation of 194 eV critical energy and with an average photon intensity of ~1 * 10/sup 17/ photons s/sup -1/ was impinging on the sample at perpendicular incidence. It is found that the desorption yields eta (molecules/photon) of the characteristic gases in an UHV system (hydrogen, methane, carbon monoxide, and carbon dioxide) for a freshly activated NEG and for a NEG fully saturated with /sup 13/C /sup 18/O are lower than that of 300 degrees C baked stainless steel. (22 refs). Fully activated NEG was studied and found to desorb less as compared to a 300 degree c baked stainless-steel surface. Furthermore, it ...

  7. Photometric analysis of the structure evolution on the Pb-19.4%Sn melt surface in the S-L temperature range

    Directory of Open Access Journals (Sweden)

    Lyakhovitskii M.M.

    2011-05-01

    Full Text Available The structure evolution of alloys in solidification range is considered as the first-order phase transformation from the solid state to the liquid one, which occurs by the mechanism of nucleation and growth of more symmetrical phase to less symmetrical crystalline phase. The kinetic regularities of this transformation are studied by the method of the photometric analysis of structure images (PHASI, which makes it possible to establish the temperature dependence of the relationship between the solid and liquid phases and their distribution on the melt surface. The PHASI method is based on the combined analysis of the brightness spectra of the visible light reflections from the sample surface and of the distribution of its scattering centers in different intensity intervals. The data on the structure evolution of the Sn+19.4%Pb alloy upon melting and solidification were considered in parallel with the measured spectra of sound signals. It was revealed that a distinct maximum is observed in the temperature dependence of radiation energy in the temperature range of phase transformation from the liquid into the solid state and hot crack formation occurs near the transition zone in the region of the contact of the ingot with the crucible.

  8. Ranchero Armature Test LA-19.4-CT-3: PBX-9501 Explosive with no smoothing layer. Firing point 88, 9/16/13

    Energy Technology Data Exchange (ETDEWEB)

    Glover, Brian B. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Goforth, James H. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rae, Philip John [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Dickson, Peter [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Briggs, Matthew E. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Marr-Lyon, Mark [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Hare, Steven John [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Herrera, Dennis Harold [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Watt, Robert Gregory [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rousculp, Christopher L. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-11-13

    LA-19.4-CT-3 (CT-3) was the third camera test in a series beginning in 1/11, which diagnose the performance of 6 mm thick, 6061 T-0 Al Ranchero armatures. [The test LA-43-CT-2 (CT-2) is described in LA-UR-14-21983.] The goal of CT-3 was to verify that PBX-9501, with 18 mm point spacing and no smoothing layer, could be used for Ranchero generator armatures in place of PBXN-110, which had been used in all previous Ranchero applications. CT-1 and CT-2 both had 43 cm long slapper detonator systems imbedded in the cast PBXN-110 explosive, but manufacturing a charge for a similar 9501 test was not cost effective. Instead, a single cylinder of 9501, 19.368 cm long and 15.494 cm (6.100”)in diameter, had a groove machined to accommodate a row of 11 SE-1 detonators with 18 mm point spacing along the mid-plane of the cylinder. The expansion of the armature looks like a slapper assembly along almost ½ of the circumference, and provides adequate proof of concept. Removing the smoother from PBXN-110-driven armatures increased the armature velocity from 3.1 mm/μs to 3.3 mm/μs, as seen in CT-2, and the velocity measured on CT-3 increased to 3.8 mm/μs. In addition, the camera records show that the surface of the armature is smooth enough, and free from ruptures for an expansion of greater that 2X. The advantage of using 9501 is that it precludes concerns about blow-outs seen when bubbles are left in the cast material, and gives extra velocity. The disadvantage is that the machined explosives are more expensive.

  9. The ITPA and C20orf194 Polymorphisms and Hematological Changes During Treatment With Pegylated-Interferon Plus Ribavirin in Patients With Chronic Hepatitis C

    Science.gov (United States)

    Pouryasin, Mohammad; Keshvari, Maryam; Sharafi, Heidar; Alavian, Seyed Moayed; Behnava, Bita; Alavian, Seyed Ehsan; Pouryasin, Ali

    2016-01-01

    Background: It has been found that ITPase deficiency is caused by ITPA gene polymorphisms. It was observed that ITPA polymorphisms have impact on hematological changes, including hemoglobin (Hb)-decline during treatment of chronic hepatitis C (CHC) patients with pegylated-interferon (PEG-IFN) plus ribavirin (RBV). Objectives: This study aimed to assess the effect of ITPA and C20orf194 polymorphisms on hematological changes at week 4 of treatment with PEG-IFN plus RBV in patients with CHC. Patients and Methods: In this retrospective study, 168 patients with CHC (56% HCV genotype-1 and 44% HCV genotype-3) under the treatment of PEG-IFN plus RBV were genotyped for rs1127354, rs7270101 and rs6051702 polymorphisms by the polymerase chain reaction-restriction fragment length polymorphism. Hematological changes including Hb-, platelet (Plt)- and white blood cell-decline at week 4 of the treatment were assessed. Results: In univariate analysis, rs1127354 and HCV genotypes were found to influence the Hb-decline at week 4 of the treatment. In multivariate analysis, rs1127354 CA + AA and HCV genotype-3 were found to have a great role on prevention of Hb-decline. Furthermore, rs1127354 and HCV RNA levels were found to influence the Plt-decline at week 4 of the treatment in the univariate analysis. In multivariate analysis, rs1127354 CA + AA and HCV RNA levels less than 600,000 IU/mL were found to be associated with a higher level of Plt-decline. Conclusions: In patients with CHC, who were treated with PEG-IFN plus RBV, Hb-decline was affected by rs1127354 and HCV genotypes. However, Plt-decline may be altered by rs1127354 and baseline HCV RNA levels.

  10. The composition and distribution of metal clusters in the MoFe protein from a nifZ deletion strain (DJ 194) of Azotobacter vinelandii

    Institute of Scientific and Technical Information of China (English)

    ZHOU Huina; ZHANG Chunxi; ZHAO Ying; BIAN Shaomin; REN Fei; WANG Huangping; HUANG Jufu

    2005-01-01

    Through the anaerobic chromatography on the columns of DEAE 52, Q-Sepharose and Sephacryl S-200, a nitrogenase MoFe protein (ΔnifZ Av1) was obtained from a nifZ deleted mutant of Azotobacter vinelandii (stain DJ194). The results of Western blotting after anoxic native electrophoresis and SDS-PAGE showed that ΔnifZ Av1 was similar to wild type MoFe protein (OP Av1) at the electrophoretic mobility, molecular weight and subunit composition. Furthermore, ΔnifZ Av1 was also similar to OP Av1 at the molybdenum content, EPR signal (g≈4.3, 3.65 and 2.01), and the molar extinction coefficient (Δε) of circular dichroism (CD) at 660 nm region. All of these indicated that, besides having the same α2β2 composition as OP Av1, the ΔnifZ Av1 also contained equal amount of reductive FeMoco in the spin state of S=3/2 to OP Av1. However, the iron content and substrate (C2H2, H+ and N2)-reduction activity of ΔnifZ Av1 were 74% and 46%―50% of those of OP Av1, respectively. Furthermore, the Δε at around 450 nm, which reflects P-cluster in Av1, was obviously lower than that of OP Av1. It suggested that the difference between ΔnifZ Av1 and OP Av1 resulted from P-cluster rather than FeMoco, and from the half number of P-cluster in ΔnifZ Av1, but the composition or redox state of P-cluster in ΔnifZ Av1 were not changed. Thus it could propose that ΔnifZ Av1 is composed of two different αβ subunit pairs. One is a FeMoco- and P-cluster-containing pair, and the other is a P-cluster-deficient but FeMoco-con- taining pair. Since the deletion of nifZ gene leads to the deficiency of only one of two P-clusters in a α2β2 tetramer, the assembly of P-cluster may not simply depend on one gene product, and so a possible mechanism of NifZ is supposed here.

  11. Process for producing astatine-211 for radiopharmaceutical use

    International Nuclear Information System (INIS)

    A one-step chemical manipulation is described in combination with a distillation and collection process for producing At-211 comprising; a. providing a target of irradiated Bismuth coated to a predetermined thickness of a backing member, b. providing a vapor-producing still operably connected with a condenser that has a water cooled condensate collector formed of a dry silica gel mesh maintained at a temperature above the freezing point of water, and providing an effluent gas filter that is operably connected to receive effluent gas from the condenser, c. heating the target in the still at a temperature in the range of about 6300-6800C for a time period in the range of 50 to 80 minutes, to evole At-211 vapor from the target, c. providing a dry carrier gas having an oxygen concentration that is sufficient to form Bi/sub 2/O/sub 3/ thereby to essentially preclude vaporization of Bi metal, passing the carrier gas through the still to carry the At-211 vapor to the condenser, and to carry effluent from the condenser to the effluent gas filter, e. eluting At-211 from the condensate collector of the condenser with a controlled volume of eluent containing predetermined solvents that are compatible with a given desired radiopharmaceutical procedure, and f. collecting the At-211 in the controlled volume of eluent for use in the given radiopharmaceutical procedure

  12. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  13. Insights into the Hydrocarbon Tolerance of Two Devosia Isolates, D. chinhatensis Strain IPL18T and D. geojensis Strain BD-c194T, via Whole-Genome Sequence Analysis.

    Science.gov (United States)

    Hassan, Yousef I; Lepp, Dion; Li, Xiu-Zhen; Zhou, Ting

    2015-01-01

    Hexachlorocyclohexane (HCH) was among the most commonly used pesticides after the Second World War. The extensive use of this hydrocarbon for almost six decades has created a contamination problem on a global scale, and bioremediation methods are being extensively explored. The reported ability of some Devosia species to grow in the presence of appreciable amounts of hydrocarbons (2,000 mg/kg of contaminated soil) is attracting closer attention. Here, we report the de novo genome assembly of two hydrocarbon-tolerating Devosia isolates, D. chinhatensis strain IPL18(T) and D. geojensis strain BD-c194(T), as a first step toward understanding the metabolic pathways involved in their environmental adaptation and tolerance toward hydrocarbons. PMID:26251505

  14. „Neue Leitbilder für den Fortschritt“ (LS 194. Ein Plädoyer für die Wiederentdeckung praktischer Weisheit als neues Leitbild in der Marktwirtschaft

    Directory of Open Access Journals (Sweden)

    Claudius Bachmann

    2016-07-01

    Full Text Available In the light of the far-reaching leadership failures and business scandals of the last decades, the question has often been raised of whether we are reaping the results of the practical application of abstract management theory which is actually counteracting a socially, environmentally, and economically sustainable market economy. In this sense, Pope Francis recently called for ‘new models of progress’ to reflect on ‘the meaning of the economy and its goals’ (LS 194. To answer these calls, I first provide an overview of the recent discourse in leadership and organizational studies that have critically scrutinized the established theories and models of mainstream business. Second, I draw on the Apostolic Exhortation Evangelii Gaudium and the Encyclical Laudato Si’ to derive the cornerstones of an ‘evangelizing approach’ to the guiding principles of management theory and practice suggested by Pope Francis. Third, to facilitate this renewal, I introduce the ancient idea of practical wisdom (prudence which has recently enjoyed a remarkable renaissance in the literature and is considered as a new transformative paradigm for management theory and practice.

  15. General energy competence in the primary law of the European Union. An analysis of Article 194 of the Treaty on the Functioning of the European Union in the Lisbon version in consideration of the historical development of energy competence; Die allgemeine Energiekompetenz im Primaerrecht der Europaeischen Union. Eine Analyse des Artikels 194 des Vertrags ueber die Arbeitsweise der Europaeischen Union in der Fassung des Vertrags von Lissabon unter Beruecksichtigung der historischen Entwicklung der Energiekompetenz

    Energy Technology Data Exchange (ETDEWEB)

    Hacklaender, Daniel

    2010-07-01

    With the coming into force of the Lisbon treaty, the internal measures and policies of the European Union were supplemented by the independent title ''Energy''. While the need for supranational management of energy-political task was recognized at an early stage already, the legal instruments for this purpose were lacking. Article 194 of the Treaty on the Functioning of the European Union now provides a legal basis for a comprehensive, interdisciplinary energy policy on a European scale. The author investigates the content of the energy article. He shows that the modification of the treaty has brought about greater competences of the Union, especially in the field of energy supply assurance which is greatly influenced by the new regulations on energy solidarity. The book also discusses problems of competing legislation resulting from interdependences between the energy article on the one hand and competence standards with other goals on the other hand and also attempts to define the specific limits of energy competence. (orig.)

  16. 40 CFR 194.26 - Expert judgment.

    Science.gov (United States)

    2010-07-01

    ... CFR PART 191 DISPOSAL REGULATIONS Compliance Certification and Re-certification General Requirements...: (i) Individuals who are members of the team of investigators requesting the judgment or the team of... organizational level, a supervisory role or who are supervised by those who will utilize the judgment were...

  17. 26 CFR 1.194-3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... used in forestation or reforestation. The property must be held by the taxpayer for the growing and... qualifying reforestation expenditures incurred by such taxpayer on leased qualified timber property... which is attributable to reforestation expenditures. (c) Reforestation expenditures—(1) In general....

  18. 49 CFR 572.194 - Shoulder.

    Science.gov (United States)

    2010-10-01

    ... (drawing 180-0000). The dummy is equipped with T1 laterally oriented accelerometer as specified in 49 CFR... 49 CFR 572.200(j). (2) Seat the dummy, outfitted with the torso jacket (180-3450) and cotton... spine box incline. (8) The impactor is specified in 49 CFR 572.200(a). (9) The impactor is guided,...

  19. 46 CFR 194.10-35 - Labeling.

    Science.gov (United States)

    2010-10-01

    ... under provisions of 49 CFR 176.137 shall bear the additional statements on each side: MAGAZINE WARNING... GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS HANDLING, USE, AND... against the background. On small chests the labeling size may be reduced to that consistent with the...

  20. Evaluation of a Wet Chemistry Method for Isolation of Cyclotron Produced [211At]Astatine

    Directory of Open Access Journals (Sweden)

    Shigeki Watanabe

    2013-09-01

    Full Text Available A “wet chemistry” approach for isolation of 211At from an irradiated bismuth target is described. The approach involves five steps: (1 dissolution of bismuth target in conc. HNO3; (2 removal of the HNO3 by distillation; (3 dissolution of residue in 8 M HCl; (4 extraction of 211At from 8 M HCl into DIPE; and (5 extraction of 211At from DIPE into NaOH. Results from 55 “optimized” 211At isolation runs gave recovery yields of approximately 78% after decay and attenuation corrections. An attenuation-corrected average of 26 ± 3 mCi in the target provided isolated (actual yields of 16 ± 3 mCi of 211At. A sixth step, used for purification of 211At from trace metals, was evaluated in seven runs. In those runs, isolated 211At was distilled under reductive conditions to provide an average 71 ± 8% recovery. RadioHPLC analyses of the isolated 211At solutions, both initial and after distillation, were obtained to examine the 211At species present. The primary species of 211At present was astatide, but astatate and unidentified species were also observed. Studies to determine the effect of bismuth attenuation on 211At were conducted to estimate an attenuation factor (~1.33 for adjustment of 211At readings in the bismuth target.

  1. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  2. Astatination of nanoparticles containing silver as possible carriers of 211At

    Czech Academy of Sciences Publication Activity Database

    Lebeda, Ondřej; Kučka, Jan; Hrubý, Martin; Koňák, Čestmír; Kozempel, Ján

    2006-01-01

    Roč. 64, - (2006), s. 201-206. ISSN 0969-8043 R&D Projects: GA AV ČR KJB4048302; GA AV ČR KJB4050408 Institutional research plan: CEZ:AV0Z1048901 Keywords : nanoparticles * 211AT * Atalpha particle therapy Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.924, year: 2006

  3. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  4. Between Truth and Beauty. Symposium 194e – 201c

    Czech Academy of Sciences Publication Activity Database

    Boháček, Kryštof

    2010-01-01

    Roč. 2, International Issue 1 (2010), s. 173-195. ISSN 1803-7860 Institutional support: RVO:67985955 Keywords : Plato * Symposium * Gorgias * Agathon * tragic thought * rhetoric * philosophy of power Subject RIV: AA - Philosophy ; Religion http://hdl.handle.net/11104/0236437

  5. 26 CFR 1.194-2 - Amount of deduction allowable.

    Science.gov (United States)

    2010-04-01

    ... deduction allowable. (a) General rule. The allowable monthly deduction with respect to reforestation expenditures made in a taxable year is determined by dividing the amount of reforestation expenditures made in... subject to election. A taxpayer may elect to amortize up to $10,000 of qualifying...

  6. New Perspectives on Mentoring. ERIC Digest No. 194.

    Science.gov (United States)

    Kerka, Sandra

    Like most institutions in a world of change, the practice of mentoring is being influenced by new forms of work, technology, and learning. Organizational trends such as downsizing, restructuring, teamwork, increased diversity, and individual responsibility for career development are contributing to a resurgent interest in mentoring in the 1990s.…

  7. 27 CFR 26.194 - Detention of articles.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Detention of articles. 26..., DEPARTMENT OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Shipment of... Detention of articles. (a) Upon receiving a notification in accordance with § 26.193(b), the appropriate...

  8. 46 CFR 194.05-7 - Explosives-Detail requirements.

    Science.gov (United States)

    2010-10-01

    ... (explosive) materials (as defined in 49 CFR 173.50) and blasting-caps must be carried in magazines...) materials (as defined in 49 CFR 173.50) must be identified by their appropriate DOT classification. (c)(1) Compatibility of magazine stowage shall be in accordance with 49 CFR 176.144. (2) Magazine chests, magazine...

  9. Dicty_cDB: VSI194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ldfytdvldlkyldafldkdprlkkyskl nkaiagviedfslvsfiplnimdkksvanliasidksngyiygsldtntaileiqeretq wnfdkyqetqekyyksy...edfslvsfiplnimdkksvanliasidksngyiygsldtntaileiqeretq wnfdkyqetqekyyksyedddvifendqdedydefskylnr*INNNKIIIIIKKK... E Sequences producing significant alignments: (bits) Value N ( AU268302 ) Dictyostelium discoideum vegeta...tive cDNA clone:VS... 928 0.0 1 ( AU268301 ) Dictyostelium discoideum vegetative cDNA c...lone:VS... 928 0.0 1 ( AU261301 ) Dictyostelium discoideum vegetative cDNA clone:

  10. Dicty_cDB: AFF194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gsncitkttrktktdgirdskrirkissrrsrc*rkyr l*s*rkektrri*kenagktk*skrcsktknt*r*rkrkn*irktkrkrstkrinetsne wck*w*it...All Frames) Frame A: ttttnrgdnittnik***i*ktgsncitkttrktktdgirdskrirkissrrsrc*rkyr l*s*rkektrri*kenagktk*skrcskt

  11. 40 CFR 194.23 - Models and computer codes.

    Science.gov (United States)

    2010-07-01

    ... executing the computer codes, including hardware and software requirements, input and output formats with explanations of each input and output variable and parameter (e.g., parameter name and units); listings of input and output files from a sample computer run; and reports on code verification,...

  12. Dicty_cDB: SSB194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ipponbare of ssp. japonica of Oryza sativa (rice). 46 0.20 4 AE014832 |AE014832.1 Plasmodium falciparum 3D7 ...illium chrysogenum Wiscons... 71 3e-11 AY168005_1( AY168005 |pid:none) Emericella nidulans Ras-GAP gene...hkliiefflkkkkik*ke Frame B: kftmxpniy*slyfvhwlqllvpviwvhl*qrllnmlhsirikil*itlkrywsm*rnsh wkai*kvkmiislnfvkis...LLEMQSNGQTEYETTFFKLNVNLLLYVLNKTFIS*inyriffkkkknkikrs Homology vs CSM-cDNA Score E Sequences producing signific....1 kx54h08.y1 Parastrongyloides trichosuri PA pAMP1 v1 Chiapelli McCarter Parastrongyloides trichosuri

  13. Dicty_cDB: AHB194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RISSIVIET--- ---vqlvnf*l*kkvqtlfqyhiwv*eqkf*sllihh*rvikvksc*hwvqh*mfslvvv qnhgiwkervis...---lfns*ifsykrrfkryfsiiygyesknfnlclstike*sk*nlvnigfnikcfl*ww srtmafgkkesfpincfkfnq*tkctfnrtr*w*fipchlsysyksfktnwyrinhw**s nhyqsis...nnnsnq lvkkqetkseekvksepqkhllpsqknklkkikek*vikrrgktgkxeilgsagskke Homology vs CSM-cDNA Score E Sequences pro...xnfrfsgf*kr Translated Amino Acid sequence (All Frames) Frame A: k*fnnqiiylfifyiykfyiyv*nlyiiiikeikdik*ikikrk****ik...s*sinynsillsspsfnsitscqftkrssnsrfftsstntttrttttttttai nlsrnkkpnlkkklnlnlkniyyqvkrin*krlkrnrssreeerqerxkf*vqrv

  14. 34 CFR 668.194 - Economically disadvantaged appeals.

    Science.gov (United States)

    2010-07-01

    ... selected under paragraph (b)(2) of this section, have an expected family contribution, as defined in 34 CFR 690.2, that is equal to or less than the largest expected family contribution that would allow a... Human Services poverty guidelines for the size of the student's family unit. (2) The students who...

  15. Dicty_cDB: CHO194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available er of HSP's gapped (non-prelim): 0 length of query: 121 length of database: 80,480,566 effective HSP length: 17 effective... length of query: 104 effective length of database: 78,821,179 effective search space: 8197402616 effective...successful extensions: 0 Number of sequences better than 10.0: 0 length of query: 121 length of database: _,504,085,797 effective... HSP length: 21 effective length of query: 100 effective length of database: ^,543,142,933 effective... search space: 4654314293300 effective search space used: 4654314293300 T: 0 A: 0 X1: 6 (11.9 b

  16. Dicty_cDB: SLD194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Dictyostelium discoideum gamete cDNA clone:FCL-AC... 161 7e-36 1 ( AU285021 ) Dictyostelium discoideum gamete... cDNA clone:FCL-AA... 161 7e-36 1 ( AU285015 ) Dictyostelium discoideum gamete ...cDNA clone:FCL-AA... 161 7e-36 1 ( AU284890 ) Dictyostelium discoideum gamete cDNA clone:FC-BO1... 161 7e-36... 1 ( AU284628 ) Dictyostelium discoideum gamete cDNA clone:FC-BF1... 161 7e-36 1 ( AU284420 ) Dictyostelium discoideum gamete... cDNA clone:FC-AT2... 161 7e-36 1 ( AU284396 ) Dictyostelium discoideum gamete cDNA clone:F

  17. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  18. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE,CERN

    OpenAIRE

    Rothe, Sebastian

    2012-01-01

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spec...

  19. Inactivation of human osteosarcoma cells in vitro by {sup 211}At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, R.H. [Univ. of Oslo (Norway)]|[Institute for Cancer Research, Oslo (Norway); Bruland, O.S. [Institute for Cancer Research, Oslo (Norway); Hoff, P.; Alstad, J. [Univ. of Oslo (Norway); Lindmo, T. [Institute for Cancer Research, Oslo (Norway); Rofstad, E.K. [Norwegian Institute of Technology, Trondheim (Norway)

    1994-08-01

    The potential usefulness of {alpha}-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) {sup 211}At-TP-3 of different specific activities, (b) {sup 211}At-labeled bovine serum albumin (BSA), (c) free {sup 211}At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, {sup 211}At-BSA or free {sup 211}At. The D{sub o}`s were lower for free {sup 211}At than for {sup 211}At-BSA. The survival curves for {sup 211}At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to {sup 211}At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to {sup 211}At-TP-3 treatment was the antigen expression. Cell inactivation after {sup 211}At-TP-3 treatment increased substantially with increasing specific activity of the {sup 211}At-TP-3. At high specific activities, the cytotoxic effect of {sup 211}At-TP-3 was significantly higher than that of {sup 211}At-BSA. In conclusion, {sup 211}At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs.

  20. Level spin and moments of inertia in superdeformed nuclei near A=194

    International Nuclear Information System (INIS)

    Experimental transition energies in the superdeformed (SD) bands near A=190 are least-squares fit to rotational model formulae in order to extract level spin. The data set includes 16 SD bands, which show no evidence of either irregular behavior near the bottom of the bands or abrupt angular momentum alignment at low ℎω. The 9 transitions lowest in energy in each band are well described by the formulae. The fitted spin of the final state in the γ-ray cascade in within ±0.1 ℎ of an integer or half-odd integer for 13 of the bands. The weight of the evidence suggests that meaningful level spins corresponding to these transitions can be inferred. The moment of inertia at ω=0 is correlated, with J=88.3(5) ℎ2/MeV and J=93.4(5) ℎ2/MeV for the strong and weak bands, respectively. (orig.)

  1. People and things. CERN Courier, Jun 1979, v. 19(4)

    International Nuclear Information System (INIS)

    On 1 April, six months ahead of schedule, electrons were injected into the 8 GeV electron-positron storage ring, CESR, at Cornell. Two weeks later beam was accumulated at an energy of 5.5 GeV. The contract for the management and construct/on of the conventional facilities of the ISABELLE 400 GeV proton storage rings to be built at the Brookhaven Laboratory has been awarded to the New York firm of Ammann and Whitney. Greatly helped by the quality of the beams from the new linac, the CERN 800 MeV four-ring Booster has achieved several new records which bode well for the role it has to play with the PS in feeding the high energy machines in the coming years

  2. 194 Influence of Montelukast on the State of Eosinophil Activation in Asthmatic Children

    OpenAIRE

    Botan, Valéria; Miranda, Marthina; Couto, Shirley; Rocha, Erica; Muniz-Junqueira, Maria Imaculada

    2012-01-01

    Background Eosinophils play an important role in inflammation asthma. In asthma, the leukotrienes are implicated in pathophysiological mechanisms. The antileukotriene montelukast inhibits proinflammatory cytokines and decreases half-life of eosinophils. However, the influence of montelukast on the activation of eosinophils is not clear yet. Therefore, the objective of this work was to evaluate the effect of montelukast on the state of activation of eosinophils in children with persistent asth...

  3. 41 CFR 102-194.25 - What is an automated Standard or Optional format?

    Science.gov (United States)

    2010-07-01

    ... Optional format? An automated Standard or Optional format is an electronic version of the officially prescribed form containing the same data elements and used for the electronic transaction of information...

  4. Susceptibility of 194 Salmonella Isolates to 17 Chemicals used as Sanitizers and Biocides

    Science.gov (United States)

    Salmonella is a major cause of foodborne illnesses in the United States. Meat processing facilities use a wide variety of antimicrobial interventions to reduce Salmonella contamination. The objective of this study was to determine the minimum inhibitory concentration (MIC) of sanitizers and biocides...

  5. 40 CFR 267.194 - What installation requirements must I follow?

    Science.gov (United States)

    2010-07-01

    ... must support and protect ancillary equipment against physical damage and excessive stress due to settlement, vibration, expansion, or contraction. (b) You must provide the type and degree of corrosion... required in 40 CFR 270.11(d)....

  6. LSW-177 and LSW-194: Red-fleshed watermelon lines with low-total soluble solids

    Science.gov (United States)

    Increasing fruit total soluble solids (TSS) content has been a priority of many breeding programs, and the TSS content of modern watermelon [Citrullus lanatus var. lanatus (Thunb.) Matsum. & Nakai)] cultivars is considerably higher than their heirloom counterparts (12-14% TSS compared to ~10% TSS re...

  7. 19 CFR 19.4 - CBP and proprietor responsibility and supervision over warehouses.

    Science.gov (United States)

    2010-04-01

    ... accounted for on a First-In-First-Out (FIFO) basis; or using a unique identifier for inventory categories... fungible merchandise on a First-In-First-Out (FIFO) basis instead of specific identification by warehouse..., quantity counts of goods in warehouse inventories, spot checks of selected warehouse transactions...

  8. SU-E-T-194: From Dicom-RT to Radiobiological Dose Metrics in 5 Minutes

    Energy Technology Data Exchange (ETDEWEB)

    Whelan, B; Holloway, L

    2014-06-01

    Purpose: To develop a flexible and standalone framework for batch calculation of radiobiological dose metrics from Dicom-RT. Methods: Software has been developed which allows (1) The calculation of DVH data from DICOM dose and structure files (DVHgenerator), (2) Calculation of a wide range of radiobiological metrics from this data (CompPlanGui). Both these tools are run via graphical user interface (GUI), making them fast and simple. Part 1 is a new tool which has not previously been published, whilst part 2 is a GUI overlay for the previously published software ‘Comp-Plan’ (Holloway et. al., Medical Dosimetry, 2012), previously reliant on command line interface. The time taken for an experienced user to evaluate a test case of 6 plans with and without CompPlanGUI was quantified. Results: The DVH-generator has been found to be faster, more robust and require far less physical memory then using alternative software solutions for the same purpose. The Comp Plan GUI significantly reduces the amount of time required to set up a base directory, eliminates code crashes arising from typographical errors, and renders the code far more accessible to non-expert users. It took an experienced user of the code around 3 minutes to set up a base directory of 6 plans compared around 8 minutes without, indicating that using CompPlanGUI reduced setup time by over 50%. Conclusion: A standalone GUI based framework has developed which allows for the batch calculation of radiobiological dose metrics directly from Dicom-RT files. As with the original code, this work will be made freely available on request, as well as via matlab file exchange.

  9. SU-E-T-194: From Dicom-RT to Radiobiological Dose Metrics in 5 Minutes

    International Nuclear Information System (INIS)

    Purpose: To develop a flexible and standalone framework for batch calculation of radiobiological dose metrics from Dicom-RT. Methods: Software has been developed which allows (1) The calculation of DVH data from DICOM dose and structure files (DVHgenerator), (2) Calculation of a wide range of radiobiological metrics from this data (CompPlanGui). Both these tools are run via graphical user interface (GUI), making them fast and simple. Part 1 is a new tool which has not previously been published, whilst part 2 is a GUI overlay for the previously published software ‘Comp-Plan’ (Holloway et. al., Medical Dosimetry, 2012), previously reliant on command line interface. The time taken for an experienced user to evaluate a test case of 6 plans with and without CompPlanGUI was quantified. Results: The DVH-generator has been found to be faster, more robust and require far less physical memory then using alternative software solutions for the same purpose. The Comp Plan GUI significantly reduces the amount of time required to set up a base directory, eliminates code crashes arising from typographical errors, and renders the code far more accessible to non-expert users. It took an experienced user of the code around 3 minutes to set up a base directory of 6 plans compared around 8 minutes without, indicating that using CompPlanGUI reduced setup time by over 50%. Conclusion: A standalone GUI based framework has developed which allows for the batch calculation of radiobiological dose metrics directly from Dicom-RT files. As with the original code, this work will be made freely available on request, as well as via matlab file exchange

  10. JPL Physical Oceanography Distributed Active Archive Center (PO.DAAC) data availability, version 1-94

    Science.gov (United States)

    1994-01-01

    The Physical Oceanography Distributed Active Archive Center (PO.DAAC) archive at the Jet Propulsion Laboratory (JPL) includes satellite data sets for the ocean sciences and global-change research to facilitate multidisciplinary use of satellite ocean data. Parameters include sea-surface height, surface-wind vector, sea-surface temperature, atmospheric liquid water, and integrated water vapor. The JPL PO.DAAC is an element of the Earth Observing System Data and Information System (EOSDIS) and is the United States distribution site for Ocean Topography Experiment (TOPEX)/POSEIDON data and metadata.

  11. Yucca Mountain Site Characterization Project Bibliography, July, December 194: An update

    International Nuclear Information System (INIS)

    Following a reorganization of the Office of Civilian Radioactive Waste Management in 1990, the Yucca Mountain Project was renamed Yucca Mountain Site Charactrization Project. The title of this bibliography was also changed to Yucca Mountain Site Characterization Project Bibliography. Prior to August 5, 1988, this project was called the Nevada Nuclear Waste Storage Investigations. This bibliography contains information on this ongoing project that was added to the Department of Energy's Science and Technology Database from July 1, 1994 through December 31, 1994. The bibliography is categorized by principal project participating organization. Participant-sponsored subcontractor reports, papers, and articles are included in the sponsoring organization's list. Another section contains information about publications on the Energy Science and Technology Database that were not sponsored by the project but have some relevance to it

  12. Anomalous Fluctuations of s-Wave Reduced Neutron Widths of 192,194Pt Resonances

    International Nuclear Information System (INIS)

    We obtained an unprecedentedly large number of s-wave neutron widths through R-matrix analysis of neutron cross-section measurements on enriched Pt samples. Careful analysis of these data rejects the validity of the Porter-Thomas distribution with a statistical significance of at least 99.997%.

  13. Nuclear structure in odd-odd nuclei, 144≤A≤194

    International Nuclear Information System (INIS)

    A comprehensive review of the present understanding, both theoretical and experimental, of intrinsic and rotational level structures in medium-heavy deformed odd-odd nuclei is presented. A discussion of the various experimental methods is presented, emphasizing the need for a variety of experimental approaches. The odd-odd nuclei that are immediately amenable to fruitful additional study are pointed out. A discussion of the intrinsic level structures, Gallagher-Moszkowski (GM) splittings, Newby (N) shifts, and role of the residual p-n interaction is presented. Currently available data in the rare-earth region allow the empirical determination of 137 GM splittings and 36 N shifts for 25 odd-odd nuclei in the mass region 152≤A≤188. A new parametrization of the residual p-n interaction is presented which also takes into account the 27 GM splittings and 12 N shifts from the actinide region. Newly discovered features of rotational bands, such as odd-even staggering, and other high-spin phenomena, such as signature inversion and delay in bandcrossing frequency, are discussed. The role of higher-order Coriolis coupling is pointed out. Systematics of the two-quasiparticle excitations, shape coexistence, isomers, and four-quasiparticle states are presented. Calculated results of the two-quasiparticle intrinsic excitations using two methods, the intrinsic level spacings for odd-A neighboring nuclei and the quasiparticle-plus-phonon coupling model, are compared with experiment. copyright 1998 The American Physical Society

  14. Djurleite (Cu1.94S) and low chalcocite (Cu2S): New crystal structure studies

    Science.gov (United States)

    Evans, H.T., Jr.

    1979-01-01

    Additional x-ray structure studies on low chalcocite generally confirm the previously reported structure but show that either disorder is present or the true space group is not P21/c but Pc, four of the 96 copper atoms in the monoclinic unit cell taking on twofold (linear) coordination. The crystal structure of djurleite has been solved in space group P21/n, the monoclinic cell having parameters a = 26.897, b = 15.745, and c = 13.565 angstroms; ?? = 90.13??; and a content of 248 copper and 128 sulfur atoms. Of the 62 different copper atoms in the structure, 52 are in threefold, triangular coordination with sulfur, nine in tetrahedral, and one in linear coordination.

  15. 1935 15' Quad #194 Aerial Photo Mosaic Index - 2 of 2

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  16. 1935 15' Quad #194 Aerial Photo Mosaic Index - 1 of 2

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  17. The quasicontinuum of gamma rays from the feeding and decay of the superdeformed in {sup 194}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Lauritsen, T.; Ahmad, I.; Carpenter, M.P. [and others

    1995-08-01

    Over the last year we developed techniques for the study of the quasicontinuum of gamma-rays from both the feeding and especially the decay of the superdeformed (SD) bands in the Hg nuclei, most notably {sup 192}Hg. From this analysis we could extract both the spin and energy of some of the SD bands. The quasicontinuum analysis is the only technique so far that could extract these two fundamental properties of the now more than 100 SD bands found in the A = 150 and A = 190 regions. We based our understanding of the feeding and decay on comparisons of the data with extensive Monte Carlo simulations of the emission of gamma rays, both from the entry distribution toward the SD minimum, and, at lower spins, from the decay out of the SD band back to the states in the normal well.

  18. Production and novel radiochemical separation of 194Au from Pt for use in multi-modality nanoparticles

    OpenAIRE

    Graves, S; S Goel; Chen, F; Valdovinos, H.; Barnhart, T.; W. Cai; Nickles, R.

    2015-01-01

    Introduction Gold nanoparticles (AuNPs) have demonstrated their incredible versatility in applications such as in vitro and in vivo imaging, cancer therapy, and drug delivery.[1-3] These AuNPs come in many shapes including nanospheres, nanorods, nanoshells, and nanocages. Their versatility stems from the ability to construct or label a single AuNP with many functions. Many types of AuNPs are inherently flourescent, allowing for ex vivo utilization as well as small animal fluorescence imagi...

  19. Analysis of ER and fission in decay of 210Rn* formed in 16O + 194Pt reaction

    International Nuclear Information System (INIS)

    In the present work, the decay of 210Rn* is studied using the dynamical cluster decay model (DCM). The ER as well as fission cross-sections are calculated by independent as well as simultaneous choice of neck length parameter 'ΔR'

  20. 15 CFR 19.4 - What notice will Commerce entities send to a debtor when collecting a Commerce debt?

    Science.gov (United States)

    2010-01-01

    .... 3201(e); 31 U.S.C. 3720B, 31 CFR 285.13, and § 19.17(a) of this Part); (16) If applicable, the Commerce... must be made unless excused in accordance with 31 CFR 901.9 (see § 19.5 of this Part); (3) The date by... administrative collection of debts. See 31 CFR part 901....

  1. Ellagic Acid-Changed Epigenome of Ribosomal Genes and Condensed RPA194-Positive Regions of Nucleoli in Tumour Cells

    Czech Academy of Sciences Publication Activity Database

    Legartová, Soňa; Sbardella, G.; Kozubek, Stanislav; Bártová, Eva

    2015-01-01

    Roč. 61, č. 2 (2015), s. 49-59. ISSN 0015-5500 R&D Projects: GA ČR GBP302/12/G157; GA ČR GA13-07822S Institutional support: RVO:68081707 Keywords : ARGININE METHYLTRANSFERASE 1 * CHRISTMAS TREES * CHROMATIN Subject RIV: BO - Biophysics Impact factor: 1.000, year: 2014

  2. 77 FR 194 - Federal Acquisition Regulation; Time-and-Materials and Labor-Hour Contracts for Commercial Items

    Science.gov (United States)

    2012-01-03

    ... acquire commercial services only when no other contract type is suitable; and instill discipline in the... Commercial Items AGENCIES: Department of Defense (DoD), General Services Administration (GSA), and National... 75 FR 59195 on September 27, 2010. The due date for public comments was November 26, 2010....

  3. Shelf-Life of ɛ-Lysyl-3-(Trimethylstannyl)Benzamide Immunoconjugates, Precursors for 211At Labeling of Antibodies

    OpenAIRE

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per; Jensen, Holger; Holgersson, Stellan; Lindegren, Sture

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity and the complex radiochemistry of 211At are major obstacles for research and prospective clinical applications. In the present study, astatination of immunoconjugates, already prepared well in advance...

  4. Search for shape coexistence in {sup 188,190}Pb via fine structure in the alpha decay of {sup 192,194}Po

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, I.; Davids, C.; Janssens, R.V.F. [and others

    1995-08-01

    The interaction between coexisting shapes in nuclei near closed shells was of great interest in the past decade. Excited 0{sup +} states at low energy can often be identified as the bandheads of structures with differing shapes built on those states, These structures were identified in {sup 190-198}Pb via beta decay and alpha decay {open_quotes}fine structure{close_quotes} studies. Coexistence of different shapes in Pb nuclei was predicted by Nilsson-Strutinsky calculations, in which both the oblate and prolate minima were predicted to have excitation energies near 1 MeV. It was our intention to continue the systematic study of the Pb nuclides by searching for excited O{sup +} states in {sup 188}Pb by observing the fine structure in the alpha decay of {sup 192}Po.

  5. [Analysis of the results and considerations on the organizational aspects of the implementation of the Law 194/78 in a provincial hospital].

    Science.gov (United States)

    Pacilli, L; Arrotta, S; Ansaldi, E; Graffino, W

    1981-09-01

    Law number 94 legalizing abortion passed in Italy in May 1978. This article reports on the situation of induced abortion in the small provincial hospital of Avigliana, Torino, 1 year after the implementation of the law. The paramedical personnel were supportive of the medical and obstetrical personnel who, not being conscientious objectors, accepted to perform abortions. Every woman was thoroughly checked and counseled prior to the operation by the same doctor who was going to perform the abortion; the procedure was always done under general anesthesia and by vacuum aspiration. There were 66 abortions between June-December 1978, and 115 between January-July 1979. Contrary to expectations the number of deliveries also increased, from 66 during the 1st half to 145 during the 2nd half of operations. More than half the number of patients were referred from the ambulatory clinic within the same hospital, as compared to only 25% during the 1st half; only 7.8% were referred by private physicians, as compared to 30% during the 1st half. Almost 50% of patients were housewives both during the 1st and during the 2nd half; age of patients was, for the great majority, between 24-35; parity was 2 in 43.8% of cases for the 1st half, and in 40% of cases in the 2nd half. The majority of operations was performed within the 1st 8 weeks of pregnancy, and many women came from districts outside that of Avigliana. 34.8% of requests for abortion were because of failure of contraception, and almost 40% for socioeconomic reasons; only 8.2% of requests were motivated by reasons of health. Misinformation about contraceptive practices was widespread among the patients. PMID:7322426

  6. Immunohistochemical changes in the expression of HSP27 in exercised human vastus lateralis muscle”. Acta Physiologica (Oxf). 194(3): 215-22, 2008

    DEFF Research Database (Denmark)

    Folkesson, Mattias; Mackey, A L; Holm, Lars;

    2008-01-01

    27 protein in muscle fibres from five of nine subjects. The number of fibres with accumulation of HSP27 in RE ranged from 0% to 32% with a mean of 6.3% of the total number of fibres. CONCLUSION: We conclude that this rapid HSP27 protein relocation after RE is an important player in the cellular...... remodelling of human muscle fibres in response to exercise involving high-force contractions, but not in response to endurance exercises....

  7. American Recovery and Reinvestment Act ( ARRA) FEMP Technical Assistance, U.S. General Services Administration - Project 194 U.S. Custom Cargo Inspection Facility, Detroit, MI

    Energy Technology Data Exchange (ETDEWEB)

    Arends, J.; Sandusky, William F.

    2010-05-31

    This report documents the findings of an on-site audit of the U.S. Customs Cargo Inspection Facility (CIF) in Detroit, Michigan. The federal landlord for this building is the General Services Administration (GSA). The focus of the audit was to identify various no-cost or low-cost energy-efficiency opportunities that, once implemented, would reduce electrical and gas consumption and increase the operational efficiency of the building. This audit also provided an opportunity to identify potential capital cost projects that should be considered in the future to acquire additional energy (electric and gas) and water savings to further increase the operational efficiency of the building.

  8. Hepatitis B virus in tenofovir-naive Chinese patients with chronic hepatitis B contains no mutation of rtA194T conferring a reduced tenofovir susceptibility

    Institute of Scientific and Technical Information of China (English)

    LIU Yan; WANG Chun-mei; CHENG Jun; LIANG Zhao-ling; ZHONG Yan-wei; REN Xiao-qiang; XU Zhi-hui; Fabien Zoulim; XU Dong-ping

    2009-01-01

    @@ Recently the Chinese Ministry of Health declared that 93 million people were chronically infected with hepatitis B virus (HBV) in China. Four nucleotide analogues (Nas) are currently approved for the treatment of HBV infection, I.e., lamivudine (LAM), adefovir (ADV), entecavir (ETV), and telbivudine (L-dT).1 In contrast to therapeutic benefits, prolonged use of Nas increases the emergence of drug-resistant mutations in the HBV reverse transcriptase (RT) domain, leading to a.

  9. Les ONG : instruments du néolibéralisme ou alternatives populaires ?. -Paris, l’harmattan, 1998- 194 p

    OpenAIRE

    Izerouken, Arab

    2013-01-01

    Les auteurs ayant collaboré à la réalisation de cette publication, annoncent d’emblée la couleur. Ils expriment, dans leurs analyses des ONG (en particulier les ONG dites " de développement"), le point de vue du Sud. L’ouvrage, à travers les différents articles qui le composent, passe au crible les intentions affichées, les pratiques, le fonctionnement et l’organisation des ONG. Les auteurs conscients de la difficulté qu’il y a à définir le groupe notionnel ONG" semblent, devant le succès du ...

  10. Chandra Observation of the Cluster of Galaxies MS 0839.9+2938 at z=0.194: the Central Excess Iron and SN Ia Enrichment

    OpenAIRE

    Wang, Yu; Xu, Haiguang; Zhang, Zhongli; Xu, Yueheng; Wu, Xiang-Ping; Xue, Sui-Jian; Li, Zongwei

    2005-01-01

    We present the Chandra study of the intermediately distant cluster of galaxies MS 0839.9+2938. By performing both the projected and deprojected spectral analyses, we find that the gas temperature is approximately constant at about 4 keV in 130-444h_70^-1 kpc. In the inner regions, the gas temperature descends towards the center, reaching ~ 0.2. We argue that most of the excess iron should have been contributed by SNe Ia. By utilizing the observed SN Ia rate and stellar mass loss rate, we esti...

  11. A representação feminina a partir do aprofundamento psicológico de Fedra - DOI: 10.4025/actascihumansoc.v27i2.194 Woman representation from a depth psychological examination of Fedra - DOI: 10.4025/actascihumansoc.v27i2.194

    Directory of Open Access Journals (Sweden)

    Marisa Corrêa Silva

    2005-11-01

    Full Text Available Neste estudo trabalhamos com a representação feminina a partir do aprofundamento psicológico da personagem Fedra, no texto dramático Fedra, de Racine. Entendemos que, dentro dos estudos literários, a questão dos gêneros tem suscitado grande interesse e tem se desenvolvido grandemente durante as últimas décadas. Percebemos que este exame pode contribuir para os estudos de gênero, visto que apresenta uma representação de feminilidade nos textos dramáticos, levando em conta aspectos de um aprofundamento na psicologia da heroína. Por meio de nossos estudos, concluímos que existem marcas no texto que nos permitem identificar aspectos de feminilidade e que por meio do aprofundamento psicológico realizado no texto de Racine, é possível reconhecer e apontar traços da ambigüidade feminina, construída sobre o alicerce da contraposição entre feminino e masculino.This study shows feminine representation from a profound psychological study of the character Fedra in Racine's dramatic play Fedra. In literary theory, gender issues have been of great interest and have also experienced great development, particularly in the last decades. This paper intends to contribute towards gender studies by showing the feminine representation in dramatic plays based on a careful psychological examination of the female protagonist. Results show that there are some feminine text markings as well as feminine ambiguity traces which may be recognized and pointed out in the contraposition of feminine and masculine through the psychological study of the character.

  12. A representação feminina a partir do aprofundamento psicológico de Fedra - DOI: 10.4025/actascihumansoc.v27i2.194 Woman representation from a depth psychological examination of Fedra - DOI: 10.4025/actascihumansoc.v27i2.194

    OpenAIRE

    Marisa Corrêa Silva; Rosana Baú Rabello

    2005-01-01

    Neste estudo trabalhamos com a representação feminina a partir do aprofundamento psicológico da personagem Fedra, no texto dramático Fedra, de Racine. Entendemos que, dentro dos estudos literários, a questão dos gêneros tem suscitado grande interesse e tem se desenvolvido grandemente durante as últimas décadas. Percebemos que este exame pode contribuir para os estudos de gênero, visto que apresenta uma representação de feminilidade nos textos dramáticos, levando em conta aspectos de um aprofu...

  13. Dicty_cDB: Contig-U10506-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available = 9e-54 Identities = 194/194 (100%) Strand = Plus / Plus Query: 14 tccaaanaaaatccnanaaccatatttnttaatattnccaa...aatcgganatcatcnttnc 73 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 14 tccaaanaaaatccna...ct: 74 caatttnganaaaaccnttggnaaaacttggnttattgattttgaaaaanaaacaactaa 133 Query: 134 aatccnanatggnagnttcnttncn...||||||||||||||||||| Sbjct: 134 aatccnanatggnagnttcnttncnaatattnaaaanacnttnattcnttggaanagaca 193 Query: 194 n... Score = 206 bits (104), Expect(2) = 2e-60 Identities = 194/194 (100%) Strand = Plus / Minus Query: 14 tccaaanaaaatccna

  14. Le palais d’Aiétès et son jardin chez Apollonios de Rhodes (Arg., III, v. 194-252). Un exemple de paysage-palimpseste antique ? The Palace of Aeetes and its Garden in Apollonius of Rhodes (Arg., III, lines 194-252). An example of ancient landscape as palimpsest? Il palazzo di Eeta e il suo giardino in Apollonio Rodio (Arg., III, 194-252). Un esempio di paesaggio-palinsesto antico?

    OpenAIRE

    Laury-Nuria André

    2012-01-01

    Lorsque le lecteur découvre au chant III des Argonautiques d’Apollonios de Rhodes l’espace du « paysage urbain » colque, au fur et à mesure de la progression visuelle des personnages, se dessine mentalement tout un espace littéraire fait de réminiscences homériques. L’espace végétal semble composé d’un bouquet d’intertextes de nature endogène tandis que l’architecture palatiale combine structure archaïque et ornements hellénistiques. Nulle trace d’exotisme donc, mais un espace composé de réfé...

  15. Le palais d’Aiétès et son jardin chez Apollonios de Rhodes (Arg., III, v. 194-252. Un exemple de paysage-palimpseste antique ? The Palace of Aeetes and its Garden in Apollonius of Rhodes (Arg., III, lines 194-252. An example of ancient landscape as palimpsest? Il palazzo di Eeta e il suo giardino in Apollonio Rodio (Arg., III, 194-252. Un esempio di paesaggio-palinsesto antico?

    Directory of Open Access Journals (Sweden)

    Laury-Nuria André

    2012-07-01

    Full Text Available Lorsque le lecteur découvre au chant III des Argonautiques d’Apollonios de Rhodes l’espace du « paysage urbain » colque, au fur et à mesure de la progression visuelle des personnages, se dessine mentalement tout un espace littéraire fait de réminiscences homériques. L’espace végétal semble composé d’un bouquet d’intertextes de nature endogène tandis que l’architecture palatiale combine structure archaïque et ornements hellénistiques. Nulle trace d’exotisme donc, mais un espace composé de référents grecs typiques. Du fait de ces référents littéraires, la construction de l’espace palatial urbain emprunte sa configuration même au type d’écriture poétique sollicité par le poète épique : la réécriture. Comment comprendre alors que le palais d’Aiétès puisse être à l’image du palais du souverain grec hellénistique, image idéale d’une architecture s’inscrivant dans l’ordre divin ? Il faut voir ici non seulement la mise en image, l’illustration concrète via l’architecture et, partant, le « paysage urbain » qui se singularise par sa nature hybride, de la volonté de rapprocher Orient et Occident, mais aussi et surtout les moyens mêmes de cette mise en œuvre. Le palais et son jardin ne seraient alors qu’une promesse, un prototype d’un modèle idéal à étendre, grandeur nature, sur l’ensemble du territoire colque, et de l’oïkoumène tout entière.When the reader of the third book of Apollonius of Rhodes discovers, in the course of the characters’ visual progression, the space of a Colchian “urban landscape”, s/he mentally creates a literary space made of Homeric recollections. The garden space seems composed of a bouquet of intertexts of endogenous nature, whereas the palatial architecture combines archaic structure with hellenistic ornamentation. So no trace of the exotic, but a space composed of typical Greek references. As a result of these literary references, the construction of palatial urban space borrows its own configuration from the type of poetic writing the epic poet himself solicits: re-writing. How else can one explain that the palace of Aeetes can be the image of a hellenistic Greek royal palace, the perfect image of an architecture that inscribes itself into a divine order? One should see here not only the reconfiguration, the concrete illustration through the archictecture and, consequently, the urban “landscape” of such an unusual hybrid character, as a result of the wish to reconcile East and West, but also, perhaps especially, the means of its implementation. The palace and garden would then only be a promise, an ideal prototype to be extended, on a large scale, over all of the Colchian land and the entire oekoumene.Quando il lettore scopre, nel terzo libro delle Argonautiche di Apollonio Rodio, lo spazio del ‘paesaggio urbano’ colco, via che progredisce la visuale dei personaggi, viene tracciato mentalmente tutto uno spazio letterario fatto di reminiscenze omeriche. Lo spazio vegetale sembra composto da un insieme di intertesti endogeni, laddove l’architettura palaziale combina struttura arcaica e decorazioni ellenistiche. Nessuna traccia d’esotismo, quindi, ma uno spazio composto di tipici referenti greci. A partire da questi referenti letterari, la costruzione dello spazio palaziale urbano deve la sua stessa configurazione al tipo di scrittura poetica sollecitata dal poeta epico: la riscrittura. Come comprendere, allora, che il palazzo di Eeta possa essere a immagine del palazzo del sovrano greco ellenistico, immagine ideale di un’architettura che si inscrive nell’ordine divino? Occorre vedere qui non soltanto la raffigurazione, l’illustrazione concreta tramite l’architettura e, perciò, il ‘paesaggio urbano’ che si distingue per la sua natura ibrida, dalla volontà di avvicinare Oriente e Occidente, ma anche e soprattutto i mezzi stessi di questa attuazione. Il palazzo e il suo giardino non sarebbero allora altro che una promessa, un prototipo di un modello ideale da estendere, in scala naturale, all’insieme del territorio colco e dell’intera ecumene.

  16. Shelf-life of ɛ-lysyl-3-(trimethylstannyl)benzamide immunoconjugates, precursors for 211At labeling of antibodies

    DEFF Research Database (Denmark)

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per;

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity ...

  17. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  18. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    International Nuclear Information System (INIS)

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons

  19. Separation of 211At from irradiated bismuth target and labelling of a model protein

    International Nuclear Information System (INIS)

    Astatine-211 is a promising radionuclide for therapeutic use in nuclear medicine. An efficient method (70%) for radiochemical separation from the irradiated Bi-target has been described. The level of Bi contamination in the purified 2'11At-solution was estimated. Finally labelling of a model protein has been tried. (author). 14 refs

  20. Multibeam collection for KN194-04: Multibeam data collected aboard Knorr from 2008-10-03 to 2008-10-31, departing from Reykjavik, Iceland and returning to Reykjavik, Iceland

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  1. Le palais d’Aiétès et son jardin chez Apollonios de Rhodes (Arg., III, v. 194-252). Un exemple de paysage-palimpseste antique ?

    OpenAIRE

    André, Laury-Nuria

    2013-01-01

    Lorsque le lecteur découvre au chant III des Argonautiques d’Apollonios de Rhodes l’espace du « paysage urbain » colque, au fur et à mesure de la progression visuelle des personnages, se dessine mentalement tout un espace littéraire fait de réminiscences homériques. L’espace végétal semble composé d’un bouquet d’intertextes de nature endogène tandis que l’architecture palatiale combine structure archaïque et ornements hellénistiques. Nul...

  2. Multibeam collection for KN194-02: Multibeam data collected aboard Knorr from 2008-09-01 to 2008-09-23, departing from Nuuk (Godthab), Greenland and returning to Nuuk (Godthab), Greenland

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  3. Analisis Yuridis Terhadap Sengketa Kepemilikan Merek “Lexus” Antara Perusahaan PT. Toyota Jidosha Kabushiki Kaisha Dengan PT. Lexus Daya Utama (Studi Kasus Putusan No. 194.K/Pdt.Sus/2011)

    OpenAIRE

    Komalasari, Rini

    2016-01-01

    Brand is a mark which consists of pictures, names, words, alphabets, figures, color arrangement, of the combination of these elements which have distinctive power and are used in the activities of goods and services. The requirement/recognition on the right of brand for the brand ownership, according to constitution, is by registering it to the Directorate General of HKI as it is stipulated in Law on Brand No. 15/2001. This case began from the claim which was filed by PT. To...

  4. Insights into the Hydrocarbon Tolerance of Two Devosia Isolates, D. chinhatensis Strain IPL18T and D. geojensis Strain BD-c194T, via Whole-Genome Sequence Analysis

    OpenAIRE

    Hassan, Yousef I.; Lepp, Dion; Li, Xiu-Zhen; Zhou, Ting

    2015-01-01

    Hexachlorocyclohexane (HCH) was among the most commonly used pesticides after the Second World War. The extensive use of this hydrocarbon for almost six decades has created a contamination problem on a global scale, and bioremediation methods are being extensively explored. The reported ability of some Devosia species to grow in the presence of appreciable amounts of hydrocarbons (2,000 mg/kg of contaminated soil) is attracting closer attention. Here, we report the de novo genome assembly of ...

  5. Hurdles for a Broader Use of 211At and for the Synthesis of 211At-Labelled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    One of the key impediments to the use of 211At is the very well known deleterious effect of high radiation fields caused by its alpha particles on the synthesis of 211At-labelled radiopharmaceuticals. This is problematic because radiolysis-mediated effects can produce diminishing efficiency of electrophilic astatination reactions due to increasing deposition of radiation dose with increasing activities and with the passage of the time. Astatine-211 has chemical properties that permit complex labelling strategies and a longer half-life than 213Bi that makes it more suitable when the targeting molecule does not gain immediate access to the tumour cells. The first clinical evaluation was published in 2001 [2] in patients with brain tumour. Although this study circumvents many of the challenges to entering clinical studies with 211At and many obstacles had to be surmounted before clinical studies could be initiated, several problems were encountered in maintaining efficient labelling with escalating radiation dose of α-particle even with fresh 211At elution [3]. Astatine-211 also has an additional hurdle to overcome before to its clinical application in labelled radiopharmaceuticals related with its production and distribution. Among the potential group of promising α- emitter it is the only one produced by cyclotrons, but due to the scarcity of cyclotrons equipped with 25−30 MeV α-particle beams, it will of necessity be utilized in distant locations from the site of production. It presents a major chemical challenge because the diminishing efficiency of electrophilic astatination reactions with the passage of the time is well known, a problem likely related to the radiolysis produced by the high LET (linear energy transfer) meaning that large amounts of energy are deposited in a highly localized manner. This problem has been most comprehensively investigated to understand and evaluate the role of the radiolysis effects of astatine alpha particles in the synthesis

  6. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  7. Radiopharmaceutical Chemistry of Targeted Radiopharmaceutics. Synthesis of 211At-Labeled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    Targeted α-particle radiotherapy is an appealing approach to cancer treatment because of the potential for delivering curative doses of radiation to tumor with minimal damage to normal tissue due to a range equivalent to only a few cell diameters. Compared with β-emitters they have significant advantages from a radiobiological perspective. The LET of 211At α-particles is more than 400 times higher than the β-particles emitted by 90Y, in addition the distance between ionizing events is almost the same as that between the two strands of DNA, yielding a high probability of creating non-repairable DNA damage. It gives the ability to kill cancer cells not compromised by hypoxia, dose rate effects or cell cycle position, enhancing their attractiveness for targeted radiotherapy. However, translation of the concept to the clinic has been slow, many obstacles had to be surmounted before clinical studies could be initiated, the first clinical evaluation of a 211At- labeled mAb was made in 2001. This study circumvents many of the challenges to entering clinical studies with 211At. But several problems were encountered in maintaining efficient labeling with escalating radiation dose of alpha-particle likely related to radiolysis. The impact of the radiolysis produced by the α-particle over the labeling chemistry is much higher in comparison with typical β-emitters due to a deposition of energy in the solvent in a highly localized manner two orders of magnitude per unit volume higher than 90Y or 131I. Due to these difficulties a comprehensive basic science study about the radiolytic effects of astatine alpha-particles over the synthesis of 211At-labeled radiopharmaceuticals was carried out. Its main goal was overcoming the problem of the synthesis of 211At-labeled radiopharmaceuticals at the high activities necessaries for therapy and also to extend the shelf life of astatine elutions. Briefly this study held several steps, the first one was to study the role of solvent

  8. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    International Nuclear Information System (INIS)

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211At and 124I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[211At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[211At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [124I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[124I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of macromolecules

  9. 211At production and recovery: first results of a new start

    International Nuclear Information System (INIS)

    Full text: 211At is the only alpha-emitting isotope which can be introduced into organic molecular structures by covalent chemical binding and possesses superior decay characteristics for therapeutic applications when compared with other alpha emitters. However, its production requires a minimum of 27,5 MeV alpha-particles, which are relatively rarely available. In view of the revival of alpha-therapy approaches a production of 211At has been set up at the MHH cyclotron (MC-35). The first aim of this project was to establish a target- and work-up-system for the reliable production of several ten MBq-quantities of 211At for animal- and cell-research. An aluminum-target-system holds a 1.3 cm diameter Bi-disc of 0.25 mm thickness. The disk is pressed onto a the aluminum backing with 2 tons/cm2. The front is covered with a 125 μm Al foil, cooled by a He jet which is separated from the vacuum by a 250 μm Ti foil. Starting with 27.5 MeV alpha-particles the resulting target-energy is 25 MeV. This relatively low energy is chosen to avoid any contamination with 210At and 210Po in the first experimental period. A beam current of 10 μA for 15 min (9 mCoulomb) yields 16.4 MBq 211At theoretically. Astatine is recovered from the target by a dry distillation technique, using various gases as a transport support-medium. The small all-quartz distillation-apparatus is heated up to 900 oC. Astatine is recovered in a small cool able vessel containing various trapping media. Distillation and trapping can be monitored with small radioactivity monitors. The whole system fits in a cubical 0.5 m glove box. Continuous monitoring of the distillation process allowed to optimize the heating rate, the transport support-medium and its flow-rate. Various trapping solutions were tested for their efficiency. Different beam dispersion in the target seems to influence the release and distillation of astatine from the molten bismuth-target. Two different release patterns were observed. The first

  10. 75 FR 9027 - Proposed Collection; Comment Request for Regulation Project

    Science.gov (United States)

    2010-02-26

    ...-80 (T.D. 7927), Amortization of Reforestation Expenditures (Sec. Sec. 1.194-2 and 1.194-4). DATES... Internet at Elaine.H.Christophe@irs.gov . SUPPLEMENTARY INFORMATION: Title: Amortization of Reforestation... section 194 allows taxpayers to elect to amortize certain reforestation expenditures over a 7-year...

  11. Dicty_cDB: SFA691 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 510164 |AJ510164.1 Cloning vector pDXA-3strep. 194 7e-47 2 X85119 |X85119.1 Artificial... sequences cloning vector DNA pDXA-3H. 194 7e-47 2 X85122 |X85122.1 Artificial sequences cloning vector... DNA pDXA-HY. 194 7e-47 2 AJ510165 |AJ510165.1 Cloning vector pDXA-3FLAG. 194 7e-47 2 X85118 |X85118.1 Artificial... sequences cloning vector DNA pDXA-3C. 194 7e-47 2 X85123 |X85123.1 Artificial... sequence. 194 7e-47 2 X85120 |X85120.1 Artificial sequences cloning vector DNA pDXD-3H. 194 8e-47 2 AJ51016

  12. Decision of the German Federal Constitutional Court in proceedings instituted by the Land of Lower of Saxony, on the constitutionality of paragraph 2a, sub-para. 1(2) of paragraph 7 atomic energy act (AtG). Ruling as of 2 March 1999 (Az.: 2BvF 1/94)

    International Nuclear Information System (INIS)

    The legal question to be decided by the Federal Constitutional Court of Germany was whether a single ministry of the federal government can be vested, by way of a federal act, with the authority to issue general administrative regulations for implementation of the federal atomic energy act (AtG), to the governments of the federal Lands in matters where the Land governments act on behalf of the federal government, as e.g. in this case, concerning nuclear power plant licensing and radiation protection. The court ruling explains that the Constitution provides for exclusive rights of the federal government to issue general administrative regulations for the implementation of federal law. (orig./CB)

  13. Lenguaje, poesía y filosofía. Este artículo es una elaboración del discurso de recepción como miembro de la Academia Colombiana de la Lengua, publicado en el Boletín de la Academia Colombiana, Tomo XLVI, Número 194,1996.

    Directory of Open Access Journals (Sweden)

    Cecilia Balcázar de Bucher

    2000-05-01

    Full Text Available Son varios los enfoques que pueden adoptarse en el estudio de esta relación; y aquí podríamos intentarlo desde la lingüística -"la más científica de las humanidades y la más humanistica de las ciencias"-; o por la percepción que nos da el haber vivido en la poesía y el haberle dado un vistazo a la filosofía desde la ventana de la lengua.

  14. Inclusive measurement of (p,πsup(-)xn) double charge exchange reactions on bismuth from threshold to 800 MeV

    International Nuclear Information System (INIS)

    The energy dependence of the total angle-integrated cross section for the production of astatine isotopes from (p,πsup(-)xn) double charge exchange reactions on bismuth (sup(209)Bi) was measured from 120 to 800 MeV using activation and radiochemical techniques. Chemical yields were estimated by direct radioassaying of sup(211)At activity in thin (approximately 1 mg/cmsup(2)), irradiated bismuth targets. Calculations of the contributions of secondary (2-step) reactions to these measured astatine yields were performed, based partially upon the observed sup(211)At activity although even at the highest energies, the contribution to products lighter than sup(207)At was negligible. These data for products with as many as 7 neutrons removed from the doubly coherent product (sup(210)At) display nearby gaussian shapes for the mass distributions of the astatine residues with the maximum occurring for about sup(204)At. The most probable momentum transfer deduced from these distributions for the initial πsup(-) production step was 335 MeV/c. The observed excitation functions display a behaviour similar to that observed for the yield of sup(210)Po from a (p,πsup(O)) reaction on sup(209)Bi, but radically different from that observed for inclusive πsup(-) reactions on a heavy nucleus. These data are discussed in terms of recent theoretical approaches to negative pion production from bismuth. In addition, a simple, schematic model is developed to treat the rapidly decreasing percentage of the total inclusive πsup(-) emission which is observed for this double charge exchange reaction. This model reflects the capacity of a nucleus to a source of internal energetic protons

  15. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    OpenAIRE

    BAYRAM, Ali

    1998-01-01

    In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 1...

  16. Human radiation studies: Remembering the early years: Oral history of Dr. Patricia Wallace Durbin, Ph.D., conducted November 11, 1994

    International Nuclear Information System (INIS)

    This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches

  17. AcEST: DK950316 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0008_F09 645 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_F09. 5' end seq ... VMGKGGVGKSSTVNSVIGEKAAAVS 67 Query: 194 AFQSETMRTVLCSR VRAGFTLNIIDTPGLVEGLFVNDHALDTIRRSLLNKTIDVMIYVDR 373 ... VMGKGGVGKSSTVNSIIGERVVSIS 68 Query: 194 AFQSETMRTVLCSR VRAGFTLNIIDTPGLVEGLFVNDHALDTIRRSLLNKTIDVMIYVDR 373 ... VLGKGGVGKSSTVNSLIGEQVVRVS 65 Query: 194 AFQSETMRTVLCSR VRAGFTLNIIDTPGLVEGLFVNDHALDTIRRSLLNKTIDVMIYVDR 373 ... (5%) Frame = +2 Query: 158 NSLVGERVAVVSAFQSETMRTVLCSR VRAGFTLNIIDTPGLVEGLF---VNDHALDTIRR 328 NS+ E AFQ T ...

  18. Contrasted evolutionary histories of two Toll-like receptors (Tlr4 and Tlr7) in wild rodents (MURINAE)

    Czech Academy of Sciences Publication Activity Database

    Fornůsková, Alena; Vinkler, M.; Pages, M.; Galan, M.; Jousselin, E.; Cerqueira, F.; Morand, S.; Charbonnel, N.; Bryja, Josef; Cosson, J.-F.

    2013-01-01

    Roč. 13, č. 194 (2013), s. 194. ISSN 1471-2148 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:68081766 Keywords : Arms race * Host-pathogen interaction * Pattern recognition receptors * Adaptive evolution * Pathogen-Associated Molecular Pattern (PAMP) Subject RIV: EG - Zoology Impact factor: 3.407, year: 2013 http://www.biomedcentral.com/1471-2148/13/194

  19. Dicty_cDB: Contig-U00979-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tttttttaatgaacnaa 134 Query: 135 naaattcnagtaaaatcnaaagagnttatgatattaccnatgntntaagnccnttaggtc 194 ||||||||||...|||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 135 naaattcnagtaaaatcnaaagagnttatgatattaccnatgntnt...) Strand = Plus / Minus Query: 125 aatgaacnaanaaattcnagtaaaatcnaaagagnttatgatattaccna...agtaaaatcnaaagagnttatgatattaccnatgntntaagn 25 Query: 185 ccnttaggtctaatccgnaaaac 207 |||||||||||||||||||||||

  20. 77 FR 3636 - Federal Acquisition Regulation; Brand-Name Specifications; Correction

    Science.gov (United States)

    2012-01-25

    ... at 77 FR 194 on January 3, 2012. DATES: Effective Date: February 2, 2012. FOR FURTHER INFORMATION..., which published in the Federal Register at 77 FR 189 on January 3, 2012. Correction In the final rule document appearing at 77 FR 189 on January 3, 2012, on page 194, first column, amendatory instruction...

  1. Pamjat teksta i tekst kak pamjat / Ülle Pärli

    Index Scriptorium Estoniae

    Pärli, Ülle

    1999-01-01

    Bibl. lk. 194. Kokkuvõtted eesti k. "Teksti mälu ja tekst kui mälu" ning inglise k. "The memory of a text and text as a memory", lk. 194-195. Jossif Brodski luuletusest "Järelsõna valmile" ("Posleslovije k basne")

  2. Drug: D10094 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D10094 Drug Blosozumab (USAN) C6424H9852N1684O2030S46 144538.6608 144628.0165 (Heavy chain) QVQL ... L194, L'23-L'88, L'134-L'194) Peptide Treatment of osteoporosis ... monoclonal antibody IgG4 sclerostin (SOST) [HSA:50 ...

  3. Cryopreservation of fungi using perlite

    Czech Academy of Sciences Publication Activity Database

    Homolka, Ladislav; Lisá, Ludmila

    Goslar: Springer, 2007, s. 194-194. [International Conference on Culture Collections /11./. Goslar (DE), 07.10.2007-11.10.2007] R&D Projects: GA MŠk LC06066 Institutional research plan: CEZ:AV0Z50200510 Keywords : cryopreservation Subject RIV: EE - Microbiology, Virology

  4. Drug: D10444 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D10444 Drug Lirilumab (USAN/INN) C6452H9918N1698O2030S46 145137.2203 145226.9339 (Heavy chain) Q ... -L88, L134-L194, L'23-L'88, L'134-L'194) (modified residues : H1', H1' Q=pyroglutamic acid [CPD:C01879]) (glyco ...

  5. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  6. A route for polonium 210 production from alpha-particle irradiated bismuth-209 target

    International Nuclear Information System (INIS)

    A method is proposed for production of polonium-210 via the 209Bi(α,3n)210 At nuclear reaction. Bombardment of a bismuth-209 target was performed with a 37 MeV alpha-particle beam that leads to the production of astatine-210 (T1/2 = 8.1 h), which decays to polonium-210. It is purified from the bismuth target matrix by employing liquid-liquid extraction using tributyl phosphate (TBP) in para-xylene from 7 M hydrochloric acid. Back extraction of polonium-210 was performed by 9 M nitric acid. This method allows to purify a tracer amount of Po-210 (2.6 x 10-13 mol) from macroscopic amount of Bi (2.8 x 10-2 mol).

  7. Effective bond orders from two-step spin–orbit coupling approaches: The I{sub 2}, At{sub 2}, IO{sup +}, and AtO{sup +} case studies

    Energy Technology Data Exchange (ETDEWEB)

    Maurice, Rémi, E-mail: remi.maurice@subatech.in2p3.fr; Montavon, Gilles [SUBATECH, CNRS UMR 6457, IN2P3/EMN Nantes/Université de Nantes, 4 rue Alfred Kastler, BP 20722, 44307 Nantes Cedex 3 (France); Réal, Florent; Gomes, André Severo Pereira; Vallet, Valérie [Laboratoire PhLAM, CNRS UMR 8523, Université de Lille, 59655 Villeneuve d’Ascq Cedex (France); Galland, Nicolas [CEISAM, UMR CNRS 6230, Université de Nantes, 2 rue de la Houssinière, BP 92208, 44322 Nantes Cedex 3 (France)

    2015-03-07

    The nature of chemical bonds in heavy main-group diatomics is discussed from the viewpoint of effective bond orders, which are computed from spin–orbit wave functions resulting from spin–orbit configuration interaction calculations. The reliability of the relativistic correlated wave functions obtained in such two-step spin–orbit coupling frameworks is assessed by benchmark studies of the spectroscopic constants with respect to either experimental data, or state-of-the-art fully relativistic correlated calculations. The I{sub 2}, At{sub 2}, IO{sup +}, and AtO{sup +} species are considered, and differences and similarities between the astatine and iodine elements are highlighted. In particular, we demonstrate that spin–orbit coupling weakens the covalent character of the bond in At{sub 2} even more than electron correlation, making the consideration of spin–orbit coupling compulsory for discussing chemical bonding in heavy (6p) main group element systems.

  8. Effective bond orders from two-step spin–orbit coupling approaches: The I2, At2, IO+, and AtO+ case studies

    International Nuclear Information System (INIS)

    The nature of chemical bonds in heavy main-group diatomics is discussed from the viewpoint of effective bond orders, which are computed from spin–orbit wave functions resulting from spin–orbit configuration interaction calculations. The reliability of the relativistic correlated wave functions obtained in such two-step spin–orbit coupling frameworks is assessed by benchmark studies of the spectroscopic constants with respect to either experimental data, or state-of-the-art fully relativistic correlated calculations. The I2, At2, IO+, and AtO+ species are considered, and differences and similarities between the astatine and iodine elements are highlighted. In particular, we demonstrate that spin–orbit coupling weakens the covalent character of the bond in At2 even more than electron correlation, making the consideration of spin–orbit coupling compulsory for discussing chemical bonding in heavy (6p) main group element systems

  9. Different ways to improve the clinical effectiveness of radioimmunotherapy in solid tumors

    Directory of Open Access Journals (Sweden)

    Chatal Jean-Francois

    2009-09-01

    Full Text Available Radioimmunotherapy (RIT has been proven effective in the treatment of radiosensitive non-Hodgkin lymphoma but, for radioresistant solid tumors, new approaches are necessary to improve the clinical effectiveness. A real improvement has been the introduction of the pretargeting technology which appeared to be able to significantly increase tumor-to-normal organ uptake ratios.Another very promising approach consists in associating RIT with other treatment modalities. Finally the use of alpha particle-emitting radionuclides such as astatin-211 or bismuth-213 (alpha-RIT should allow to efficiently eradicate disseminated microscopic clusters of tumor cells or isolated tumor cells which fit well with the short path length of alpha particles.

  10. Sequential radioimmunotherapy with 177Lu- and 211At-labeled monoclonal antibody BR96 in a syngeneic rat colon carcinoma model

    DEFF Research Database (Denmark)

    Eriksson, Sophie E; Elgström, Erika; Bäck, Tom;

    2014-01-01

    UNLABELLED: Alpha-particle emitters, such as astatine-211 (211At), are generally considered suitable for the treatment of small cell clusters due to their short path length, while beta-particle emitters, for example, Lutetium-177 (177Lu), have a longer path length and are considered better for...... small, established tumors. A combination of such radionuclides may be successful in regimens of radioimmunotherapy. In this study, rats were treated by sequential administration of first a 177Lu-labeled antibody, followed by a 211At-labeled antibody 25 days later. METHODS: Rats bearing solid colon...... carcinoma tumors were treated with 400 MBq/kg body weight 177Lu-BR96. After 25 days, three groups of animals were given either 5 or 10 MBq/kg body weight of 211At-BR96 simultaneously with or without a blocking agent reducing halogen uptake in normal tissues. Control animals were not given any 211At-BR96...

  11. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  12. Development of 211At Chemistry for Labelling Biomolecules

    International Nuclear Information System (INIS)

    Our studies have demonstrated that high recovery of 211At can be obtained using a “wet chemistry” approach to isolation from the bismuth target. We have also demonstrated that direct labelling of antibody-B10 conjugates with 211At can be performed in high yields, and that the astatinated antibodies are stable to in vivo deastatination. While these results will allow us to enter clinical studies with 211At-labelled antibodies, the chemistry associated with 211At is not fully understood. Therefore, it is important that many more basic studies to be conducted with 211At, so the optimal labelling reagent for each type of disease-targeting agent becomes apparent

  13. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena;

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... levels of γH2AX decreased during the first 24h in both cycling and stationary cultures and complete repair was seen in all cultures but cycling cells exposed to (211)At. Compared to stationary cells alpha particles were more harmful for cycling cultures, an effect also seen at the pChk2 levels...... cultures at a modest level of damage, clearly demonstrating that cell cycle status influences the relative effectiveness of alpha particles....

  14. An improved synthesis of an 125I and 211At labelled benzamide for melanoma imaging

    International Nuclear Information System (INIS)

    Recent studies have indicated that benzamides can exhibit affinity for malignant melanoma and may be exploited diagnostically in the treatment of this cancer. Radioiodinated N-(2-diethylaminoethyl)-3-[123I/131I]iodo-4-methoxybenzamide (*I-IMBA) is a benzamide with promising diagnostic properties. A new synthesis procedure was developed to obtain 125I-IMBA suitable for use in vivo. The assets of the procedure include the use of less toxic reagents and better reproducible results when radiolabelling the precursor. The procedure also facilitates the synthesis of the astatinated N-(2-diethylaminoethyl)-3-[211At]astatine-4-methoxybenzamide (211At-AMBA), a new benzamide with a therapeutic potential. The regiospecific no-carrier-added 125I- and 211At-labeling of the benzamide is performed by demetalation of an organotin precursor. Using tributylstannyl as a leaving group, the radiochemical yield obtained after 15 minutes of reaction was 70 %-90 % for both 125I-IMBA and 211At-AMBA. The labelling was performed in a solution of MeOH:AcOH with NCS as the oxidising agent. The organotin precursor N-(2-diethylaminoethyl)-3-(tri-n-butylstannyl)-4-methoxy-benzamide was synthesized from 3-bromo-4-methoxybenzoic acid, with n-BuLi (2 eq) and Bu3SnCl (1 eq) in THF, giving 3-(tri-n-butylstannyl)-4-methoxybenzoic acid. The amide function was introduced by converting the acid group into an active N-succinimidyl-ester, a good leaving group in the reaction with 2-(diethylamino)ethylamine. The overall yield of the organotin precursor was 65 %

  15. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Energy Technology Data Exchange (ETDEWEB)

    Marsh, B.A., E-mail: bruce.marsh@cern.ch [CERN, CH-1211 Geneva (Switzerland); Andel, B. [Comenius University, Bratislava (Slovakia); Andreyev, A.N. [University of York, Department of Physics, York YO10 5DD (United Kingdom); Antalic, S. [Comenius University, Bratislava (Slovakia); Atanasov, D. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Barzakh, A.E. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, 188300 Gatchina (Russian Federation); Bastin, B. [Grand Accérateur National d’Ions Lourds (GANIL), Bd Henri Becquerel, F-14076 Caen (France); Borgmann, Ch. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Capponi, L. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Cocolios, T.E.; Day Goodacre, T. [CERN, CH-1211 Geneva (Switzerland); University of Manchester, Manchester (United Kingdom); Dehairs, M. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Derkx, X. [University of the West of Scotland, School of Engineering, Paisley PA1 2BE (United Kingdom); De Witte, H. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fedorov, D.V. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, 188300 Gatchina (Russian Federation); Fedosseev, V.N.; Focker, G.J. [CERN, CH-1211 Geneva (Switzerland); Fink, D.A. [Ruprecht-Karls Universität, Seminarstr. 2, 69117 Heidelberg (Germany); CERN, CH-1211 Geneva (Switzerland); Flanagan, K.T. [University of Manchester, Manchester (United Kingdom); Franchoo, S. [CSNSM-IN2P3-CNRS, Université Paris-Sud, 91406 Orsay (France); and others

    2013-12-15

    Highlights: • Upgrade of the lasers, detectors and data acquisition for in-source resonance ionization spectroscopy at ISOLDE. • First use of the ISOLTRAP MR-ToF MS in combination with laser spectroscopy at ISOLDE. • Resonance ionization of astatine for the study of its nuclear structure. -- Abstract: At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  16. Stabilizing additives for CWM and their molecular conformation

    Energy Technology Data Exchange (ETDEWEB)

    Saeki, T.; Usui, H. (Yamaguchi University, Yamaguchi (Japan). Dept. of Chemical Engineering)

    1994-01-01

    Description is presented of an investigation aimed at finding a suitable molecular structure of stabilizing additives for coal-water mixtures. Rheological characteristics and stability of CWMs with different additives (bio-polysaccharides S-60, S-130 and S-194) were measured. Although these additives have almost the same length of molecular chains, they have different size of ramified chains (branches). The experimental results showed that S-194, which has long branches, and S-60, which has no branches, were both effective to increase the stability. However, the stabilizing mechanisms of S-60 and S-194 were considered to be different. 11 refs., 6 figs., 1 tab.

  17. Dicty_cDB: Contig-U13509-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 78 Start point 4427081 End point 4426057 Strand (PLUS/MINUS) MINUS Number of clones 2 Number of EST 2 Link t... 0.0 Identities = 487/487 (100%) Strand = Plus / Plus Query: 431 tactacttcaacaaccacaccatcaaacagtttatttggaaca...17 Score = 385 bits (194), Expect = e-107 Identities = 194/194 (100%) Strand = Plus / Plus Query: 200 aacatc... = 137 bits (69), Expect = 3e-32 Identities = 69/69 (100%) Strand = Plus / Plus Q...pect = 3e-29 Identities = 73/73 (100%) Strand = Plus / Plus Query: 953 ttctaccacctcaacaaccaccacaccatnaactggn

  18. Theoretical analysis of an Uqp(u2) model for the congruent superdeformed rotational bands

    International Nuclear Information System (INIS)

    Superdeformed rotational bands in 191-192-193-194Hg are analyzed by means of the Uqp(u2) model. An overall and excellent agreement between the calculated and observed spectra Eγ, kinematic moment of inertia J(1) and dynamic moment of inertia J(2), the aligned angular momentum (i = ω (J(1)(191-193-194Hg)-J(1)(192Hg))) is obtained. Further more, the nuclear softness in 191-192-193-194Hg are calculated by means of the Uqp(u2) model and drawn into the nuclear configuration analysis

  19. Plasmid transduction by Bacillus subtilis bacteriophage SPP1: effects of DNA homology between plasmid and bacteriophage.

    OpenAIRE

    Deichelbohrer, I; Alonso, J.C.; Lüder, G; Trautner, T A

    1985-01-01

    Any SPP1 DNA restriction fragment cloned into Bacillus subtilis plasmid pC194 or pUB110 increased the transduction frequency of the plasmid by SPP1 100- to 1,000-fold over the transduction level of the plasmid alone. This increment was observed irrespective of whether a fragment contained the SPP1 packaging origin (pac). Furthermore, an SPP1 derivative into whose genome pC194 DNA had been integrated transduced pC194 DNA with a greatly enhanced frequency. Transduction enhancement mediated by D...

  20. Innovaatiline mõtlemine nõuab juhilt julgust kastist välja tulla / Alexander Kotchubei

    Index Scriptorium Estoniae

    Kotchubei, Alexander, 1963-

    2005-01-01

    Ilmunud ka: Juhi ideelaegas. - Tallinn, 2006, lk. 194-196. Uuenduslikkuse aluseks on konkurentidest efektiivsem mõtlemine. Vt. samas: Tänapäeva juht peab olema avatud ja riskijulge; Uusi ideid soodustavad muudatused mõtteviisis

  1. Kardinální ctnosti v Husově Komentáři Sentencí

    Czech Academy of Sciences Publication Activity Database

    Machula, Tomáš

    2015-01-01

    Roč. 17, č. 4 (2015), s. 185-194. ISSN 1212-8570 Institutional support: RVO:67985955 Keywords : Hus * cardinal virtues * moral virtues * commentary on the Sentences * ethics Subject RIV: AA - Philosophy ; Religion

  2. Speckles of cryptic black-headed gull eggs show no mechanical or conductance structural function

    Czech Academy of Sciences Publication Activity Database

    Maurer, G.; Portugal, S. J.; Mikšík, Ivan; Cassey, P.

    2011-01-01

    Roč. 285, č. 3 (2011), s. 194-204. ISSN 0952-8369 Institutional research plan: CEZ:AV0Z50110509 Keywords : eggshell * pigmentation * porphyrin Subject RIV: ED - Physiology Impact factor: 2.043, year: 2011

  3. Eimuntas Nekroshiuse teatripoeetika / Ruta Mazheikiene ; tõlk. Tiina Kattel

    Index Scriptorium Estoniae

    Mazheikiene, Ruta

    2004-01-01

    E. Nekroshiuse lavastustele iseloomulikest joontest, toetudes tema lavastustele "Hamlet" "Macbeth", "Othello", "Onu Vanja", "Nina". Samuti näitlejatega töötamise strateegiast. Kasut. kirjandus, lk. 194-195

  4. Dicty_cDB: Contig-U10492-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d = Plus / Plus Query: 14 aaaacncttggtttnaacatgcttcaaangccnttcatcatttatccnttcannnnnnna 7...gccnttcatcatttatccnttcattttntta 73 Query: 74 cgtcaattaagnggnganacaaatntactcgttgangntggngccctttggnttaana...at 133 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 74 cgtcaattaagnggnganacaaatntactcgttgan...ggccgatccntattatattttaccnttagnatnttcaattttccaanatggn 193 Query: 194 tccgttngtttntcaangnctgatganactagnccaatgatgaaaacna...gnctgatganactagnccaatgatgaaaacnattangncttcn 253 Query: 254 ttttgntttttacccttagnttttac

  5. Breast Cancer Basics and You: Introduction | NIH MedlinePlus the Magazine

    Science.gov (United States)

    ... of this page please turn Javascript on. Feature: Breast Cancer Breast Cancer Basics and You: Introduction Past Issues / Spring - Summer ... were more than 194,000 new cases of breast cancer in the United States in 2009. More than ...

  6. Lengyelské sídliště staršího stupně z Ostrožské Lhoty (okr. Uherské Hradiště)

    Czech Academy of Sciences Publication Activity Database

    Válek, D.; Kuča, M.; Nývltová Fišáková, Miriam; Vaškových, M.

    2012-01-01

    Roč. 53, č. 1 (2012), s. 169-194. ISSN 0583-5569 Institutional research plan: CEZ:AV0Z80010507 Keywords : Lengyel culture * settlement * stone industry Subject RIV: AC - Archeology, Anthropology, Ethnology

  7. Hodnocení státní podpory stavebního spoření: dopad na úspory a příjmovou nerovnost

    Czech Academy of Sciences Publication Activity Database

    Dušek, Libor; Janský, Petr

    2012-01-01

    Roč. 60, č. 10 (2012), s. 991-1004. ISSN 0013-3035 Institutional support: RVO:67985998 Keywords : building savings * Czech Republic * evidence-based policy Subject RIV: AH - Economics Impact factor: 0.194, year: 2012

  8. Diomedovo pojednání o dramatickém básnictví

    Czech Academy of Sciences Publication Activity Database

    Sarkissian, Alena

    -, č. 3 (2008), s. 194-202. ISSN 0862-5409 Institutional research plan: CEZ:AV0Z90090514 Keywords : ancient theatre * Codex Theodosianus * canon * mime * pantomime Subject RIV: AA - Philosophy ; Religion

  9. AcEST: BP915384 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000070_H04 433 Adiantum capillus-veneris mRNA. clone: YMU001_000070_H04. BP915384 CL3734C ... THEERELLEK 349 Query: 183 LASL 194 LA + Sbjct: 350 LAKI ... 353 >sp|Q7UA76|DNAJ_SYNPX Chaperone protein dnaJ O ... IPEERELLEK 353 Query: 183 LASL 194 LA + Sbjct: 354 LAKI ... 357 >sp|Q8YUA5|DNAJ_ANASP Chaperone protein dnaJ O ... IPEERELLEK 353 Query: 183 LASL 194 LA + Sbjct: 354 LAKI ... 357 >sp|Q7V9C8|DNAJ_PROMM Chaperone protein dnaJ O ... TPEEKELLEK 349 Query: 183 LASL 194 LA + Sbjct: 350 LAKI ... 353 TrEMBL (release 39.9) Link to BlastX Result : ...

  10. Modeling geochemical datasets for source apportionment: Comparison of least square regression and inversion approaches.

    Digital Repository Service at National Institute of Oceanography (India)

    Tripathy, G.R.; Das, Anirban.

    . Analysis of different modes of factor analysis as least squares fit problems. Chemometrics and Intelligent Laboratory Systems 18, 183–194. Paatero, P., 1997. Least squares formulation of robust non-negative factor analysis. Chemometrics and Intelligent...

  11. Epstein-Barr Virus Neurologic Complications

    Directory of Open Access Journals (Sweden)

    J. Gordon Millichap

    2015-12-01

    Full Text Available Investigators at the Karol Marcinkowski University of Medical Sciences, Poznan, Poland, analyzed the records of 194 children diagnosed with Epstein-Barr virus infection and having the viral capsid antigen IgM antibody.

  12. First indication of population of superdeformed states by incomplete fusion reactions

    International Nuclear Information System (INIS)

    The high-spin normally deformed and superdeformed states of 194Hg have been populated in an exit channel of the 16O+186W reaction at 110 MeV bombarding energy. The Doppler shift analysis of the energies of the γ transitions de-exciting both normally deformed and superdeformed states in 194Hg indicates a lower recoil velocity of the 194Hg nucleus compared to that of the 196Pb nucleus obtained from the 6n exit channel of the complete-fusion compound nucleus. This suggests that incomplete fusion plays the main role in the population of normally deformed and superdeformed states of 194Hg in this reaction. copyright 1997 The American Physical Society

  13. Thermo-Mechanical Anomaly Developed in Metals under Elastic Stress

    Czech Academy of Sciences Publication Activity Database

    Pekárek, Viktor

    2005-01-01

    Roč. 50, č. 2 (2005), s. 177-194. ISSN 0001-7043 Institutional research plan: CEZ:AV0Z20570509 Keywords : elastic deformations * temperature changes * thermal dilatations Subject RIV: BM - Solid Matter Physics ; Magnetism

  14. UniProt search blastx result: AK289070 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK289070 J090094F22 P27502|POL_RTBVP Polyprotein (P194 protein) [Contains: Coat protein; Proteas ... .1.26.4)] - Rice tungro bacilliform virus (isolate Philippines ) (RTBV) 6.00E-27 ...

  15. 76 FR 10073 - Self-Regulatory Organizations; NYSE Arca, Inc.; Order Granting Approval of Proposed Rule Change...

    Science.gov (United States)

    2011-02-23

    .... \\3\\ See Securities Exchange Act Release No. 63609 (December 27, 2010), 76 FR 194 (``Notice''). \\4\\ In... developing/emerging market economies in Asia, primarily China, Hong Kong, India, Indonesia, South...

  16. K pojmu psychospirituální krize

    Czech Academy of Sciences Publication Activity Database

    Říčan, Pavel

    2012-01-01

    Roč. 56, č. 2 (2012), s. 194-196. ISSN 0009-062X Institutional support: RVO:68081740 Keywords : psychospiritual crisis * spirituality * transpersonal psychology Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012

  17. 75 FR 33669 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-06-14

    .... Title: LR-189-80 (T.D. 7927) Final Amortization of Reforestation Expenditures Abstract: 26 U.S.C. 194(a) allows taxpayers to elect to amortize certain reforestation expenditures over a 7-year period if...

  18. 83 šle (Heslo v atlase)

    Czech Academy of Sciences Publication Activity Database

    Balhar, Jan

    1. dotisk. Praha : Academia, 2004, s. 192-194 ISBN 80-200-0014-3 Institutional research plan: CEZ:AV0Z9061902 Keywords : Czech dialectology * geolinguistics * lexical differences Subject RIV: AI - Linguistics

  19. Fire Management Plan: Upper Mississippi River National Wildlife and Fish Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Upper Mississippi River National Wildlife and Fish Refuge consists of approximately 194,000 acres of wooded islands, waters and marshes extending southward...

  20. Dicósimo, Daniel y Simonassi, Silvia (comp., Trabajadores y empresarios en la Argentina del siglo XX: indagaciones desde la historia social

    Directory of Open Access Journals (Sweden)

    Valeria Ianni

    2013-01-01

    Full Text Available Dicósimo, Daniel y Simonassi, Silvia (comp., Trabajadores y empresarios en la Argentina del siglo XX: indagaciones desde la historia social, Prohistoria ediciones, Rosario, 2011 (194 págs..

  1. Inoculum of arbuscular mycorrhizal fungi for production systems: science meets business

    Czech Academy of Sciences Publication Activity Database

    Gianinazzi, S.; Vosátka, Miroslav

    2004-01-01

    Roč. 82, - (2004), s. 1264-1271. ISSN 0008-4026 Institutional research plan: CEZ:AV0Z6005908 Keywords : Inoculum production * mycorrhiza applications Subject RIV: EF - Botanics Impact factor: 1.194, year: 2004

  2. Funkce vlastních jmen v literatuře a literární onomastika

    Czech Academy of Sciences Publication Activity Database

    Dvořáková, Žaneta

    2012-01-01

    Roč. 73, č. 3 (2012), s. 194-207. ISSN 0037-7031 Institutional support: RVO:68378092 Keywords : literary onomastics * proper names * functions of proper names Subject RIV: AI - Linguistics Impact factor: 0.233, year: 2012

  3. Structure and function of cyanobacterial mats in wetlands of Belize

    Czech Academy of Sciences Publication Activity Database

    Komárek, Jiří; Sirová, D.; Komárková-Legnerová, Jaroslava; Rejmánková, E.

    Boca Raton : CRC Press, 2015 - (Entry, J.; Gottlieb, A.; Jayachandran, K.; Ogram, A.), 194-217 ISBN 978-1-4987-1183-8 Institutional support: RVO:67985939 ; RVO:60077344 Keywords : Belize * swamps * cyanobacterial mats Subject RIV: EF - Botanics

  4. Biophysical approach to low back pain: a pilot report

    Czech Academy of Sciences Publication Activity Database

    Foletti, A.; Pokorný, Jiří

    2015-01-01

    Roč. 34, č. 2 (2015), s. 156-159. ISSN 1536-8378 Institutional support: RVO:67985882 Keywords : Bioelectromagnetic medicine * Biophysical therapy * Coherence domains Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.194, year: 2014

  5. New supersymmetric quartet of nuclei in the A∼190 mass region

    International Nuclear Information System (INIS)

    We present evidence for a new supersymmetric quartet in the A∼190 region of the nuclear mass table. New experimental information on transfer and neutron capture reactions to the odd-odd nucleus 194Ir strongly suggests the existence of a new supersymmetric quartet, consisting of the 192,193Os and 193,194Ir nuclei. We make explicit predictions for the odd-neutron nucleus 193Os and suggest that its spectroscopic properties be measured in dedicated experiments

  6. A prospective study of XRCC1 haplotypes and their interaction with plasma carotenoids on breast cancer risk

    Energy Technology Data Exchange (ETDEWEB)

    Mohrenweiser, H W; Han, J; Hankinson, S E; De Vivo, I; Spiegelman, D; Tamimi, R M; Colditz, G A; Hunter, D J

    2004-01-15

    The XRCC1 protein is involved in the base excision repair pathway through interactions with other proteins. Polymorphisms in the XRCC1 gene may lead to variation in repair proficiency and confer inherited predisposition to cancer. We prospectively assessed the associations between polymorphisms and haplotypes in XRCC1 and breast cancer risk in a nested case-control study within the Nurses' Health Study (incident cases, n 1004; controls, n 1385). We further investigated gene-environment interactions between the XRCC1 variations and plasma carotenoids on breast cancer risk. We genotyped four haplotype-tagging single nucleotide polymorphisms Arg {sup 194}Trp, C26602T, Arg{sup 399}Gln, and Gln{sup 632}Gln in the XRCC1 gene. Five common haplotypes accounted for 99% of the chromosomes in the present study population of mostly Caucasian women. We observed a marginally significant reduction in the risk of breast cancer among {sup 194}Trp carriers. As compared with no-carriers, women with at least one {sup 194}Trp allele had a multivariate odds ratio of 0.79 (95% of the confidence interval, 0.60 -1.04). The inferred haplotype harboring the {sup 194}Trp allele was more common in controls than in cases (6.6 versus 5.3%, P 0.07). We observed that the Arg {sup 194}Trp modified the inverse associations of plasma -carotene level (P, ordinal test for interaction 0.02) and plasma -carotene level (P, ordinal test for interaction 0.003) with breast cancer risk. No suggestion of an interaction was observed between the Arg {sup 194}Trp and cigarette smoking. Our results suggest an inverse association between XRCC1 {sup 194}Trp allele and breast cancer risk. The findings of the effect modification of the Arg {sup 194}Trp on the relations of plasma -and -carotene levels with breast cancer risk suggest a potential protective effect of carotenoids in breast carcinogenesis by preventing oxidative DNA damage.

  7. An anti-HIV-1 V3 loop antibody fully protects cross-clade and elicits T-cell immunity in macaques mucosally challenged with an R5 clade C SHIV.

    Directory of Open Access Journals (Sweden)

    Jennifer D Watkins

    Full Text Available Neutralizing antibodies have been shown to protect macaques against SHIV challenge. However, genetically diverse HIV-1 clades have evolved, and a key question left unanswered is whether neutralizing antibodies can confer cross-clade protection in vivo. The novel human monoclonal antibody HGN194 was isolated from an individual infected with an HIV-1 clade AG recombinant circulating recombinant form (CRF. HGN194 targets an epitope in the third hypervariable loop (V3 of HIV-1 gp120 and neutralizes a range of relatively neutralization-sensitive and resistant viruses. We evaluated the potential of HGN194 to protect infant rhesus monkeys against a SHIV encoding a primary CCR5-tropic HIV-1 clade C envelope. After high-dose mucosal challenge, all untreated controls became highly viremic while all HGN194-treated animals (50 mg/kg were completely protected. When HGN194 was given at 1 mg/kg, one out of two monkeys remained aviremic, whereas the other had delayed, lower peak viremia. Interestingly, all protected monkeys given high-dose HGN194 developed Gag-specific proliferative responses of both CD4+ and CD8+ T cells. To test whether generation of the latter involved cryptic infection, we ablated CD8+ cells after HGN194 clearance. No viremia was detected in any protected monkeys, thus ruling out virus reservoirs. Thus, induction of CD8 T-cell immunity may have resulted from transient "Hit and Run" infection or cross priming via Ag-Ab-mediated cross-presentation. Together, our data identified the HGN194 epitope as protective and provide proof-of-concept that this anti-V3 loop mAb can prevent infection with sterilizing immunity after challenge with virus of a different clade, implying that V3 is a potential vaccine target.

  8. Dicty_cDB: Contig-U09412-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ||||||||||||||| Sbjct: 283 tgatgttactttttgtggtccattcttannnnnnnnnntttaggtcgtgtattattaatt 342 Query: 343 gatcttgtaaatagtttagttgtaaaaata...dentities = 198/198 (100%) Strand = Plus / Plus Query: 1 attatcacaactattttataataaaccaattttaaagatta...(164), Expect = 5e-89 Identities = 194/194 (100%) Strand = Plus / Plus Query: 223 aggtgaaaacaatttatcatttaaaaaatggacattaggtaat...ttaaaaaatggacattaggtaattcagttgatagaataaa 282 Query: 283 tgatgttactttttgtggtccat...oarchaeum equitans Kin4-M, complete genome. 54 0.009 1 ( AF130844 ) Homo sapiens ZNF127AS gene, putative 3' untran

  9. Dicty_cDB: Contig-U13988-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iac ryanodine receptor (R... 48 0.84 1 ( M59743 ) Rabbit cardiac muscle Ca-2+ release cha............................done Score E Sequences producing significant alignments: (bits) Value N ( AC116551 ) Dictyostelium disco...tatgatcaccaaaata 688 Score = 367 bits (185), Expect = e-101 Identities = 194/194 (100%) ...gtaa 1297 |||||||||||||| Sbjct: 1284 aaatacaccagtaa 1297 Score = 299 bits (151), Expect =...attataaaacc-aaatccagttgtaacaaatacaccagtaa 1325 Score = 36.2 bits (18), Expect = 0.092

  10. Interferon production and immune response induction in pathogenic rabies virus-infected mice

    International Nuclear Information System (INIS)

    Pathogenic parental rabies virus strain CVS (challenge virus standard) and its apathogenic variant RV194-2 were shown to differ in their ability to induce interferon (IFN) and immune response of the host. After intracerebral inoculation. IFN and antibody production was higher in the RV194-2 virus-infected mice than in the CVS infection. The enhancement of 2-5A synthetase activity, an IFN-mediated enzyme marker, showed biochemical evidence that IFN is active in both apathogenic and pathogenic infections. On the other hand, spontaneous proliferation in vitro of thymocytes and splenocytes from CVS virus-infected mice was strongly inhibited in contrast to the RV194-2 infection. In the CVS infection, the thymocyte proliferation However, in the RV194-2 infection, the thymocyte proliferation was higher than of the splenocytes. These results suggest a better performance of T-cell response to the RV194-2 infection. This fact can be critical for an enhancement of antibody production in the apathogenic infection and subsequent virus clearance from the brain of RV194-2 virus-infected mice. (author)

  11. Properties of Nuclear Superdeformed Rotational Bands in A~190 Mass Region

    Directory of Open Access Journals (Sweden)

    Khalaf A. M.

    2014-10-01

    Full Text Available Two-parameters formula based on the conventional collective rotational model is ap- plied to describe superdeformed rotational bands (SDRB’s in nuclei in the A 190 mass region, namely the five SDRB’s 192 Hg(SD1, 194 Hg(SD1, 194 Hg(SD2, 194 Pb(SD1 and 194 Pb(SD2. The bandhead spins of the observed levels have been ex- tracted by first and second-hand estimation corresponding to pure rotator and our pro- posed formula respectively by plotting the E-Gamma Over Spin (EGOS versus spin. A computer simulated search program is used to extract the model parameters in order to obtain a minimum root mean square (rms deviation between the calculated and the experimental transition energies The values of spins resulting from second estimation method are excellent consistent with spin assignment of other models. The calculated transition energies, level spins, rotational frequencies, kinematic and dynamic moments of inertia are systematically examined. The di ff erence in - ray transition energies ∆ E between transitions in the two isotones 192 Hg(SD1 and 194 Pb(SD1 were small and con- stant up to rotational frequency ℏ ! 0.25 MeV. Therefore, these two bands have been considered as identical bands. The ∆ I = 2 energy staggering observed in 194 Hg(SD1 and 194 Hg(SD2 of our selected SDRB’s are also described from a smooth reference representing the finite difference approximation to the fourth order derivative of the transition energies at a given spin.

  12. Inhibition of Metastatic Potential in Breast Carcinoma In Vivo and In Vitro through Targeting VEGFRs and FGFRs

    Directory of Open Access Journals (Sweden)

    Ming-Hsien Chien

    2013-01-01

    Full Text Available Angiogenesis and lymphangiogenesis are considered to play key roles in tumor metastasis. Targeting receptor tyrosine kinases essentially involved in the angiogenesis and lymphangiogenesis would theoretically prevent cancer metastasis. However, the optimal multikinase inhibitor for metastasis suppression has yet to be developed. In this study, we evaluated the effect of NSTPBP 0100194-A (194-A, a multikinase inhibitor of vascular endothelial growth factor receptors (VEGFRs/fibroblast growth factor receptors (FGFRs, on lymphangiogenesis and angiogenesis in a mammary fat pad xenograft model of the highly invasive breast cancer cell line 4T1-Luc+. We investigated the biologic effect of 194-A on various invasive breast cancer cell lines as well as endothelial and lymphatic endothelial cells. Intriguingly, we found that 194-A drastically reduced the formation of lung, liver, and lymph node metastasis of 4T1-Luc+ and decreased primary tumor growth. This was associated with significant reductions in intratumoral lymphatic vessel length (LVL and microvessel density (MVD. 194-A blocked VEGFRs mediated signaling on both endothelial and lymphatic endothelial cells. Moreover, 194-A significantly inhibited the invasive capacity induced by VEGF-C or FGF-2 in vitro in both 4T1 and MDA-MB231 cells. In conclusion, these experimental results demonstrate that simultaneous inhibition of VEGFRs/FGFRs kinases may be a promising strategy to prevent breast cancer metastasis.

  13. Search for new candidates for the neutrino-oriented mass determination by electron-capture

    CERN Multimedia

    Herfurth, F; Boehm, C; Blaum, K; Beck, D

    2008-01-01

    This proposal is part of an extended program dedicated to the neutrino-mass determination in the electron-capture sector, which aims at ultra-precise mass measurements by Penning traps in combination with cryogenic micro-calorimetry for atomic de-excitation measurements. Here, precise mass measurements with ISOLTRAP are proposed for the orbital electron-capture nuclides $^{194}$Hg and $^{202}$Pb, as well as their daughters, with the goal to determine accurately their Q-values. These values are expected to be the smallest ones among a great variety of known electron-capture precursors. Therefore, these nuclides are strong candidates for an improved electron-neutrino mass determination. We ask for 8 shifts of on-line beam at ISOLDE for mass measurements of $^{194}$Hg, $^{194}$ Au, $^{202}$Pb, and $^{202}$Tl at ISOLTRAP.

  14. Studies of exotic modes of fission in the lead region

    International Nuclear Information System (INIS)

    In a series of complementary experiments at the tandem of JAEA and at the mass-separator ISOLDE (CERN), new fission phenomena in the lead region of the chart of nuclei were investigated. At ISOLDE, the low-energy fission of 194,196Po was studied via the process of beta-delayed fission of the parent 194,196At nuclei. A multi-modal fission fragment mass split was observed for 194,196Po. At JAEA the higher-energy fusion-fission studies of 198Hg, 191,193Ir were performed in reactions with protons and 7Li. In the JAEA experiment, we observed a transition from mass-symmetric to mass asymmetric fission between 189Ir and 193Ir. By studying fission in these regions, we investigate the new evolution of shell structure to regulate fission (as far as fission is concerned) of the chart of nuclides. (author)

  15. Superelasticity of TiPdNi Alloys with and without Rare Earth Ce Addition

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    Ti50.6Pda0Ni19.4 and Ti51Pd2sNi21 (Ce) alloys have been prepared under various temperatures for long time annealing. Differential scanning calorimetery (DSC), X-ray diffraction (XRD) and tensile test were employed to investigate the phase transformation behavior and superelasticity of the alloys. It has been found that the phase transformation temperature of Ti50.6Pd30Ni19.4 is about 40℃ higher than that of Ti51Pd28Ni21(Ce), and do not change much with different annealed temperature. Obvious superelasticity is retained in Ti50.6Pd30Ni19.4 alloy annealed at 400℃ for 18 h, and annealing at higher temperature shows a deterioration of this property. The Ce addition in Ti51Pd28Ni21 alloy significantly delays recrystallization, increases yied strength and elastic modulus, but the superelasticity is poor.

  16. Mass spectrometry and decay spectroscopy of isomers across the Z=82 shell closure

    Science.gov (United States)

    Stanja, J.; Borgmann, Ch.; Agramunt, J.; Algora, A.; Beck, D.; Blaum, K.; Böhm, Ch.; Breitenfeldt, M.; Cocolios, T. E.; Fraile, L. M.; Herfurth, F.; Herlert, A.; Kowalska, M.; Kreim, S.; Lunney, D.; Manea, V.; Minaya Ramirez, E.; Naimi, S.; Neidherr, D.; Rosenbusch, M.; Schweikhard, L.; Simpson, G.; Wienholtz, F.; Wolf, R. N.; Zuber, K.

    2013-11-01

    Recent results from a measurement campaign studying the isomerism in neutron-deficient Tl isotopes are presented. The measurements make use of a nuclear spectroscopy setup coupled to the high-resolution Penning-trap mass spectrometer ISOLTRAP at CERN's radioactive ion-beam facility ISOLDE. The mass values of 190,194Tl are improved and a mass-spin-state assignment is carried out. An additional mass measurement of the grandparent nuclide 198At allows the deduction of the spin-state ordering in 190Tl. As a result, the excitation energies of the isomers in both Tl isotopes are determined for the first time to Eex(194Tl)=260(15) keV and Eex(190Tl)=89(12) keV. Furthermore, this allows anchoring of the ground-state and isomer masses of 194Bi, 202Fr, and 206Ac, which are linked by two independent α-decay chains.

  17. An overview of the recent results on fission dynamics from the NAND facility

    Indian Academy of Sciences (India)

    B R Behera

    2015-08-01

    This paper summarizes the results of some of the recent fusion–fission experiments carried out at the National Array of Neutron Detectors (NAND) Phase-01 installed at the Pelletron+LINAC accelerator facility of Inter-University Accelerator Centre (IUAC), New Delhi. Pre-scission neutron multiplicity excitation functions are measured for the 213,215,217Fr, 210,212,214,216Rn and 206,210Po compound nuclei populated through the fusion of the 19F+194,196,198Pt, 16,18O+194,198Pt and 12C+194,198Pt systems, respectively. Pre-scission neutron yields from these reactions are compared with the extensive statistical model calculations to look for the effects due to the compound nucleus shell closure, / ratio of the compound nucleus, magnitude of the saddle-point shell corerction and fission time-scale.

  18. Modeling and Re-Engineering of Azotobacter vinelandii Alginate Lyase to Enhance Its Catalytic Efficiency for Accelerating Biofilm Degradation

    Science.gov (United States)

    Jang, Chul Ho; Piao, Yu Lan; Huang, Xiaoqin; Yoon, Eun Jeong; Park, So Hee; Lee, Kyoung; Zhan, Chang-Guo; Cho, Hoon

    2016-01-01

    Alginate is known to prevent elimination of Pseudomonas aeruginosa biofilms. Alginate lyase (AlgL) might therefore facilitate treatment of Pseudomonas aeruginosa-infected cystic fibrosis patients. However, the catalytic activity of wild-type AlgL is not sufficiently high. Therefore, molecular modeling and site-directed mutagenesis of AlgL might assist in enzyme engineering for therapeutic development. AlgL, isolated from Azotobacter vinelandii, catalyzes depolymerization of alginate via a β-elimination reaction. AlgL was modeled based on the crystal structure template of Sphingomonas AlgL species A1-III. Based on this computational analysis, AlgL was subjected to site-directed mutagenesis to improve its catalytic activity. The kcat/Km of the K194E mutant showed a nearly 5-fold increase against the acetylated alginate substrate, as compared to the wild-type. Double and triple mutants (K194E/K245D, K245D/K319A, K194E/K245D/E312D, and K194E/K245D/K319A) were also prepared. The most potent mutant was observed to be K194E/K245D/K319A, which has a 10-fold improved kcat value (against acetylated alginate) compared to the wild-type enzyme. The antibiofilm effect of both AlgL forms was identified in combination with piperacillin/tazobactam (PT) and the disruption effect was significantly higher in mutant AlgL combined with PT than wild-type AlgL. However, for both the wild-type and K194E/K245D/K319A mutant, the use of the AlgL enzyme alone did not show significant antibiofilm effect. PMID:27253324

  19. Evolution of fission-fragment mass distributions in the neutron-deficient lead region

    OpenAIRE

    Ghys, Lars; Andreyev, A.N.; Huyse, Mark; Van Duppen, Piet; Sels, Simon; Andel, B.; Antalic, S; Barzakh, A; Capponi, L.; Cocolios, Thomas Elias; Derkx, X.; De Witte, Hilde; J. Elseviers; Fedorov, D. V.; Fedosseev, V. N.

    2014-01-01

    Low-energy β-delayed fission of 194,196At and 200,202Fr was studied in detail at the mass separator ISOLDE at CERN. The fission-fragment mass distributions of daughter nuclei 194,196Po and 202Rn indicate a triple-humped structure, marking the transition between asymmetric fission of 178,180Hg and symmetric fission in the light Ra-Rn nuclei. Comparison with the macroscopic-microscopic finite-range liquid-drop model and the self-consistent approach employing the Gogny D1S energy den...

  20. AcEST: DK955197 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0022_H07 532 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_H07. 5' end seq ... KDEVTALPLLK 192 Query: 194 RFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLRARF 373 R+ F +AC+L S ... KDEVMALPLLK 192 Query: 194 RFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLRARF 373 R+ F +AC+L S ... KDEVKVLP 189 Query: 185 LMKRFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLR 364 L++ F IA L + +Q+ ... KDEATVLP 177 Query: 185 LMKRFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLR 364 L+K F +A L E+ QE ...

  1. Rheological properties and some applications for rhamsan and xanthan gum solutions

    Energy Technology Data Exchange (ETDEWEB)

    Podolsak, A.K.; Tiu, C.; Saeki, T.; Usui, H. [Monash University, Clayton, Vic. (Australia). Dept. of Chemical Engineering

    1996-07-01

    The rheological properties of solutions of xanthan gum (Kelzan D) and three rhamsan gums, S-60, S-130 and S-194, are examined. Effects studied include those of temperature, concentration and (for the rhamsan gums) extent of side chain branching. Solutions of greater viscosity and elasticity at most shear rates result as the degree of branching increases. When compared with xanthan gum, S-194 is found to be less temperature sensitive and more stable to excess shear. The use of these polymers in two commercial applications, (coal-water mixtures and timber preservative emulsions) is examined. Several advantages are identified when rhamsan gums are used instead of xanthan gum in both cases.

  2. FEM-based methods for the solution of the nonlinear output regulation problem

    Czech Academy of Sciences Publication Activity Database

    Rehák, Branislav; Čelikovský, S.

    Bratislava : Slovak University of Technology in Bratislava, 2007, 194-1-194-6. ISBN 978-80-227-2677-1. [Process Control 2007. Štrbské Pleso (SK), 11.06.2007-14.06.2007] R&D Projects: GA AV ČR(CZ) GP102/07/P413 Grant ostatní: GA MŠk(CZ) LA 274 Institutional research plan: CEZ:AV0Z10750506 Keywords : Nonlinear output regulation * partial differential equation * optimization * singularly perturbed equation Subject RIV: BC - Control Systems Theory

  3. Acute Toxicity and Neurotoxicity of Chlorpyrifos in Black Tiger Shrimp, Penaeus monodon

    OpenAIRE

    Tassanee Eamkamon; Sirawut Klinbunga; Kumthorn Thirakhupt; Piamsak Menasveta; Narongsak Puanglarp

    2012-01-01

    Acute toxicity and neurotoxicity of chlorpyrifos were determined in black tiger shrimp, P. monodon. LC50 values after 24 to 96 h of exposure were between 149.55 and 59.16 nmol/L. To determine the neurotoxicity of chlorpyrifos, the inhibition of acetylcholinesterase was monitored in the gill of the shrimps exposed to lethal (0.019, 0.194, and 1.942 µmol/L) and sub-lethal (0.019, 0.194, and 1.942 nmol/L) concentrations of chlorpyrifos. In lethal dose exposure, the AChE activities observed in sh...

  4. AcEST: DK946423 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU02A01NGRL0012_J06 194 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0012_J06. 5' end...finition sp|O70129|C5AR_CAVPO C5a anaphylatoxin chemotactic receptor OS=Cavia porcellus Align length 39 Scor...ro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman...ence: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman... sequence. DK946423 - Show DK946423 Clone id YMU02A01NGRL0012_J06 Library YMU02 Length 194 Definition Adian

  5. AcEST: DK948287 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0002_O18 678 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0002_O18. 5' end seq ... EVVPFTHVMHLAAQAGVRYAMENPSSYVHSNI 193 Query: 650 GGFVTL LE 673 GFV LLE Sbjct: 194 AGFVNLLE 201 >sp|Q9LPC1|G ... EVVPFTHVMHLAAQAGVRYAMENPGSYVHSNI 194 Query: 650 GGFVTL LE 673 GFV LLE Sbjct: 195 AGFVNLLE 202 >sp|O22141|G ... KIVSFTHVMHLAAQAGVRYAMENPSSYVH 196 Query: 641 SNVGGFVTL LE 673 SN+ GFV LLE Sbjct: 197 SNIAGFVNLLE 207 >sp|Q ... DVVPFTHILHLAAQAGV 199 Query: 605 RYAVKNPLAYVHSNVGGFVTL LE 673 RYA+KNP +Y+ SN+ GFV LLE Sbjct: 200 RYAMKNPQS ...

  6. Formation and decay of neutron—deficient nuclei Po and Pb

    Institute of Scientific and Technical Information of China (English)

    ChenXue-Shi; AhmadI; 等

    1998-01-01

    A study of α-decay for &192,194Po and 188.190Pb was performed in the reaction of 36Ar on 160Dy at 176MeV,The formation cross sction was obtained to be 5.0±0.2μb for 192Po and 11.6±0.3ub for 194Po.The resulting reduced αwidth δ2 was 38(5)keV for 188Pb and 25(3)keV for 190Pb,which further confirmed the magic characteristics for neutron-deficient nuclei of Z=82.

  7. Glacial-interglacial changes in the surface water characteristics of the Andaman Sea: Evidence from stable isotopic ratios of planktonic foraminifera

    Digital Repository Service at National Institute of Oceanography (India)

    Ahmad; Patil, D.J.; Rao, P.S.; Nath, B.N.; Rao, B.R.; Rajagopalan, G.

    of this region since the last glaciation (Duplessy 1982; Kallel et al 1988b; Sarkar et al 1990; Ahmad and Labeyrie 1994; Naqvi et al 1994). However, not much information is available on the surface and deep-water characteristics of the Andaman Sea because....85 1.61 350 ?1.49 1.66 380 ?1.56 1.61 400 ?1.94 1.6 410 ?1.89 1.32 420 ?1.94 1.38 154 S M Ahmad et al water 18O due to ice volume change and isotopic fractionation between calcium carbonate and water (Emiliani 1955). Oxygen isotopic fractionation...

  8. Biological basis of rabies virus neurovirulence in mice: comparative pathogenesis study using the immunoperoxidase technique.

    OpenAIRE

    Jackson, A C

    1991-01-01

    The CVS strain of fixed rabies virus causes acute, fatal encephalomyelitis in young adult ICR mice. Variant RV194-2, which was selected from CVS virus in cell culture with a neutralizing antiglycoprotein monoclonal antibody, has a single amino acid change in the glycoprotein. The infections caused by CVS virus and RV194-2 virus were compared in mice for 14 days postinoculation of 5 x 10(7) PFU into the right masseter muscle. All CVS virus-infected mice died (mean time to death, 7.9 days), com...

  9. Impacto del virus de la leucosis bovina en la producción de leche

    OpenAIRE

    Cadavid Gutierrez , Lascario Artemo

    2012-01-01

    El objetivo del estudio fue determinar la prevalencia de Leucosis Viral Bovina (LVB) en vacas lecheras y establecer si existía una relación directa con la producción de leche. Se trabajo con 194 animales de la raza Holstein y Jersey (1-5 partos), en 9 hatos ubicados en la zona central del departamento del Valle del Cauca. Las 194 muestras de sangre fueron procesadas en el laboratorio de biología molecular de la Universidad Nacional de Colombia, donde se detecto el virus mediante la técnica de...

  10. Atomic force microscopy-coupled microcoils for cellular-scale nuclear magnetic resonance spectroscopy

    Science.gov (United States)

    Mousoulis, Charilaos; Maleki, Teimour; Ziaie, Babak; Neu, Corey P.

    2013-04-01

    We present the coupling of atomic force microscopy (AFM) and nuclear magnetic resonance (NMR) technologies to enable topographical, mechanical, and chemical profiling of biological samples. Here, we fabricate and perform proof-of-concept testing of radiofrequency planar microcoils on commercial AFM cantilevers. The sensitive region of the coil was estimated to cover an approximate volume of 19.4 × 103 μm3 (19.4 pl). Functionality of the spectroscopic module of the prototype device is illustrated through the detection of 1Η resonance in deionized water. The acquired spectra depict combined NMR capability with AFM that may ultimately enable biophysical and biochemical studies at the single cell level.

  11. AcEST: DK945187 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU02A01NGRL0008_I05 194 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0008_I05. 5' end seq ... uence. DK945187 CL122Conti g1 Show DK945187 Clone id YMU02A01NGRL0008_I05 Libr ... ary YMU02 Length 194 Definiti on Adiantum capillus-veneris mRNA. clone: YMU02A01N ... GRL0008_I05. 5' end sequence. Accession DK945187 Ti ssue type young leaves Developmental stage sporophy ... te Conti g ID CL122Conti g1 Sequence TAACTTTGGAACACAAGTTTGAAA ...

  12. Sprawność fizyczna osób w wieku emerytalnym z aglomeracji miejskiej = Fitness of retirement age with urban agglomeration

    OpenAIRE

    Ratkowski, Wojciech; Grabowska-Skorb, Paulina; Bzdawski, Maciej; Napierała, Marek; Pezala, Małgorzata; Zukow, Walery

    2015-01-01

    Ratkowski Wojciech, Grabowska-Skorb Paulina, Bzdawski Maciej, Napierała Marek, Pezala Małgorzata, Zukow Walery. Sprawność fizyczna osób w wieku emerytalnym z aglomeracji miejskiej = Fitness of retirement age with urban agglomeration. Journal of Education, Health and Sport. 2015;5(4):177-194. ISSN 2391-8306. DOI: 10.5281/zenodo.16726 http://ojs.ukw.edu.pl/index.php/johs/article/view/2015%3B5%284%29%3A177-194 https://pbn.nauka.gov.pl/works/554168 http://dx.doi.org/10.5281/zen...

  13. Single-stranded plasmid DNA in Bacillus subtilis and Staphylococcus aureus.

    OpenAIRE

    te Riele, H; Michel, B.; Ehrlich, S D

    1986-01-01

    Plasmid pC194 was found to exist in a double-stranded and a single-stranded DNA form in Bacillus subtilis and Staphylococcus aureus. This single-stranded DNA was found as a circular molecule of the same size as the parental monomer and corresponded to only one of the two DNA strands. It represented one-third of plasmid copies. Single- and double-stranded DNA copies in similar proportions to the above were detected for five other S. aureus plasmids (pC221, pC223, pE194, pT127, and pT181) and o...

  14. Superdeformed rotational bands in the Mercury region

    International Nuclear Information System (INIS)

    A study of rotational properties of the ground superdeformed bands in 190Hg, 192Hg, 194Hg, and 194Pb is presented. The cranked Hartree-Fock-Bogolyubov method is used with the SkM* parametrization of the Skyrme force in the particle-hole channel and a seniority interaction in the pairing channel. An approximate particle number projection is performed by means of the Lipkin-Nogami prescription. The proton and neutron quasiparticle rhouthians are analyzed in connection with the present information on about thirty presently observed superdeformed bands in nuclei close neighbours of 192Hg. (authors). 53 refs., 14 figs

  15. The biokinetics of alpha-particle emitting radiopharmaceuticals

    International Nuclear Information System (INIS)

    The past two decades have seen wide interest in the application of alpha-particle emitting radionuclides for targeted endoradiotherapy and a large number of compounds labeled with 211At (T1/2 7.21 h), 212Bi (T1/2 1 h) or 213Bi (T1/2 0.78 h) have been studied. Knowledge of the biokinetic behaviour of such agents is important both for their optimal clinical exploitation and for general radiological protection purposes. Animal studies of the distribution and retention of 211At compounds, including ionic astatide, substituted aromatic compounds and labelled monoclonal antibodies, have provided new information on the biochemistry of astatine. With respect the thyroid gland the uptake of the astatide ion has been shown to be very much lower than that of the iodide ion. Less information is available for 212Bi-labelled radiopharmaceuticals. The available data for both 211At and 212Bi radiopharmaceuticals are reviewed. Cautious generic biokinetic models for inorganic and simple organic compounds of 211At and 212Bi; for [211At]-, and [212Bi]-biphosphonates and for [211At]-, and [212Bi]-monoclonal antibodies, are proposed for use in general radiological protection when compound-specific data are not available. (orig.)

  16. The radiolabeled monoclonal antibodies in immunoscintigraphy and radioimmunotherapy: current state and perspectives

    International Nuclear Information System (INIS)

    The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)

  17. Biological toxicity of intracellular radionuclide decay. Part of a coordinated programme on radiation biology of Auger emitters and their therapeutic applications

    International Nuclear Information System (INIS)

    Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125I-labelled Synkavit would be desirable for clinical application

  18. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  19. The biokinetics of alpha-particle emitting radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, D.M. [School of Chemistry, Cardiff Univ., Cardiff (United Kingdom); Duffield, J.R. [Faculty of Applied Sciences, Univ. of the West of England, Bristol (United Kingdom)

    2005-07-01

    The past two decades have seen wide interest in the application of alpha-particle emitting radionuclides for targeted endoradiotherapy and a large number of compounds labeled with {sup 211}At (T{sup 1}/{sub 2} 7.21 h), {sup 212}Bi (T{sup 1}/{sub 2} 1 h) or {sup 213}Bi (T{sup 1}/{sub 2} 0.78 h) have been studied. Knowledge of the biokinetic behaviour of such agents is important both for their optimal clinical exploitation and for general radiological protection purposes. Animal studies of the distribution and retention of {sup 211}At compounds, including ionic astatide, substituted aromatic compounds and labelled monoclonal antibodies, have provided new information on the biochemistry of astatine. With respect the thyroid gland the uptake of the astatide ion has been shown to be very much lower than that of the iodide ion. Less information is available for {sup 212}Bi-labelled radiopharmaceuticals. The available data for both {sup 211}At and {sup 212}Bi radiopharmaceuticals are reviewed. Cautious generic biokinetic models for inorganic and simple organic compounds of {sup 211}At and {sup 212}Bi; for [{sup 211}At]-, and [{sup 212}Bi]-biphosphonates and for [{sup 211}At]-, and [{sup 212}Bi]-monoclonal antibodies, are proposed for use in general radiological protection when compound-specific data are not available. (orig.)

  20. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    International Nuclear Information System (INIS)

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 (211At-cMAb U36). Effects on 211At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  1. Tumor immunotargeting using innovative radionuclides.

    Science.gov (United States)

    Kraeber-Bodéré, Françoise; Rousseau, Caroline; Bodet-Milin, Caroline; Mathieu, Cédric; Guérard, François; Frampas, Eric; Carlier, Thomas; Chouin, Nicolas; Haddad, Ferid; Chatal, Jean-François; Faivre-Chauvet, Alain; Chérel, Michel; Barbet, Jacques

    2015-01-01

    This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality. PMID:25679452

  2. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  3. Proceedings of transuranium elements

    International Nuclear Information System (INIS)

    The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium

  4. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  5. Development and radiotherapeutic application of 211At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    International Nuclear Information System (INIS)

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated

  6. Nuclear and chemical data for life sciences

    International Nuclear Information System (INIS)

    Use of reactor produced radionuclides is popular in life sciences. However, cyclotron production of proton rich radionuclides are being more focused in recent times. These radionuclides have already gained attention in various fields, including life sciences, provided they are obtained in pure form. This article is a representative brief of our contributions in generating nuclear data for the production of proton rich radionuclides of terbium, astatine, technetium, ruthenium, cadmium, niobium, zirconium, rhenium, etc., which may have application in clinical, biological, agriculture studies or in basic research. The chemical data required to separate the product isotopes from the corresponding target matrix have been presented along with a few propositions of radiopharmaceuticals. It also emphasizes on the development of simple empirical technique, based on the nuclear reaction model analysis, to generate reliable nuclear data for the estimation of yield and angular distribution of emitted neutrons and light charged particles from light as well as heavy ion induced reactions on thick stopping targets. These data bear utmost important in radiation dosimetry. (author)

  7. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  8. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    Energy Technology Data Exchange (ETDEWEB)

    Nestor, Marika, E-mail: marika.nestor@bms.uu.s [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden); Sundstroem, Magnus [Unit of Molecular Pathology, Department of Genetics and Pathology, Uppsala University (Sweden); Anniko, Matti [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden)

    2011-01-15

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ({sup 211}At-cMAb U36). Effects on {sup 211}At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with {sup 211}At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced {sup 211}At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  9. Alpha particle emitters in medicine

    International Nuclear Information System (INIS)

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 (211At) and natural bismuth-212 (212Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 (223Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs

  10. Preparation of 211At-labeled humanized anti-Tac using 211At produced in disposable internal and external bismuth targets

    International Nuclear Information System (INIS)

    These studies describe the production and purification of 211At as well as the procedure for labeling humanized anti-Tac, the antibody to the α-chain of the IL-2 receptor (IL-2Rα), which has been shown to be a useful target for immunotherapy. The optimized protocol combines the advantages of the two-stage dry distillation procedure with the astatination of trialkylstannyl substances as labeling compounds for proteins. The 211At was produced by bombarding either an external or a recently developed disposable internal bismuth target with α-particles from a Cyclotron Corporation CS-30 cyclotron. The 211At was found to contain less than 0.01% 210At. The production rate for the external target was 0.15 mCi ± 0.056 μA-1 h-1 (n = 9) (5.55 MBq μA-1 h-1). The production rate for the internal target was 0.44 ± 0.14 mCi μA-1 h-1 (n = 16) (16.28 MBq μA-1 h-1)

  11. TOWARD A THEORY OF SUSTAINABLE SYSTEMS. FLUID PHASE EQUILIBRIA: JOURNAL ARTICLE

    Science.gov (United States)

    NRMRL/STD JOURNAL NRMRL-CIN-1364 Cabezas*, H., and Fath**, B.D. Toward a Theory of Sustainable Systems. Fluid Phase Equilibria (Nakanishi, K., Yasukiko, A., Miyano, Y. (Ed.), Elsevier Science B.V.) 194-197:3-14 (2002). EPA/600/J-02/186, www.elsevier.com/locate/fluid. 03/2...

  12. Differences in overweight and obesity among children from migrant and native origin : The role of physical activity, dietary intake, and sleep duration

    NARCIS (Netherlands)

    L.J.W. Labree (Wim); D. van de Mheen (Dike); M.P.M.H. Rutten-van Mölken (Maureen); G. Rodenburg (Gerda); G.T. Koopmans (Gerrit); M.M.E. Foets (Marleen)

    2015-01-01

    textabstractA cross-sectional survey was performed to examine to what degree differences in overweight and obesity between native Dutch and migrant primary school children could be explained by differences in physical activity, dietary intake, and sleep duration among these children. Subjects (n=194

  13. Teachers' Attitudes toward the Integration of Pupils with Intellectual Disabilities.

    Science.gov (United States)

    Kis-Glavas, Lelia; And Others

    This study examined the attitudes of 194 teachers in 17 regular primary schools in the city of Zagreb (Croatia) and the surrounding area about the integration of children with intellectual or other developmental disabilities. In addition to providing demographic data, the teachers completed a 21-item questionnaire with questions that addressed:…

  14. Developmental Dynamics of Math Performance From Preschool to Grade 2

    Science.gov (United States)

    Aunola, Kaisa; Leskinen, Esko; Lerkkanen, Marja-Kristiina; Nurmi, Jari-Erik

    2004-01-01

    This study investigated the developmental dynamics of mathematical performance during children's transition from preschool to Grade 2 and the cognitive antecedents of this development. 194 Finnish children were examined 6 times according to their math performance, twice during each year across a 3-year period. Cognitive antecedents, that is,…

  15. Green Belt - a case of ecological network in European cultural landscape

    Czech Academy of Sciences Publication Activity Database

    Bartoš, Michael; Kušová, Drahomíra; Zemek, František; Těšitel, Jan

    Brno : CZ-IALE Praha, 2007, s. 4-11. ISBN 978-80-86386-97-3 Grant ostatní: -(XE) Interreg IIIB CADSES Green Belt (5D107), PANET (5D194) Institutional research plan: CEZ:AV0Z60870520 Keywords : green belt * habitat system * nature protection * ecological network Subject RIV: EH - Ecology, Behaviour

  16. Parental Behaviors during Family Interactions Predict Changes in Depression and Anxiety Symptoms during Adolescence

    Science.gov (United States)

    Schwartz, Orli S.; Dudgeon, Paul; Sheeber, Lisa B.; Yap, Marie B. H.; Simmons, Julian G.; Allen, Nicholas B.

    2012-01-01

    This study investigated the prospective, longitudinal relations between parental behaviors observed during parent-adolescent interactions, and the development of depression and anxiety symptoms in a community-based sample of 194 adolescents. Positive and negative parental behaviors were examined, with negative behaviors operationalized to…

  17. Migration of images. Private collections of modernism and avant-garde and the search for Cubism in Eastern Europe

    Czech Academy of Sciences Publication Activity Database

    Lahoda, Vojtěch

    Amsterdam - New York: Rodopi, 2014 - (Bäckström, P.; Hjartarson, B.), s. 187-194. (Avant-garde critical studies. 30). ISBN 978-90-420-3788-5 Institutional support: RVO:68378033 Keywords : avant-garde * Czech cubism * collections Subject RIV: AL - Art, Architecture, Cultural Heritage

  18. Study of copaiba oil on behavioral testing in rodent models by inducing neuropathic and inflammatory pain

    Directory of Open Access Journals (Sweden)

    Daniel L Medeiros

    2014-09-01

    Conclusion: Our results indicate that copaiba oil may act as an antinoceptive agent and induce plasmatic CK increase by a mechanism involving probably the splenic overproduction of megakaryocytes, suggesting this way the participation of immature platelets in the process. [J Exp Integr Med 2014; 4(3.000: 194-200

  19. EST Table: DC554099 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DC554099 E_FL_wd--_06C23_F_0 11/12/09 n.h 10/09/28 37 %/194 aa ref|XP_001866947.1| thyroid ... recep ... ng protein [Culex quinquefasciatus] gb|EDS44216.1| thyroid ... receptor interacting protein [Culex quinquefasciat ...

  20. Electrocardiographic precordial ST-segment deviations and the risk of cardiovascular death

    DEFF Research Database (Denmark)

    Rasmussen, Peter Vibe; Nielsen, Jonas Bille; Pietersen, Adrian;

    2014-01-01

    computerized analysis of ECGs from 285 194 persons, we evaluated the association between precordial ST-segment deviations and the risk of CVD. All data on medication, comorbidity, and outcomes were retrieved from Danish registries. After a median follow-up period of 5.8 years, there were 6679 cardiovascular...

  1. Drug: D00528 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D00528 Drug Anhydrous caffeine (JP16); Caffeine (USP); Anhydrous caffeine (TN) C8H10N4O2 194.080 ... OANALEPTICS N06B PSYCHOSTIMULANTS, AGENTS USED FOR ADHD ... AND NOOTROPICS N06BC Xanthine derivatives N06BC01 ...

  2. Assessment of menstrual characteristics among nulliparous female consumers of carbonated soft drinks

    Directory of Open Access Journals (Sweden)

    Ologhaguo M. Adienbo

    2016-01-01

    Conclusions: This study has shown that consumption of soft drinks during menstruation could alter menstrual characteristics in nulliparous females by increasing the menstrual flow, menstrual pain and menstrual duration. [Int J Reprod Contracept Obstet Gynecol 2016; 5(1.000: 194-197

  3. Value Added: The Economic Impact of Public Universities.

    Science.gov (United States)

    National Association of State Universities and Land Grant Colleges, Washington, DC.

    This monograph reports the results of a survey of the economic impact on state and local economies of the 194 member institutions of the National Association of State Universities and Land-Grant Colleges. Analysis of responses (from 111 institutions) is reported in text and graphs. An introductory section notes that the recent emphasis on cutting…

  4. Co-Rumination Cultivates Anxiety: A Genetically Informed Study of Friend Influence during Early Adolescence

    Science.gov (United States)

    Dirghangi, Shrija; Kahn, Gilly; Laursen, Brett; Brendgen, Mara; Vitaro, Frank; Dionne, Ginette; Boivin, Michel

    2015-01-01

    This study tested 2 related hypotheses. The first holds that high co-rumination anticipates heightened internalizing problems. The second holds that positive relationships with friends exacerbate the risk for internalizing problems arising from co-rumination. A sample of MZ twins followed from birth (194 girls and 170 boys) completed (a)…

  5. Middle-School Homework Management: More than Just Gender and Family Involvement

    Science.gov (United States)

    Xu, Jianzhong

    2007-01-01

    The article links student and family characteristics, along with homework characteristics and homework purposes, to homework management as reported by 194 middle-school students in Grades 5-6. The results revealed that homework management was not related to grade level, amount of parental education, time spent on homework, or extrinsic reasons for…

  6. Injury Patterns In Low Intensity Conflict

    Directory of Open Access Journals (Sweden)

    V Saraswat

    2009-01-01

    Most common mode of injury was Gunshot wound (41.4%, followed by splinter injuries (39.2% and Road traffic accident(RTA (19.4%. Overall mortality was 3.8% and inpatient mortality of 1.4%. Head and neck injuries were leading cause of death followed by thoracic injuries.

  7. Thermal optimality of net ecosystem exchange of carbon dioxide and underlying mechanisms

    Czech Academy of Sciences Publication Activity Database

    Niu, S.; Luo, Y.; Fei, S.; Marek, Michal V.

    2012-01-01

    Roč. 194, č. 3 (2012), s. 775-783. ISSN 0028-646X Institutional support: RVO:67179843 Keywords : climate change * optimum temperature * temperature acclimation * temperature adaptation * thermal optimality Subject RIV: EH - Ecology, Behaviour Impact factor: 6.736, year: 2012

  8. Linguo-Intercultural Sensitivity and Its Predictors in EFL in a Bosnian Sample

    Science.gov (United States)

    Aydogan, Hakan; Akbarov, Azamat

    2015-01-01

    In this article, the predictive power of five variables relevant for Linguo-intercultural sensitivity (flexibility) is examined. Communication aspect of intercultural interactions, specifically, the role of English as an international language are emphasized. Attitudes Towards English and Its Usage Scale (ATEUS) was applied to 194 students who…

  9. Aggression in Dating Relationships Compared by Country of Origin

    Science.gov (United States)

    Seligowski, Antonia; West, Doe

    2009-01-01

    Aims: The purpose of this study was to analyze prevalence levels of aggression in dating relationships and to compare this by country of origin. The study also seeks more understanding of the violence experienced by men in these countries. Method: A convenience sample was used; study participants were 194 females and 168 males ranging in age from…

  10. Elastic anisotropy and pore space geometry of schlieren granite: direct 3-D measurements at high confining pressure combined with microfabric analysis

    Czech Academy of Sciences Publication Activity Database

    Staněk, Martin; Géraud, Y.; Lexa, O.; Špaček, P.; Ulrich, S.; Diraison, M.

    2013-01-01

    Roč. 194, č. 1 (2013), s. 383-394. ISSN 0956-540X Institutional support: RVO:67985530 Keywords : magnetic fabrics and anisotropy * microstructures * seismic anisotropy * fractures and faults Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 2.724, year: 2013

  11. Instability origin of subgrain formation in plastically deformed materials

    Czech Academy of Sciences Publication Activity Database

    Kratochvíl, J.; Kružík, Martin; Sedláček, R.

    2010-01-01

    Roč. 48, č. 11 (2010), s. 1401-1412. ISSN 0020-7225 R&D Projects: GA AV ČR IAA100750802 Institutional research plan: CEZ:AV0Z10750506 Keywords : Crystal plasticity * Energetic solutions * Gradient plasticity Subject RIV: BA - General Mathematics Impact factor: 1.194, year: 2010

  12. Radiating Frohlich system as a model of cellular electromagnetism

    Czech Academy of Sciences Publication Activity Database

    Šrobár, Fedor

    2015-01-01

    Roč. 34, č. 4 (2015), s. 355-360. ISSN 1536-8378 Institutional support: RVO:67985882 Keywords : electromagnetic radiation * Fröhlich systems * cell physiology Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.194, year: 2014

  13. Childbearing among Canadian Stepfamilies

    Czech Academy of Sciences Publication Activity Database

    Heintz-Martin, V.; Le Bourdais, C.; Hamplová, Dana

    2014-01-01

    Roč. 41, 1-2 (2014), s. 61-77. ISSN 0380-1489 R&D Projects: GA ČR(CZ) GAP404/11/0145 Institutional support: RVO:68378025 Keywords : stepfamilies * childbearing * life course Subject RIV: AO - Sociology , Demography Impact factor: 0.194, year: 2014

  14. Past and future impacts of land use and climate change on agricultural ecosystem services in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Lorencová, E.; Frélichová, J.; Nelson, E.; Vačkář, David

    2013-01-01

    Roč. 33, JUL (2013), s. 183-194. ISSN 0264-8377 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0073 Institutional support: RVO:67179843 Keywords : climate change * scenarios * land use change * ecosystem services * agriculture * assessment Subject RIV: EH - Ecology, Behaviour Impact factor: 3.134, year: 2013

  15. Friends or lovers? Person- and variable-oriented perspectives on dyadic similarity in adolescent romantic relationships

    NARCIS (Netherlands)

    Seiffge-Krenke, I.; Burk, W.J.

    2013-01-01

    Variable- and person-oriented approaches were used to examine the affiliative and romantic experiences of adolescents in heterosexual romantic relationships and its associations with relationship conflict and jealousy on a sample of 194 romantic partner dyads. Variable-oriented findings indicated th

  16. AcEST: BP916079 [AcEST

    Lifescience Database Archive (English)

    Full Text Available S=Oryza... 34 4.1 tr|Q2KKR3|Q2KKR3_SINCH Schwannoma-associated protein-like protei... 33 9.1 tr|Q54HT9|Q54HT... 156 LNQSAEHQSVEPHCDEIEYLCNQCMSMWVLMMKVCTLIW 194 >tr|Q2KKR3|Q2KKR3_SINCH Schwannoma-associated protein-like

  17. Fruits & Vegetables Drying Combining Hot Air, DIC Technology and Microwaves

    Czech Academy of Sciences Publication Activity Database

    Al Haddad, M.; Mounir, S.; Sobolík, Václav; Allaf, K.

    Hong Kong: World Scientific, 2008 - (Chen, G.), s. 1064-1069 ISBN 978-981-277-194-0. [Asia-Pacific Drying Conference /5./. Hong Kong (CN), 13.08.2007-15.08.2007] Institutional research plan: CEZ:AV0Z40720504 Keywords : drying * dic technology * microwaves Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  18. Domain Modeling: NP_000881.3 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_000881.3 chr11 Crystal structure of a Kir3.1-prokaryotic Kir channel chimera p2qksb_ chr11/NP_000881.3.../NP_000881.3_apo_50-370.pdb blast 192Q,193P,194K,196R,210M,211R,212D,213E,228H,229I,23

  19. Domain Modeling: NP_001561.3 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_001561.3 chr3 Structural Basis for the Interaction of TAK1 Kinase with its Activ...ating Protein TAB1 p2evaa_ chr3/NP_001561.3/NP_001561.3_holo_194-543.pdb psi-blast 216I,217S,218Q,219G,224V,

  20. Brief Report: Relationship between Non-Verbal IQ and Gender in Autism

    Science.gov (United States)

    Banach, Ryan; Thompson, Ann; Szatmari, Peter; Goldberg, Jeremy; Tuff, Lawrence; Zwaigenbaum, Lonnie; Mahoney, William

    2009-01-01

    It has been proposed that females at risk for autism are protected in some way, so that only those with the greatest genetic liability are affected. Consequently, affected male siblings of females with autism should be more impaired than affected male siblings of male probands. One hundred and ninety-four (194) families with a single child with…

  1. Limnologické základy moderních projektů omezení masového rozvoje vodních květů sinic

    Czech Academy of Sciences Publication Activity Database

    Maršálek, Blahoslav; Maršálková, Eliška; Vinklárková, Darina

    2008-01-01

    Roč. 58, č. 6 (2008), s. 192-194. ISSN 1211-0760 R&D Projects : GA MŠk 1M0571; GA MZe QH81012 Institutional research plan: CEZ:AV0Z60050516 Keywords : cyanobacteria * lake management * algal bloom removala Subject RIV: EF - Botanics http://www.vodnihospodarstvi.cz/ArchivPDF/vh2008/vh06_2008.pdf

  2. 75 FR 48179 - Comprehensive List of Guidance Documents at the Food and Drug Administration

    Science.gov (United States)

    2010-08-09

    ... Principles and Practices (PDF - 194KB) 11/2008 Current Good Manufacturing Practice for Phase 1... to Pharmaceutical Current Good Manufacturing Practice Regulations (PDF - 443KB) 9/2006 Drug... Sterile Drug Products Produced by Aseptic Processing--Current Good Manufacturing Practice (PDF - 734KB)...

  3. The "Reading the Mind in the Voice" Test-Revised: A Study of Complex Emotion Recognition in Adults with and Without Autism Spectrum Conditions

    Science.gov (United States)

    Golan, Ofer; Baron-Cohen, Simon; Hill, Jacqueline J.; Rutherford, M. D.

    2007-01-01

    This study reports a revised version of the "Reading the Mind in the Voice" (RMV) task. The original task (Rutherford et al., (2002), "Journal of Autism and Developmental Disorders, 32," 189-194) suffered from ceiling effects and limited sensitivity. To improve that, the task was shortened and two more foils were added to each of the remaining…

  4. Mind and Body: Concepts of Human Cognition, Physiology and False Belief in Children with Autism or Typical Development

    Science.gov (United States)

    Peterson, Candida C.

    2005-01-01

    This study examined theory of mind (ToM) and concepts of human biology (eyes, heart, brain, lungs and mind) in a sample of 67 children, including 25 high functioning children with autism (age 6-13), plus age-matched and preschool comparison groups. Contrary to Baron-Cohen [1989, "Journal of Autism and Developmental Disorders," 19(4), 579-600],…

  5. Nonisothermal nematic liquid crystal flows with the Ball-Majumdar free energy

    Czech Academy of Sciences Publication Activity Database

    Feireisl, Eduard; Schimperna, G.; Rocca, E.; Zarnescu, A.

    2015-01-01

    Roč. 194, č. 5 (2015), s. 1269-1299. ISSN 0373-3114 EU Projects: European Commission(XE) 320078 - MATHEF Keywords : nematic liquid crystal * Ball-Majumdar free theory * nonisothermal model * existence theorem Subject RIV: BA - General Mathematics Impact factor: 1.065, year: 2014 http://link.springer.com/article/10.1007%2Fs10231-014-0419-1

  6. First indication of population of superdeformed states by incomplete fusion in the mass region 190

    International Nuclear Information System (INIS)

    The high spin normally deformed and superdeformed states of 194Hg have been populated in an exit channel of the 16O + 186W reaction at 110 MeV. The Doppler shift analysis of the energies of the γ transitions de-exciting both normal and super-deformed states in this nucleus indicates a lower recoil velocity of the 196Hg nucleus compared to that of 196Pb obtained form the 6n exit channel of the complete fusion compound nucleus. This suggests that incomplete fusion plays the main role in the population of these states in 194Hg. The recoil velocities (β = v/c) for different residual nuclei are: 0.87% for 195,196Pb, 0.41% for 190Pb, 0.24% for 186-188Os and 0.37% for 193,194Hg. The value obtained for 196Pb is in fair agreement with the value obtained for a complete fusion of 16O but, the values obtained for Os, Pt and Hg agree with a kinematic calculations of incomplete fusion where the 'spectator' fragment of 12C, 8Be, 4He continues its trajectory along the beam axis with the velocity of the last one. This analysis indicates already that the incomplete fusion plays probably a crucial role in populating the superdeformed nucleus 194Hg. The study of the angular and energy distributions of the α particles in coincidence with this nucleus is presently under way

  7. 78 FR 38330 - Information Collection Being Reviewed by the Federal Communications Commission

    Science.gov (United States)

    2013-06-26

    ... Pornography and Marketing Act of 2003, CG Docket No. 04-53, FCC 04-194, published at 69 FR 55765, September 16... Federal Register on December 15, 2009 (74 FR 66356), which became effective on January 25, 2010. Privacy... Assault of Non-Solicited Pornography and Marketing Act of 2003, CG Docket No. 04-53. Form Number:...

  8. Stereotype Threat and Gender Differences in Performance on a Novel Visuospatial Task

    Science.gov (United States)

    Campbell, Susan Miller; Collaer, Marcia L.

    2009-01-01

    Stereotype threat research has shown that being a member of a negatively stereotyped group may result in impaired performance on tests of skills thought to be relevant to the stereotype. This study investigated whether stereotype threat influences gender differences in performance on a novel test of visuospatial ability. Undergraduates (N = 194)…

  9. Est ibi bestia aneb co můžete podle středověkých autorů potkat v českých hvozdech

    Czech Academy of Sciences Publication Activity Database

    Kubínová, Kateřina

    Praha: Filosofia, 2004 - (Doležalová, E.; Novotný, R.; Soukup, P.), s. 383-394 ISBN 80-7007-194-X Institutional research plan: CEZ:AV0Z8033913 Keywords : historiography * John Marignola * medieval imagination Subject RIV: AL - Art, Architecture, Cultural Heritage

  10. Designing a Digital Future: Federally Funded Research and Development in Networking and Information Technology. Report to the President and Congress

    Science.gov (United States)

    Executive Office of the President, 2010

    2010-01-01

    This report is prepared by the President's Council of Advisors on Science and Technology (PCAST) acting in its role as the President's Innovation and Technology Advisory Council (PITAC). This report fulfills PCAST's responsibilities under Executive Order 13539 and the High-Performance Computing Act of 1991 (Public Law 102-194) as amended by the…

  11. Negative regulation of Toll-like receptor signaling plays an essential role in homeostasis of the intestine

    Czech Academy of Sciences Publication Activity Database

    Biswas, A.; Wilmanski, J.; Forsman, H.; Hrnčíř, Tomáš; Hao, L.; Tlaskalová-Hogenová, Helena; Kobayashi, K.

    2011-01-01

    Roč. 41, č. 1 (2011), s. 182-194. ISSN 0014-2980 R&D Projects: GA ČR GP310/09/P182 Institutional research plan: CEZ:AV0Z50200510 Keywords : Caspase-1 * Colitis * IL-10 Subject RIV: EC - Immunology Impact factor: 5.103, year: 2011

  12. Minimising the Effects of Isobaric Product Ions in SIFT-MS Quantification of Acetaldehyde, Dimethyl Sulphide and Carbon Dioxide

    Czech Academy of Sciences Publication Activity Database

    Smith, D.; Chippendale, T. W. E.; Španěl, Patrik

    2013-01-01

    Roč. 9, č. 4 (2013), s. 550-557. ISSN 1573-4110 Institutional support: RVO:61388955 Keywords : selected ion flow tube mass spectrometry * SIFT-MS * acetaldehyde Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.194, year: 2013

  13. Severity Differences among Self-Assessors, Peer-Assessors, and Teacher Assessors Rating EFL Essays

    Science.gov (United States)

    Esfandiari, Rajab; Myford, Carol M.

    2013-01-01

    We compared three assessor types (self-assessors, peer-assessors, and teacher assessors) to determine whether they differed in the levels of severity they exercised when rating essays. We analyzed the ratings of 194 assessors who evaluated 188 essays that students enrolled in two state-run universities in Iran wrote. The assessors employed a…

  14. Contact sensitization to 5-chloro-2-methyl-4-isothiazolin-3-one and 2-methyl-4-isothiazolin-3-one (MCI/MI). A European multicentre study

    DEFF Research Database (Denmark)

    Menné, T; Frosch, P J; Veien, Niels;

    1991-01-01

    , formaldehyde, paraben-mix, and MCI/MI. 19.4% of the patients had positive patch tests to nickel, making this the most common allergen. 3% of the patients reacted to 100 ppm MCI/MI, while 2.6% reacted to formaldehyde and 1.1% to parabens. There was great variation in the frequency of MCI/MI sensitivity among...

  15. Parametric and Non-Parametric Regression Models

    Czech Academy of Sciences Publication Activity Database

    Brabec, Marek

    Stuttgart : E. Schweizerbart'sche Verlagsbuchhandlung, 2013 - (Hermanussen, M.), s. 194-199 ISBN 978-3-510-65278-5 Institutional support: RVO:67985807 Keywords : statistical modeling * non-parametric * semi-parametric * mixed-effects model * growth curve model Subject RIV: BB - Applied Statistics, Operational Research

  16. Regioisomeric analysis of triacylglycerols using silver-ion liquid chromatography-atmospheric pressure chemical ionization mass spectrometry: Comparison of five different mass analyzers

    Czech Academy of Sciences Publication Activity Database

    Holčapek, M.; Dvořáková, H.; Lísa, M.; Girón, A. J.; Sandra, P.; Cvačka, Josef

    2010-01-01

    Roč. 1217, č. 52 (2010), s. 8186-8194. ISSN 0021-9673 R&D Projects: GA ČR GA203/09/0139 Institutional research plan: CEZ:AV0Z40550506 Keywords : triacylglycerols * silver-ion liquid chromatography * regioisomer * HPLC/MS * APCI Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.194, year: 2010

  17. High-performance liquid chromatography–off line mass spectrometry analysis of anthraquinones produced by Geosmithia lavendula

    Czech Academy of Sciences Publication Activity Database

    Stodůlková, Eva; Man, Petr; Kolařík, Miroslav; Flieger, Miroslav

    2010-01-01

    Roč. 1217, č. 40 (2010), s. 6296-6302. ISSN 0021-9673 R&D Projects: GA MŠk 2B08064; GA AV ČR KAN200200651 Institutional research plan: CEZ:AV0Z50200510 Keywords : High - performance liquid chromatography * Mass spectrometry * Anthraquinones Subject RIV: EE - Microbiology, Virology Impact factor: 4.194, year: 2010

  18. Operation of thermal power plants. Pt. 1. 2. rev. ed. Betrieb von Waermekraftwerken. T. 1

    Energy Technology Data Exchange (ETDEWEB)

    Sajadatz, H.; Gawlik, R.; Guenther, M.; Ilse, W.; Moench, E.

    1985-01-01

    This is a textbook for engine operators specializing in thermal power plants. SI units are considered, and the latest state of knowledge in power plant engineering is presented including outlying structures, furnaces, steam generators, heat exchangers, condensation and cooling water systems. Many figures, examples, and problems for self-training illustrate the text. (DG). With 194 figs., 9 tabs.

  19. The dark side of romantic relationships: Aggression in adolescent couples and links to attachment

    NARCIS (Netherlands)

    Seiffge-Krenke, I.; Burk, W.J.

    2015-01-01

    This study focuses on romantic relationships from the perspective of both partners. This dyadic approach was chosen to account for the fact that both partners may differently contribute to the escalation of aggression. In a sample of 194 romantic partner dyads, differences between female and male pa

  20. “Bad Romance”: Links between Psychological and Physical Aggression and Relationship Functioning in Adolescent Couples

    NARCIS (Netherlands)

    Seiffge-Krenke, I.; Burk, W.J.

    2015-01-01

    Assortative mating is an important issue in explaining antisocial, aggressive behavior. It is yet unclear, whether the similarity paradigm fully explains frequent displays of aggression in adolescents’ romantic relationships. In a sample of 194 romantic partner dyads, differences between female and

  1. Früher Beginn: Aggression bei jugendlichen Paaren und ihr Bezug zu Partnerschaftsqualität und Bewältigung von Konflikten [Early start: Aggression in adolescent couples and its link to relationship quality and coping with conflicts

    NARCIS (Netherlands)

    Seiffge-Krenke, I.; Burk, W.J.

    2016-01-01

    Aggressive behavior in adult couples is a problem which must be taken seriously and is a frequent reason for psychotherapy and counseling. Less is known about an early start of aggression, e.g. in adolescent romantic relationships. In a sample of 194 romantic partner dyads (age 16-18 years) differen

  2. ANTIMICROBIAL RESISTANCE RATES IN CAMPYLOBACTER ISOLATES DERIVED FROM SWINE

    Science.gov (United States)

    Campylobacter, a microaerophilic gram-negative rod, is a major foodborne pathogen and commonly present in swine intestinal tract without causing any clinical disease. In this project, we investigated the antimicrobial resistance profiles of fecal Campylobacter isolates (n= 194) obtained from a swin...

  3. Perceptions of Domestic Violence: The Effects of Domestic Violence Myths, Victim's Relationship with Her Abuser, and the Decision to Return to Her Abuser

    Science.gov (United States)

    Yamawaki, Niwako; Ochoa-Shipp, Monica; Pulsipher, Craig; Harlos, Andrew; Swindler, Scott

    2012-01-01

    Researchers in this study examined the attitudes toward domestic violence, the victim, and her perpetrator. A total of 194 participants were randomly assigned to one of 4 hypothetical scenarios to evaluate how observers' perceptions were influenced by their own sex and myths about domestic violence, by the victim's decision to return to the…

  4. The degradation of lining of rotary furnaces in the production of zinc oxide

    Czech Academy of Sciences Publication Activity Database

    Luptáková, Natália; Pešlová, F.; Anisimov, E.

    2014-01-01

    Roč. 21, č. 3 (2014), s. 116-121. ISSN 1335-0803 Institutional support: RVO:68081723 Keywords : zinc oxide * the production of zinc oxide * zinc slag * refractories * the degradation of rotary furnace linings Subject RIV: JG - Metallurgy http://ojs.mateng.sk/index.php/Mateng/article/view/133/194

  5. The use of lipids as phase change materials for thermal energy storage

    Science.gov (United States)

    Phase change materials (PCMs) are substances capable of absorbing and releasing large 2 amounts of thermal energy (heat or cold) as latent heat over constant temperature as they 3 undergo a change in state of matter (phase transition), commonly, between solid and 4 liquid phases. Since the late 194...

  6. 75 FR 21353 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2010-04-23

    ... Workplace, Inc., Kalispell, MT TA-W-71,824: Neenah Paper FR, LLC., Ripon, CA TA-W-72,043: Carmeuse... Staffmasters, Cleveland, NC, November 27, 2008 TA-W-73,194: Beam Global Spirits and Wine, Leased Workers from... Division, Indianapolis, IN TA-W-73,131: Android Wixom, Wixom, MI TA-W-73,168; Riverside Mechanical,...

  7. 76 FR 61683 - ANR Pipeline Company; Notice of Application

    Science.gov (United States)

    2011-10-05

    ... Energy Regulatory Commission ANR Pipeline Company; Notice of Application Take notice that on September 22, 2011, ANR Pipeline Company (ANR Pipeline), 717 Texas Street, Suite 2400, Houston, Texas 77002-2761... an offshore production platform in Mississippi Canyon Block 194 connecting with approximately...

  8. Long the fixation of physicists worldwide, a tiny particle is found

    CERN Multimedia

    2006-01-01

    "After decades of intensive effort by both experimental and theoretical physicists worldwide, a tiny particle with no charge, a very low mass and a lifetime much shorter than a nanosecond, dubbed the "axion", has now been detected by the University at Buffalo physicist who first suggested its existence in a little-read paper as early as 194." (2 pages)

  9. Spor o Carnapův Aufbau: Quine vs. Friedman

    Czech Academy of Sciences Publication Activity Database

    Childers, Timothy

    Praha : Filosofia, 2005 - (Nitsche, M.; Sousedík, P.; Šimsa, M.), s. 179-194 ISBN 80-7007-224-5 R&D Projects: GA ČR(CZ) GA401/04/0117 Institutional research plan: CEZ:AV0Z90090514 Keywords : Carnap * Aufbau * Friedman Subject RIV: AA - Philosophy ; Religion

  10. Validity of Cognitive ability tests – comparison of computerized adaptive testing with paper and pencil and computer-based forms of administrations

    Czech Academy of Sciences Publication Activity Database

    Žitný, P.; Halama, P.; Jelínek, Martin; Květon, Petr

    2012-01-01

    Roč. 54, č. 3 (2012), s. 181-194. ISSN 0039-3320 R&D Projects: GA ČR GP406/09/P284 Institutional support: RVO:68081740 Keywords : item response theory * computerized adaptive testing * paper and pencil * computer-based * criterion and construct validity * efficiency Subject RIV: AN - Psychology Impact factor: 0.215, year: 2012

  11. Improving iodine homogeneity in NIST SRM 1548a Typical Diet by cryogenic grinding

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan; Kameník, Jan

    2015-01-01

    Roč. 20, č. 3 (2015), s. 189-194. ISSN 0949-1775 R&D Projects: GA ČR(CZ) GBP108/12/G108; GA MŠk LM2011019 Institutional support: RVO:61389005 Keywords : Iodine * reference material * NIST SRM 1548a * cryogenic grinding * homogeneity Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.966, year: 2014

  12. Vkládání do úst jako součást individuálního stylu českého politického komentátora Jiřího Hanáka

    Czech Academy of Sciences Publication Activity Database

    Hoffmannová, Jana

    Bratislava : Univerzita Komenského, 2012 - (Bohunická, A.), s. 185-194 ISBN 978-80-223-3276-7 R&D Projects: GA ČR GAP406/12/1829 Institutional support: RVO:68378092 Keywords : individual style * idiolect * intertextuality * polyphony Subject RIV: AI - Linguistics

  13. In vitro bioassay analyses of river sediment extracts and their fractions with focus on genotoxic and nongenotoxic effects

    Czech Academy of Sciences Publication Activity Database

    Polášková, P.; Marvanová, S.; Pěnčíková, K.; Andrysík, Zdeněk; Kocan, A.; Neča, J.; Ciganek, M.; Vondráček, Jan; Machala, M.

    Porto, 2007. s. 194. [SETAC Europe 17th Annual Meeting. 20.05.2007-24.05.2007, Porto] Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : AhR-mediated activity * genotoxicity * PAHs Subject RIV: BO - Biophysics

  14. The region of XRCC1 which harbours the three most common nonsynonymous polymorphic variants, is essential for the scaffolding function of XRCC1

    DEFF Research Database (Denmark)

    Hanssen-Bauer, Audun; Solvang-Garten, Karin; Gilljam, Karin Margaretha;

    2012-01-01

    most common amino acid variants of XRCC1, Arg194Trp, Arg280His and Arg399Gln, are located within the region comprising the NLS and BRCT1 domains, and these variants may be associated with increased incidence of specific types of cancer. While we could not detect differences in the intra...

  15. Berriasian bio- and magnetostratigraphy and magnetic susceptibility of the Barlya section (Western Balkan Unit, Bulgaria) – preliminary results

    Czech Academy of Sciences Publication Activity Database

    Grabowski, J.; Lakova, I.; Schnabl, Petr; Sobien, K.; Petrova, S.

    2014-01-01

    Roč. 12, č. 1 (2014), s. 185-194. ISSN 1731-3708 Institutional support: RVO:67985831 Keywords : Berriasian * Western Balkan * calpionellids * magnetostratigraphy * magnetic susceptibility Subject RIV: DE - Earth Magnetism, Geodesy, Geography https://www.voluminajurassica.org/index.php/volumina/article/view/143

  16. 40 CFR 60.4400 - How do I conduct the initial and subsequent performance tests, regarding NOX?

    Science.gov (United States)

    2010-07-01

    ... = NOX emission rate, in lb/MWh 1.194 × 10−7 = conversion constant, in lb/dscf-ppm (NOX)c = average NOX... emission rate in lb/MWh. (2) Sampling traverse points for NOX and (if applicable) diluent gas are to be... units complying with the output based standard, concurrently measure the stack gas flow rate, using...

  17. From Caterpillar to Butterfly: A Window for Looking into Students' Ideas about Life Cycle and Life Forms of Insects

    Science.gov (United States)

    Cinici, Ayhan

    2013-01-01

    The purpose of this study was a qualitative analysis of high school students' ideas about life cycle and life forms of the butterfly. For this purpose, open-ended questions and drawing methods were applied to 194 high school students from the ninth to eleventh grades and 14 to 16 years of age in Erzurum, Turkey. Students' drawings were categorised…

  18. Motives for Dissertation Research at the Intersection between Rural Education and Curriculum and Instruction

    Science.gov (United States)

    Howley, Craig B.; Howley, Aimee; Yahn, Jacqueline

    2014-01-01

    Dissertation literature focusing on issues of curriculum and instruction (C&I) in rural schools has substantially increased since 1987. We located 580 possibly rural C&I dissertations and subsequently identifi ed 194 as probably rural; of these we were able to obtain digital copies of 188 full-length studies. Our purpose was to…

  19. Out-of-phase magnetic susceptibility of rocks and soils: a rapid tool for magnetic granulometry

    Czech Academy of Sciences Publication Activity Database

    Hrouda, F.; Pokorný, J.; Ježek, J.; Chadima, Martin

    2013-01-01

    Roč. 194, č. 1 (2013), s. 170-181. ISSN 0956-540X R&D Projects: GA ČR GAP210/10/2351 Institutional support: RVO:67985831 Keywords : environmental magnetism * magnetic mineralogy and petrology * rock and mineral magnetism Subject RIV: DE - Earth Magnetism , Geodesy, Geography Impact factor: 2.724, year: 2013

  20. Non-weight-bearing status compromises the functional level up to 1 yr after hip fracture surgery

    DEFF Research Database (Denmark)

    Ariza-Vega, Patrocinio; Jiménez-Moleón, José Juan; Kristensen, Morten Tange

    2014-01-01

    OBJECTIVE: The aim of this study was to examine the influence of weight-bearing (WB) status after hip fracture surgery on 1-yr functional outcome. DESIGN: This was a prospective cohort study, carried out in a public acute hospital trauma service. The 194 patients (36 men and 158 women), with a me...

  1. K významovým vztahům v apoziční skupině

    Czech Academy of Sciences Publication Activity Database

    Veselý, Vojtěch

    2013-01-01

    Roč. 74, č. 3 (2013), s. 178-194. ISSN 0037-7031 R&D Projects: GA MK DF13P01OVV011 Keywords : apposition * appositional group * predication * determination * relationally * locative adverb Subject RIV: AI - Linguistics Impact factor: 0.133, year: 2013

  2. Ajaleht Pravda ja 40 keisri hullu : "40 kiri" sündis siis, kui teisiti enam ei saanud / Lauri Vahtre

    Index Scriptorium Estoniae

    Vahtre, Lauri, 1960-

    2005-01-01

    Eesti kultuuritegelaste kirjutatud "40 kirjast" 1980. aastal, kus tunti muret Eesti ühiskonna ja kultuuri tuleviku pärast. Artikkel sisaldab kirjale allakirjutanute nimesid. Ilmunud ka rmt.: Vahtre, Lauri. Ajaloo pööripäevad. Tallinn, 2006, lk. 190-194

  3. Out of the Qinghai-Tibet Plateau: evidence for the origin and dispersal of Eurasian temperate plants from a phylogeographic study of Hippophae rhamnoides (Elaeagnaceae)

    Czech Academy of Sciences Publication Activity Database

    Jia, Dong-Rui; Abbott, R.J.; Liu, T.-L.; Mao, K.-S.; Bartish, Igor V.; Liu, J.-Q.

    2012-01-01

    Roč. 194, č. 4 (2012), s. 1123-1133. ISSN 0028-646X Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : intraspecefic evolution * migration * phylogeography Subject RIV: EF - Botanics Impact factor: 6.736, year: 2012

  4. First report on trichomonads from true bugs

    Czech Academy of Sciences Publication Activity Database

    Smejkalová, P.; Votýpka, Jan; Lukeš, Julius; Čepička, I.

    2014-01-01

    Roč. 61, č. 3 (2014), s. 189-194. ISSN 0015-5683 Institutional support: RVO:60077344 Keywords : Parabasalia * intestinal endosymbionts * Simplicimonas * Monocercomonas * phylogeny * SSU rDNA * Heteroptera * Insecta * host-parasite association Subject RIV: EG - Zoology Impact factor: 1.147, year: 2014

  5. Die Greensche Funktion in der Analyse von nichtlinearen parametererregten Systemen

    Czech Academy of Sciences Publication Activity Database

    Hortel, Milan; Škuderová, Alena

    2001-01-01

    Roč. 81, - (2001), s. S193-S194. ISSN 0044-2267. [Annual Meeting GAMM 2000. Göttingen, 02.04.2000-07.04.2000] R&D Projects: GA ČR GA101/00/0225 Subject RIV: BI - Acoustics Impact factor: 0.238, year: 2001

  6. On some Chiroptera from Greece

    NARCIS (Netherlands)

    Laar, van Vincent; Daan, Serge

    1964-01-01

    On a trip to Greece between the 25th April and the 25th July 1963, the authors collected (on the mainland and some islands in the Aegean) insects, amphibians and reptiles as well as 194 mammals. Among the mammals, mainly rodents and insectivores, there were also 27 bats, belonging to five species. A

  7. WetVegEurope: a database of aquatic and wetland vegetation of Europe

    Czech Academy of Sciences Publication Activity Database

    Landucci, F.; Řezníčková, M.; Šumberová, Kateřina; Chytrý, M.; Aunina, L.; Bita-Nicolae, C.; Bobrov, A.; Borsukevych, L.; Brisse, H.; Carni, A.; Csiky, J.; Cvijanovic, D.; De Bie, E.; De Ruffray, P.; Dubyna, D.; Dimopoulos, P.; Dziuba, T.; FitzPatrick, U.; Font, X.; Gigante, D.; Golub, V.; Hennekens, S.M.; Hrivnák, R.; Iemelianova, S.; Jandt, U.; Jenačkovic, D.; Jansen, F.; Kacki, Z.; Lájer, K.; Matulevičiute, D.; Mesterházy, A.; Michalcová, D.; Paal, J.; Papastergiadou, E.; Properzi, A.; Radulovič, S.; Rodwell, J.; Schaminée, J.H.J.; Šilc, U.; Sinkevičiene, Z.; Stančič, Z.; Stepanovich, J.; Teteryuk, B.; Tzonev, R.; Venanzoni, R.; Weekes, L.; Willner, W.

    2015-01-01

    Roč. 45, 1-2 (2015), s. 187-194. ISSN 0340-269X R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : vegetation plot * database * aquatic and marshland vegetation Subject RIV: EF - Botanics Impact factor: 1.742, year: 2014

  8. A Randomized Study of a Literacy-Integrated Science Intervention for Low-Socio-Economic Status Middle School Students: Findings from First-Year Implementation

    Science.gov (United States)

    Tong, Fuhui; Irby, Beverly J.; Lara-Alecio, Rafael; Guerrero, Cindy; Fan, Yinan; Huerta, Margarita

    2014-01-01

    This paper presents the findings from a randomized control trial study of reading/literacy-integrated science inquiry intervention after 1 year of implementation and the treatment effect on 5th-grade low-socio-economic African-American and Hispanic students' achievement in science and English reading. A total of 94 treatment students and 194

  9. Multidrug resistance among different serotypes of clinical Salmonella isolates in Taiwan

    DEFF Research Database (Denmark)

    Lauderdale, T. L.; Aarestrup, Frank Møller; Chen, P. C.;

    2006-01-01

    (41%) and was highly prevalent in Salmonella enterica serotype Typhimurium (72.7%, 176/242) the most common serotype. Additional resistance to trimethoprim was present in 155 (19.4% overall) of the ACSSuT R-type isolates from several serotypes. Reduced susceptibility to fluoroquinolone (FQ...

  10. Exploring Preschool Children's Science Content Knowledge

    Science.gov (United States)

    Guo, Ying; Piasta, Shayne B.; Bowles, Ryan P.

    2015-01-01

    Research Findings: The purpose of this study was to describe children's science content knowledge and examine the early predictors of science content knowledge in a sample of 194 typically developing preschool children. Children's science content knowledge was assessed in the fall (Time 1) and spring (Time 2) of the preschool year.…

  11. Personality Predictors of Participation as a Mentor

    Science.gov (United States)

    Niehoff, Brian P.

    2006-01-01

    Purpose: The purpose of this paper is to focus on the personality characteristics of mentors. Design/methodology/approach: The five factor model of personality was used to examine relationships between personality and participation as a mentor. A sample of 194 practicing veterinarians were surveyed on the five factor model of personality and a…

  12. An Objective Instrument for Assessment of Erikson's Developmental Conflicts. Presentation Summary.

    Science.gov (United States)

    Speisman, Joseph C.; And Others

    An objective measure of Erikson's ego-identity construct is being developed. The total scale includes seven relatively independent subscales designed to reflect the residuals (part conflicts) of Erikson's psychosocial stages of development. An initial item pool of 194 items has been reduced to 113 items by means of judgemental and statistical…

  13. Charakterizace organických sloučenin v PM2,5 aerosolu v Ostravě v zimním období

    Czech Academy of Sciences Publication Activity Database

    Mikuška, Pavel; Křůmal, Kamil; Večeřa, Zbyněk

    Brno: Masarykova univerzita : Recetox, 2015, s. 194-197. ISBN 978-80-210-7829-1. [Ovzduší 2015. Brno (CZ), 20.04.2015-22.04.2015] R&D Projects: GA ČR(CZ) GBP503/12/G147 Institutional support: RVO:68081715 Keywords : atmospheric aerosol * organic markers * emission sources Subject RIV: CB - Analytical Chemistry, Separation

  14. Dicty_cDB: VSF358 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available y. 194 1e-45 1 X00326 |X00326.1 Dictyostelium dicoideum discoidin I beta gene upstream region. 74 4e-09 1 X85121 |X85121.1 Artificial... sequences cloning vector DNA pDXD-3C. 68 2e-07 1 X85120 |X85120.1 Artificial seque

  15. Solutions to muscle fiber equations and their long time behaviour

    Czech Academy of Sciences Publication Activity Database

    Krejčí, Pavel; Sainte-Marie, J.; Sorine, M.; Urquiza, J.M.

    2006-01-01

    Roč. 7, č. 4 (2006), s. 535-558. ISSN 1468-1218 Institutional research plan: CEZ:AV0Z10190503 Keywords : existence * uniqueness * muscle and cardiac mechanics Subject RIV: BA - General Mathematics Impact factor: 1.194, year: 2006 http://www.sciencedirect.com/science/article/pii/S1468121805000507

  16. Presence of the amphibian chytrid pathogen confirmed in Cameroon

    Czech Academy of Sciences Publication Activity Database

    Baláž, V.; Kopecký, O.; Gvoždík, Václav

    2012-01-01

    Roč. 22, č. 3 (2012), s. 191-194. ISSN 0268-0130 R&D Projects: GA MŠk LC06073 Institutional support: RVO:67985904 Keywords : Afromontane * chytridiomycosis * Congolian lowland rainforests Subject RIV: EG - Zoology Impact factor: 1.081, year: 2012

  17. AcEST: DK949699 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0006_L03 684 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0006_L03. 5' end seq ... ery: 24 DACASWWTQ---GPDLKLQLELAKQVGYATGRFGHVMLPENVYEPA LLCAESLIKLIGKG 194 DA +SWW + ++ L++Q H + +EPA + A+ L ... jct: 52 DAVSSWWVNLFGHANPRISQALSEQAF----TLEHTIFANFSHEPA IKLAQKLVALTPQS 107 Query: 195 WANKVYYSDNGSTAVEIAIKM ...

  18. Conductivity of carbon materials for alternative energy sources

    Czech Academy of Sciences Publication Activity Database

    Tichý, J.; Novák, V.; Barath, Peter

    Brno : University of technology Brno, 2009, s. 192-194. ISBN 978-80-214-3943-6. [International Conference Advanced Batteries, Accumulators and Fuel Cells /10./. Brno (CZ), 30.08.2009-02.10.2009] Institutional research plan: CEZ:AV0Z40320502 Keywords : electrodes with carbon materials Subject RIV: CG - Electrochemistry

  19. Particulate Matter deposition on Quercus ilex leaves in an industrial city of central Italy

    Czech Academy of Sciences Publication Activity Database

    Sgrigna, G.; Saebo, A.; Gawronski, S.; Popek, R.; Calfapietra, Carlo

    2015-01-01

    Roč. 197, FEB 2015 (2015), s. 187-194. ISSN 0269-7491 Institutional support: RVO:67179843 Keywords : PM10 * PM2.5 * Leaf deposition * Quercus ilex * urban environment * atmospheric pollution Subject RIV: EH - Ecology, Behaviour Impact factor: 4.143, year: 2014

  20. Monetka iz-za morja / Josef Kats

    Index Scriptorium Estoniae

    Kats, Josef, 1977-

    2005-01-01

    Eesti Panga president Andres Lipstok ja Soome Rahapaja OY tegevdirektor Raimo Makkonen allkirjastasid 19. detsembril mündivermimise lepingu, mille kohaselt vermib Eesti euromündid Rahapaja OY. Ettevõte vermib Eestile 194 miljonit euromünti

  1. Globalization and innovation in emerging markets

    Czech Academy of Sciences Publication Activity Database

    Gorodnichenko, Y.; Švejnar, Jan; Terrell, K.

    2010-01-01

    Roč. 2, č. 2 (2010), s. 194-226. ISSN 1945-7707 R&D Projects: GA ČR GAP402/10/2130; GA MŠk LC542 Institutional research plan: CEZ:MSM0021620846 Keywords : emerging market economies * foreign competition * innovation Subject RIV: AH - Economics Impact factor: 0.158, year: 2010

  2. Drug: D09874 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D09874 Drug Benralizumab (USAN/INN) C6492H10060N1724O2028S42 145964.5332 146054.4048 (Heavy chai ... 8; 134-194; H224-L214, Dimer) Peptide Treatment of asthma ... Monoclonal antibody CD125 (interleukin 5 receptor, ...

  3. Clinical results of the laser-assisted in situ keratomileusis (LASIK) for myopia

    Science.gov (United States)

    Guo, Hai-ke; Yao, Da-qing; Gui, Lu-ping

    1998-11-01

    To observe and analyze the refractive and complications of the LASIK for corrections of myopia. With the microlamellar keratoplasty and the excimer laser, LASIK was performed on 194 cases. According to the preoperative spherical equivalent refraction, divide the patients into three groups.

  4. The mechanistic bases of the power-time relationship

    DEFF Research Database (Denmark)

    Vanhatalo, Anni; Black, Matthew I; DiMenna, Fred J;

    2016-01-01

    .025) and inversely correlated with muscle type IIx fibre proportion (r = -0.76, P = 0.01). There was no relationship between W' (19.4 ± 6.3 kJ) and muscle fibre type. These data indicate a mechanistic link between the bioenergetic characteristics of different muscle fibre types and the power-duration relationship...

  5. Vascular epiphyte vegetation in rocky savannas of southeastern Brazil

    Czech Academy of Sciences Publication Activity Database

    Alves, R. J. V.; Kolbek, Jiří; Becker, J.

    2008-01-01

    Roč. 26, 1-2 (2008), s. 101-117. ISSN 0107-055X Institutional research plan: CEZ:AV0Z60050516 Keywords : epiphytic communities * campo rupestre * Minas Gerais Subject RIV: EF - Botanics Impact factor: 0.194, year: 2008

  6. Effect of sample preparation and humidity on the photodegradation rate of CEES on pure and Zn doped anatase TiO2 nanoparticles prepared by homogeneous hydrolysis

    Czech Academy of Sciences Publication Activity Database

    Osterlund, L.; Štengl, Václav; Mattsson, A.; Bakardjieva, Snejana; Andersson, P.O.; Opluštil, F.

    2009-01-01

    Roč. 88, 1-2 (2009), s. 194-203. ISSN 0926-3373 Grant ostatní: Swedish Defence Materials Administration(SE) FMV E46484 Institutional research plan: CEZ:AV0Z40320502 Keywords : CEES * TiO2 * Photocatalysis Subject RIV: CA - Inorganic Chemistry Impact factor: 5.252, year: 2009

  7. SIFT-MS Analysis of Nose-Exhaled Breath; Mouth Contamination and the Influence of Exercise

    Czech Academy of Sciences Publication Activity Database

    Smith, D.; Chippendale, T. W. E.; Dryahina, Kseniya; Španěl, Patrik

    2013-01-01

    Roč. 9, č. 2013 (2013), s. 565-575. ISSN 1573-4110 Institutional support: RVO:61388955 Keywords : selected ion flow tube mass spectrometry * breath analysis * nose exhalation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.194, year: 2013

  8. Parent Reports of Young Spanish-English Bilingual Children's Productive Vocabulary: A Development and Validation Study

    Science.gov (United States)

    Mancilla-Martinez, Jeannette; Gámez, Perla B.; Vagh, Shaher Banu; Lesaux, Nonie K.

    2016-01-01

    Purpose: This 2-phase study aims to extend research on parent report measures of children's productive vocabulary by investigating the development (n = 38) of the Spanish Vocabulary Extension and validity (n = 194) of the 100-item Spanish and English MacArthur-Bates Communicative Development Inventories Toddler Short Forms and Upward Extension…

  9. New clues on the model of YY Her after two seasons

    Czech Academy of Sciences Publication Activity Database

    Hric, L.; Gális, R.; Dobrotka, A.; Šimon, Vojtěch; Petrík, K.; Niarchos, P.; Velič, Z.; Gazeas, K.; Šmelcer, L.; Hájek, P.; Sobotka, P.; Koss, K.; Brát, L.; Lomoz, F.

    2004-01-01

    Roč. 20, - (2004), s. 222. ISSN 0035-001X. [IAU Colloquium /194./: Compact binaries in the galaxy and beyond. La Paz, Baja California Sur, 17.11.2003-22.11.2003] Institutional research plan: CEZ:AV0Z1003909 Keywords : symbiotic stars * close binaries * circumstellar matter Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.229, year: 2004

  10. AcEST: DK944747 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU02A01NGRL0007_B06 463 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0007_B06. 5' end seq ... uery: 430 PLKGV*RKPNVRDCIRTTWKPKPPQIHQMRNVGRIKTKNNITIN GT-----ISIKIRSVF 266 P K KP + +TT K PQ + + V K TIN ... bjct: 194 PGKKTTTKPTKKPTFKTTKKDHKPQTTKPKEVPTTKPTEEPTIN TTKTNIITTLLTNNTT 253 Query: 265 ARYKMSLQQNVEHGQIVGP ...

  11. Charismatic aspect of transformational leadership and its role in creating organizational culture / Gerda Mihhailova, Kulno Türk

    Index Scriptorium Estoniae

    Mihhailova, Gerda

    2006-01-01

    Ettevõtte kasvu- ja küpsusfaasis vajatakse autorite hinnangul enam nn. klassikalisi juhte, karismaatilised juhid sobivad pigem radikaalseid muutusi nõudvatesse situatsioonidesse, nagu näiteks ettevõtte rajamine või selle langusfaasist välja toomine. Skeemid. Tabel. Lisa lk. 194

  12. Telomere Length in Circulating Lymphocytes: Association with Chromosomal Aberrations

    Czech Academy of Sciences Publication Activity Database

    Hemminki, K.; Rachakonda, S.; Musak, L.; Vymetálková, Veronika; Halasová, E.; Forsti,, A.; Vodičková, Ludmila; Buchancová, J.; Vodička, Pavel; Kumar, R.

    2015-01-01

    Roč. 54, č. 3 (2015), s. 194-196. ISSN 1045-2257 Institutional support: RVO:68378041 Keywords : structural chromosome aberrations * healthy subjects * relative telomere length * genotoxicity * telomere biology Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.041, year: 2014

  13. Evaluation of respiration of mitochondria in cancer cells exposed to mitochondria-targeted agents.

    Czech Academy of Sciences Publication Activity Database

    Klučková, Katarína; Dong, L. F.; Bajziková, Martina; Rohlena, Jakub; Neužil, Jiří

    2015-01-01

    Roč. 1265, 07 Oct 2015 (2015), s. 181-194. ISSN 1940-6029 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:86652036 Keywords : Animals * Antineoplastic Agents * drug effects * *pharmacology Subject RIV: EB - Genetics ; Molecular Biology

  14. Diseases caused by defects of energy level and loss ofcoherence in living cells

    Czech Academy of Sciences Publication Activity Database

    Jandová, Anna; Pokorný, Jan; Pokorný, Jiří; Kobilková, J.; Nedbalová, M.; Čoček, A.; Jelínek, František; Vrba, J.; Vrba, J. jr.; Dohnalová, A.; Kytnarová, J.; Tuszyński, J.A.; Foletti, A.

    2015-01-01

    Roč. 34, č. 2 (2015), 151-155. ISSN 1536-8378 Institutional support: RVO:68378271 ; RVO:67985882 Keywords : cell-mediated immunity response * LDH virus antigen * cancer * myocardial infarction * schizophrenia * abortion * pathological energy states Subject RIV: BO - Biophysics Impact factor: 1.194, year: 2014

  15. Statistical Significance, Effect Size, and Replication: What Do the Journals Say?

    Science.gov (United States)

    DeVaney, Thomas A.

    2001-01-01

    Studied the attitudes of representatives of journals in education, sociology, and psychology through an electronic survey completed by 194 journal representatives. Results suggest that the majority of journals do not have written policies concerning the reporting of results from statistical significance testing, and most indicated that statistical…

  16. Multiplex polymerase chain reaction-based prognostic models in diffuse large B-cell lymphoma patients treated with R-CHOP

    DEFF Research Database (Denmark)

    Green, Tina M; Jensen, Andreas K; Holst, René;

    2016-01-01

    We present a multiplex analysis for genes known to have prognostic value in an attempt to design a clinically useful classification model in patients with diffuse large B-cell lymphoma (DLBCL). Real-time polymerase chain reaction was used to measure transcript levels of 28 relevant genes in 194 de...

  17. Disease: H00548 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available pers HH, Hamel BC X-linked mental retardation. Nat Rev Genet 6:46-57 (2005) PMID:8862875 Brunner HG MAOA deficiency and abnormal beha...viour: perspectives on an association. Ciba Found Symp 194:155-64; discussion 164-7 (1996) ...

  18. 75 FR 36773 - Pipeline Safety: Updating Facility Response Plans in Light of the Deepwater Horizon Oil Spill

    Science.gov (United States)

    2010-06-28

    ... Light of the Deepwater Horizon Oil Spill AGENCY: Pipeline and Hazardous Materials Safety Administration... Bulletin to operators of hazardous liquid pipeline facilities required to prepare and submit an oil spill response plan under 49 CFR part 194. In light of the Deepwater Horizon oil spill in the Gulf of...

  19. Advances in On-line Absolute Trace Gas Analysis by SIFT-MS

    Czech Academy of Sciences Publication Activity Database

    Španěl, Patrik; Smith, D.

    2013-01-01

    Roč. 9, č. 4 (2013), s. 525-539. ISSN 1573-4110 Institutional support: RVO:61388955 Keywords : selected ion flow tube mass spectrometry * SIFT-MS * volatile organic compounds Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.194, year: 2013

  20. Association between C reactive protein and coronary heart disease : mendelian randomisation analysis based on individual participant data

    NARCIS (Netherlands)

    Wensley, Frances; Gao, Pei; Burgess, Stephen; Kaptoge, Stephen; Di Angelantonio, Emanuele; Shah, Tina; Engert, James C.; Clarke, Robert; Davey-Smith, George; Nordestgaard, Borge G.; Saleheen, Danish; Samani, Nilesh J.; Sandhu, Manjinder; Anand, Sonia; Pepys, Mark B.; Smeeth, Liam; Whittaker, John; Casas, Juan Pablo; Thompson, Simon G.; Hingorani, Aroon D.; Danesh, John; Eiriksdottir, G.; Harris, T. B.; Launer, L. J.; Gudnason, V.; Folsom, A. R.; Andrews, G.; Ballantyne, C. M.; Samani, N. J.; Hall, A. S.; Braund, P. S.; Balmforth, A. J.; Whincup, P. H.; Morris, R.; Lawlor, D. A.; Lowe, G. D. O.; Timpson, N.; Ebrahim, S.; Ben-Shlomo, Y.; Davey-Smith, G.; Timpson, N.; Nordestgaard, B. G.; Tybjaerg-Hansen, A.; Zacho, J.; Brown, M.; Sandhu, M.; Ricketts, S. L.; Ashford, S.; Lange, L.; Reiner, A.; Cushman, M.; Tracy, R.; Wu, C.; Ge, J.; Zou, Y.; Sun, A.; Hung, J.; McQuillan, B.; Thompson, P.; Beilby, J.; Warrington, N.; Palmer, L. J.; Wanner, C.; Drechsler, C.; Hoffmann, M. M.; Fowkes, F. G. R.; Lowe, G. D. O.; Tzoulaki, I.; Kumari, M.; Miller, M.; Marmot, M.; Onland-Moret, C.; van der Schouw, Y. T.; Boer, J. M.; Wijmenga, C.; Ricketts, S. L.; Ashford, S.; Sandhu, M.; Khaw, K-T; Vasan, R. S.; Schnabel, R. B.; Yamamoto, J. F.; Benjamin, E. J.; Schunkert, H.; Erdmann, J.; Koenig, I. R.; Hengstenberg, C.; Chiodini, B.; Franzosi, M. G.; Pietri, S.; Gori, F.; Rudock, M.; Liu, Y.; Lohman, K.; Harris, T. B.; Humphries, S. E.; Hamsten, A.; Norman, P. E.; Hankey, G. J.; Jamrozik, K.; Palmer, L. J.; Rimm, E. B.; Pai, J. K.; Psaty, B. M.; Heckbert, S. R.; Bis, J. C.; Yusuf, S.; Anand, S.; Engert, J. C.; Xie, C.; Collins, R.; Clarke, R.; Bennett, D.; Kooner, J.; Chambers, J.; Elliott, P.; Maerz, W.; Kleber, M. E.; Boehm, B. O.; Winkelmann, B. R.; Melander, O.; Berglund, G.; Koenig, W.; Thorand, B.; Baumert, J.; Peters, A.; Rimm, E. B.; Manson, J.; Pai, J. K.; Humphries, S. E.; Cooper, J. A.; Talmud, P. J.; Ladenvall, P.; Johansson, L.; Jansson, J-H; Hallmans, G.; Reilly, M. P.; Qu, L.; Li, M.; Rader, D. J.; Watkins, H.; Clarke, R.; Hopewell, J.; Saleheen, D.; Danesh, J.; Frossard, P.; Sattar, N.; Robertson, M.; Shepherd, J.; Schaefer, E.; Hofman, A.; Witteman, J. C. M.; Kardys, I.; Dehghan, A.; de Faire, U.; Bennet, A.; Gigante, B.; Leander, K.; Ben-Shlomo, Y.; Davey-Smith, G.; Timpson, N.; Peters, B.; Maitland-van der Zee, A. H.; de Boer, A.; Klungel, O.; Reiner, A.; Manson, J.; Greenland, P.; Dai, J.; Liu, S.; Brunner, E.; Kivimaki, M.; Marmot, M.; Sattar, N.; O'Reilly, D.; Ford, I.; Packard, C. J.

    2011-01-01

    Objective To use genetic variants as unconfounded proxies of C reactive protein concentration to study its causal role in coronary heart disease. Design Mendelian randomisation meta-analysis of individual participant data from 47 epidemiological studies in 15 countries. Participants 194 418 particip

  1. Charge carrier photogeneration in polymer nanocomposites

    Czech Academy of Sciences Publication Activity Database

    Pfleger, Jiří; Pavlík, Martin; Vohlídal, J.

    Brno : Czech Society for New Materials and Technologies, 2004, s. 194-199. ISBN 80-214-2793-0. [International Conference Nano. Brno (CZ), 13.09.2004-15.09.2004] R&D Projects: GA AV ČR IAA4050406 Keywords : nanocomposites * conjugated polymers * photoconductivity Subject RIV: CD - Macromolecular Chemistry

  2. Corporal Punishment in Tanzania's Schools

    Science.gov (United States)

    Feinstein, Sheryl; Mwahombela, Lucas

    2010-01-01

    The purpose of this survey was to acquire descriptive information regarding corporal punishment in Tanzania's O-level secondary schools. 448 individuals participated in the study: 254 teachers and 194 students, all from government or private secondary schools in the Iringa Region of Tanzania. In addition, 14 students and 14 teachers were…

  3. Study of Locomotor Disability due to Various Types of Trauma

    Directory of Open Access Journals (Sweden)

    Sandip Rameshrao Dhole

    2015-09-01

    Conclusion: Trauma contributes not only to significant number of disabilities, but also to severity of disability. Road traffic accidents and railway accidents are major causes of traumatic locomotor disability and young persons are the usual victims of such disasters. [Natl J Med Res 2015; 5(3.000: 194-198

  4. Auxin transport routes in plant development

    Czech Academy of Sciences Publication Activity Database

    Petrášek, Jan; Friml, J.

    2009-01-01

    Roč. 136, č. 16 (2009), s. 2675-2688. ISSN 0950-1991 R&D Projects: GA AV ČR KJB600380604 Institutional research plan: CEZ:AV0Z50380511 Keywords : ROOT- HAIR DEVELOPMENT * ARABIDOPSIS-THALIANA * LATERAL ROOT Subject RIV: ED - Physiology Impact factor: 7.194, year: 2009

  5. 75 FR 34196 - Self-Regulatory Organizations; Notice of Filing of Proposed Rule Change by EDGX Exchange, Inc...

    Science.gov (United States)

    2010-06-16

    ... Organization's Statement of the Terms of Substance of the Proposed Rule Change EDGX proposes to make changes to...-Regulatory Organization's Statement of the Purpose of, and Statutory Basis for, the Proposed Rule Change 1... Exchange Release No. 61698 (March 12, 2010), 75 FR 13151 (March 18, 2010) (approving File Nos. 10-194...

  6. 75 FR 34189 - Self-Regulatory Organizations; Notice of Filing of Proposed Rule Change by EDGA Exchange, Inc...

    Science.gov (United States)

    2010-06-16

    ... Organization's Statement of the Terms of Substance of the Proposed Rule Change EDGA proposes to make changes to...-Regulatory Organization's Statement of the Purpose of, and Statutory Basis for, the Proposed Rule Change 1... Exchange Release No. 61698 (March 12, 2010), 75 FR 13151 (March 18, 2010) (approving File Nos. 10-194...

  7. Brain scintigraphy with Tc99-pertechnetate in the evaluation of patients with cerebrovascular lesions. The diagnostic value related to age of the lesion and to the size, type and localisation revealed by CT-scan

    DEFF Research Database (Denmark)

    Olsen, T S; Christensen, J; Skriver, E B; Lassen, N A

    1983-01-01

    average 3 days, 18 days and 207 days after the stroke. The detection rate of Tc99-scan was 31% on day 5, 47% on day 18, 18% on day 103 and 9% on day 194. The detection rate was however highly dependent upon: (i) the localisation of the lesion, i.e. superficially localised lesions were nearly always...

  8. GloptiPoly: Global optimization over polynomials with Matlab and SeDuMi

    Czech Academy of Sciences Publication Activity Database

    Henrion, Didier; Lasserre, J.-B.

    č. 2 (2003), s. 165-194. ISSN 0098-3500 R&D Projects: GA MŠk ME 496 Institutional research plan: CEZ:AV0Z1075907 Keywords : polynomial programming * semidefinite programming * linear matrix inequality Subject RIV: BC - Control Systems Theory Impact factor: 0.979, year: 2003

  9. The BNCT project in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Burian, J.; Marek, M.; Rataj, J.; Honova, H.; Petruželka, L.; Prokeš, K.; Tovaryš, F.; Dbalý, V.; Honzátko, Jaroslav; Tomandl, Ivo

    Osaka : Osaka International Convention Center , 2000. s. 193-194. [International Symposium on Neutron Capture Therapy for Cancer /9./. 02.10.2000-06.10.2000, Osaka] Institutional research plan: CEZ:AV0Z1048901 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  10. Androgyny, Masculinity, and Self-Esteem.

    Science.gov (United States)

    Lundy, Allan; Rosenberg, Judy A.

    1987-01-01

    Administered Coopersmith Self-Esteem Inventory and Bem Sex Role Inventory to 194 adults. Found androgyny scale emphasizing masculinity was most predictive of self-esteem, due to strong correlation found between masculinity and self-esteem. Found no effects due to femininity, interaction of femininity and masculinity, or sex. (Author/NB)

  11. Catalytic applications and FTIR investigation of zeolite SSZ-33 after isomorphous substitution

    Czech Academy of Sciences Publication Activity Database

    Vitvarová, Dana; Kurfiřtová, Lenka; Kubů, Martin; Žilková, Naděžda

    2014-01-01

    Roč. 194, AUG 2014 (2014), s. 174-182. ISSN 1387-1811 R&D Projects: GA ČR GAP106/11/0819 Institutional support: RVO:61388955 Keywords : SSZ-33 * acidity * toluene alkylation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.453, year: 2014

  12. Bordetella pertussis Adenylate Cyclase Toxin Blocks Induction of Bactericidal Nitric Oxide in Macrophages through cAMP-Dependent Activation of the SHP-1 Phosphatase

    Czech Academy of Sciences Publication Activity Database

    Černý, Ondřej; Kamanová, Jana; Mašín, Jiří; Bíbová, Ilona; Škopová, Karolína; Šebo, Peter

    2015-01-01

    Roč. 194, č. 10 (2015), s. 4901-4913. ISSN 0022-1767 R&D Projects: GA ČR GAP302/12/0460; GA ČR GA13-14547S Institutional support: RVO:61388971 Keywords : CYCLIC-AMP * MURINE MACROPHAGES * IFN-GAMMA Subject RIV: EE - Microbiology, Virology Impact factor: 4.922, year: 2014

  13. EST Table: BY943601 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BY943601 E_FL_e100_22G10_R_0 10/09/28 57 %/194 aa ref|NP_001119728.1| hemolymph ... protein [Bombyx ... mori] dbj|BAA02093.1| hemolymph ... protein [Bombyx mori] 10/08/30 n.h 10/08/28 n.h 10 ...

  14. Aktuální přehled stavu užívání konopných drog v České republice z perspektivy školních a celopopulačních studií

    Czech Academy of Sciences Publication Activity Database

    Miovský, Michal; Šťastná, L.; Řehan, V.

    2004-01-01

    Roč. 8, č. 3 (2004), s. 194-199. ISSN 1211-7579 R&D Projects: GA ČR GA406/02/1449 Institutional research plan: CEZ:AV0Z7025918 Keywords : Cannabis * epidemiological indicators * drug use Subject RIV: AN - Psychology

  15. AcEST: DK956074 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Oryzain alpha chain OS=Oryza sativa subsp. ... 139 8e-33 sp|Q94B08|GCP1_ARATH Germination... 183 DCDTSYNEGCNG 194 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=Arabidopsis thaliana

  16. Polysome Profile Analysis - Yeast

    Czech Academy of Sciences Publication Activity Database

    Pospíšek, M.; Valášek, Leoš

    2013-01-01

    Roč. 530, č. 2013 (2013), s. 173-181. ISSN 0076-6879 Institutional support: RVO:61388971 Keywords : grow yeast cultures * polysome profile analysis * sucrose density gradient centrifugation Subject RIV: CE - Biochemistry Impact factor: 2.194, year: 2013

  17. How Reading Strategy Use and Personality Types Are Related?

    Science.gov (United States)

    Safdarian, Zahra; Ghyasi, Majid; Farsani, Mohammad Amini

    2014-01-01

    This study sought to uncover the reading strategies utilized by Iranian undergraduate English Foreign Language (EFL) learners and their relationship with personality types. To this end, 194 university EFL learners were asked to fill out the Myers-Briggs Type Indicator (MBTI) to identify their personality types and answer a reading strategy…

  18. The Motivations of Exchange Students at Scandinavian Universities

    DEFF Research Database (Denmark)

    Caudery, Tim; Petersen, Margrethe; Shaw, Philip

    2008-01-01

    on a section of a project[1] on non-language students, intended to identify the motivational factors associated with exchange visits. A total of 194 exchange students spread across four host institutions, two in Sweden, two in Denmark, were interviewed. Language learning motivation varied, with high motivation...

  19. Breath Analysis and the Measurement of Total Body Water Using Isotope Dilution - Applications in the Dialysis Clinic

    Czech Academy of Sciences Publication Activity Database

    Davies, S. J.; Engel, B.; Chan, C.; Tan, B. K.; Yu, Z.; Asghar, R. B.; John, B.; Španěl, Patrik; Smith, D.

    2013-01-01

    Roč. 9, č. 4 (2013), s. 593-599. ISSN 1573-4110 R&D Projects: GA ČR GA203/00/0632 Institutional support: RVO:61388955 Keywords : bioimpedance * body composition * dialysis Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.194, year: 2013

  20. Lisabonská smlouva a závaznost Listiny základních práv EU pro Českou republiku vzhledem k tzv.výjimce (opt-out)

    Czech Academy of Sciences Publication Activity Database

    Šturma, Pavel

    2010-01-01

    Roč. 18, č. 6 (2010), s. 191-194. ISSN 1210-6410 Institutional research plan: CEZ:AV0Z70680506 Keywords : the Lisbon Treaty * the Charter of Fundamental Rights of the EU Subject RIV: AG - Legal Sciences