WorldWideScience

Sample records for astatine 193

  1. Organic chemistry of astatine

    International Nuclear Information System (INIS)

    The paper surveys the investigations on the chemical behaviour of astatine in organic systems and deals with the preparation and identification of its organic compounds. A discussion is given on some of the physico-chemical properties of these compounds determined by extrapolation techniques as well as by direct measurement. The biomedical importance of 211At-labelled compounds is briefly referred to. (authors)

  2. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  3. Astatine-211: production and availability.

    Science.gov (United States)

    Zalutsky, Michael R; Pruszynski, Marek

    2011-07-01

    The 7.2-h half life radiohalogen (211)At offers many potential advantages for targeted α-particle therapy; however, its use for this purpose is constrained by its limited availability. Astatine-211 can be produced in reasonable yield from natural bismuth targets via the (209)Bi(α,2n)(211)At nuclear reaction utilizing straightforward methods. There is some debate as to the best incident α-particle energy for maximizing 211At production while minimizing production of (210)At, which is problematic because of its 138.4-day half life α-particle emitting daughter, (210)Po. The intrinsic cost for producing (211)At is reasonably modest and comparable to that of commercially available (123)I. The major impediment to (211)At availability is attributed to the need for a medium energy α-particle beam for its production. On the other hand, there are about 30 cyclotrons in the world that have the beam characteristics required for (211)At production. PMID:22201707

  4. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211At species, 211At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  5. Dosimetrical considerations in astatine-211 radioimmunotherapy

    International Nuclear Information System (INIS)

    Several dosimetrical quantities have been suggested for use in alpha-particle dosimetry. To evaluate the expected biological effect when using these quantities, a Monte Carlo program was set to register the single-event distribution of both specific energy and alpha-particle track length to a cell nucleus (r=5.6 μm). Distributions were acquired for both 'bound' (simulating the effect of 211At-labelled antibodies bound to antigens on cell surfaces (r=7.0 μm)) as well as 'non-bound' (simulating 211At-labelled antibodies that have not bound to a cell) astatine-211. From these distributions, various theoretical cell survival curves were established for 3 different dosimetrical quantities, i.e. specific energy, number of alpha-particle hits and total track length. The survival curves for all quantities are presented for the corresponding mean absorbed dose in order to facilitate comparisons of the expected effects of using the 3 different quantities for both distributions of 211At decays. The theoretical survival curves presented here could, combined with experiments using 'bound' and 'non-bound' 211At in a single-cell suspension, reveal which dosimetrical quantity is most suitable for 211 At-radioimmunotherapy. (author)

  6. Discovery of the astatine, radon, francium, and radium isotopes

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  7. Extraction of astatine isotopes for development of radiopharmaceuticals using a 211Rn-211At generator

    International Nuclear Information System (INIS)

    In order to utilize a 211At isotope, a promising α-emitter for radionuclide therapy, the chemical properties of astatine isotopes are studied. We have examined wet chemistry methods through the distribution ratios of astatine in liquid-liquid extraction. The astatine isotopes have been found to be well extracted into DIPE and MIBK. We observed that the distribution ratio of astatine isotopes increases with concentrations of HCl greater than 3 M, while it decreases with the HCl concentration less than 2 M. The results will be useful for development of the 211Rn-211At generator. (author)

  8. Astatine-211-Labeled Targeted Radiotherapeutics: An Update

    International Nuclear Information System (INIS)

    The heavy halogen 211At was first proposed for use in α-particle targeted radiotherapy more than 30 years ago and continues to be one of the most promising radionuclides for this purpose. Although its 7.2-h half life is not ideal for intravenously administered whole antibodies, it is compatible with the pharmacokinetics of antibody fragments, peptides, aptamers and organic molecules. Its diverse chemistry allows its incorporation into a wide array of targeting vehicles, relying on its chemical similarity to iodine to provide a useful point of departure. On the other hand, the relatively low carbon-astatine bond strength is challenging. In common with the other α-emitters being discussed at this symposium, lack of reliable availability is one of the biggest hurdles in the use of 211At for targeted radiotherapy. However, in the case of 211At, it is not a question of production cost or availability of target material, because 211At can be produced in reasonable yield from natural bismuth targets. Rather, the difficulty is the lack of cyclotrons equipped with the medium energy α-particle beams required for its production. If the infrastructure for producing 211At is to be improved to the stage where 211At-labeled radiopharmaceuticals can have a meaningful impact, several developments must occur. First, the ability to produce clinically relevant levels of 211At that can be shipped to remote locations in chemically tractable form must be demonstrated. Approaches under consideration include compensating for radiolysis-mediated effects and the consideration of alternative chemistries. Second, strategies for compensating for heterogeneities in dose deposition must be developed, hopefully in a way that is compatible with approval for human use. And third, it is essential that more clinical trials be performed with 211At-labeled therapeutics, particularly in settings of minimum residual disease where the radiobiological advantages of α-particles can be best exploited. Our

  9. Scrutinizing "Invisible" astatine: A challenge for modern density functionals.

    Science.gov (United States)

    Sergentu, Dumitru-Claudiu; David, Grégoire; Montavon, Gilles; Maurice, Rémi; Galland, Nicolas

    2016-06-01

    The main-group 6p elements did not receive much attention in the development of recent density functionals. In many cases it is still difficult to choose among the modern ones a relevant functional for various applications. Here, we illustrate the case of astatine species (At, Z = 85) and we report the first, and quite complete, benchmark study on several properties concerning such species. Insights on geometries, transition energies and thermodynamic properties of a set of 19 astatine species, for which reference experimental or theoretical data has been reported, are obtained with relativistic (two-component) density functional theory calculations. An extensive set of widely used functionals is employed. The hybrid meta-generalized gradient approximation (meta-GGA) PW6B95 functional is overall the best choice. It is worth noting that the range-separated HSE06 functional as well as the old and very popular B3LYP and PBE0 hybrid-GGAs appear to perform quite well too. Moreover, we found that astatine chemistry in solution can accurately be predicted using implicit solvent models, provided that specific parameters are used to build At cavities. © 2016 Wiley Periodicals, Inc. PMID:27059181

  10. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  11. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates.

    Science.gov (United States)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Svedhem, Sofia; Lindegren, Sture

    2016-03-16

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single cancer cells. A promising radioactive nuclide for this type of therapy is astatine-211. Astatine-211 attached to tumor-specific antibodies as carrier molecules is a system currently under investigation for use in targeted alpha therapy. In the common radiolabeling procedure, astatine is coupled to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies. PMID:26791409

  12. Astatine-211: production, injection into monoclonal antibodies radiological effect, possible application to cancer treatment

    International Nuclear Information System (INIS)

    Methods developed in the Laboratory of Nuclear Problems, JINR, for producing astatine-211 and injecting it into monoclonal antibodies are described. The use of its diethylene triamine penta-acetic acid complex is shown to be the most effective method of injecting astatine into a biomolecules. The biological effect of the α-particles emitted from the astatine-211 is investigated using Chinese hamster fibroblasts and Ehrlich carcinoma cells. It is established that the mitotic activity depression, number of degenerating cells, number of cells with chromosome aberrations, and cellular surviving fraction depend on the concentration of the radionuclide in the medium 'in vitro'. The RBE of α-particles in comparison with 60Co γ-rays is 3. Injection of astatine-211 absorbed on tellurium particles into mice with ascitic tumors resulted in prolongation of their life or elimination of the tumors. (author). 39 refs, 7 figs

  13. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    OpenAIRE

    Rothe, S.; A. N. Andreyev; Antalic, S; Borschevsky, A.; Capponi, L.; Cocolios, T.E.; Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the io...

  14. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    Science.gov (United States)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-07-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and physical properties for use in targeted therapies for cancer. Due to the very short range of the emitted α-particles, this therapy is particularly suited to treating occult, disseminated cancers. Astatine is not intrinsically tumour-specific; therefore, it requires an appropriate tumour-specific targeting vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method that combines dry distillation of astatine-211 and a synthesis module for producing radiopharmaceuticals into a process platform. This platform will standardize production of astatinated radiopharmaceuticals, and hence, it will facilitate large clinical studies focused on this promising, but chemically challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies.

  15. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-01-01

    vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method......To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  16. Study of Astatine (III) reactions with O, S and N ligands in solution

    International Nuclear Information System (INIS)

    Full text of publication follows. Astatine (At, Z=85: [Xe]4f145d106s26p5) belongs to the halogen group and is located below iodine in the periodic table. One of its isotopes (211At) appears promising as a therapeutic agent in nuclear medicine (Ref.1) owing to the energy of the alpha particles emitted during the disintegration of its nucleus and its short physical half-life (7.2 h). Since there are no stable isotopes of astatine, the chemistry of this element remains poorly understood. Generally, At is supposed to behave as a halogen (Ref.2) but it has been shown recently in our group that astatine presents a metallic behaviour in aqueous solution: it notably exists as At+ and AtO+ species under the oxidation states +I and +III (Ref.3). At the present time, the number of studies dealing with the complexation properties of the cationic forms of astatine remains limited (Ref.4), owing to its low availability. In this work, we have investigated the reactions of AtO+ species with different hetero-atomic (N, S, O) model ligands. A combined approach based on experimental and theoretical studies has been used (Ref.5). On account of the difficulties of experimental investigations of astatine species, the reactivity of AtO+ was explored using a competition method founded on astatine distributions between two distinct phases. Furthermore, for each AtO+/ ligand complex, the nature of the species formed and the associated thermodynamic constants were determined by computational modeling (DFT calculations). In this framework, an original computational methodology was developed to take into account the specificities of astatine, notably the associated relativistic effects. The computed equilibrium constants have been confronted with the experimental results. This comparison demonstrates an outstanding coherence between experience and theory. Furthermore, the analysis of the results shows a key role of solvent effects on astatine chemistry. Lastly, a specific reactivity for the

  17. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments (209At, 210At, 211At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  18. Astatine-211 Pathway from Radiochemistry to Clinical Investigation

    International Nuclear Information System (INIS)

    Particularly in clinical settings where tumour burden is low and cancers are located in close proximity to essential normal tissue structures, α-particle emitting radionuclides can offer significant advantages for targeted radionuclide therapy. One of the first alpha emitters to be evaluated for this purpose is the 7.2-h half-life radiohalogen Astatine-211 (211At). From a commercialization-potential perspective 211At, is less appealing than the longer half-life alpha particle emitters Radium-223, Actinium-225 and Thorium-227, which have become the focus of many laboratories. However, if methods for providing a better supply of 211At could be developed, this alpha emitter would be the radionuclide of choice for many potential therapeutic applications. With regard to the production of 211At, this can be readily be accomplished by bombarding natural bismuth targets with 28−29.5 MeV alpha particles via the 209Bi(α,2n)211At reaction. The goal is to utilize an alpha particle beam energy that provides the required balance for maximizing 211At production while minimizing creation of 210At, which is problematic because of its 138.4-day half life alpha-particle emitting daughter, 210Po. For most intended clinical applications, alpha particle beam energy of about 29 MeV offers the best compromise between maximizing yield and providing 211At with sufficient radionuclidic purity for clinical use. Clinically relevant levels of 211At have been produced at several institutions using both internal and external cyclotron targets

  19. 32 CFR 193.3 - Policy.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Policy. 193.3 Section 193.3 National Defense... NATIONAL DEFENSE § 193.3 Policy. In order to insure that the national defense is served by adequate, safe and efficient highway transportation, it shall be the policy of the DoD to (a) integrate the...

  20. 49 CFR 193.2709 - Security.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Security. 193.2709 Section 193.2709 Transportation...: FEDERAL SAFETY STANDARDS Personnel Qualifications and Training § 193.2709 Security. Personnel having security duties must be qualified to perform their assigned duties by successful completion of the...

  1. 49 CFR 193.2715 - Training: security.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Training: security. 193.2715 Section 193.2715...: FEDERAL SAFETY STANDARDS Personnel Qualifications and Training § 193.2715 Training: security. (a) Personnel responsible for security at an LNG plant must be trained in accordance with a written plan...

  2. 49 CFR 193.2711 - Personnel health.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Personnel health. 193.2711 Section 193.2711...: FEDERAL SAFETY STANDARDS Personnel Qualifications and Training § 193.2711 Personnel health. Each operator shall follow a written plan to verify that personnel assigned operating, maintenance, security, or...

  3. 49 CFR 193.2511 - Personnel safety.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Personnel safety. 193.2511 Section 193.2511...: FEDERAL SAFETY STANDARDS Operations § 193.2511 Personnel safety. (a) Each operator shall provide any special protective clothing and equipment necessary for the safety of personnel while they are...

  4. 49 CFR 193.2607 - Foreign material.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Foreign material. 193.2607 Section 193.2607 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY...: FEDERAL SAFETY STANDARDS Maintenance § 193.2607 Foreign material. (a) The presence of foreign...

  5. 49 CFR 193.2161 - Dikes, general.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Dikes, general. 193.2161 Section 193.2161...: FEDERAL SAFETY STANDARDS Design Impoundment Design and Capacity § 193.2161 Dikes, general. An outer wall of a component served by an impounding system may not be used as a dike unless the outer wall...

  6. 49 CFR 193.2303 - Construction acceptance.

    Science.gov (United States)

    2010-10-01

    ...: FEDERAL SAFETY STANDARDS Construction § 193.2303 Construction acceptance. No person may place in service... 49 Transportation 3 2010-10-01 2010-10-01 false Construction acceptance. 193.2303 Section 193.2303 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS...

  7. 7 CFR 4280.193 - Combined funding.

    Science.gov (United States)

    2010-01-01

    .... In addition to the requirements specified in paragraphs (a) through (e) of this section, the combined... 7 Agriculture 15 2010-01-01 2010-01-01 false Combined funding. 4280.193 Section 4280.193... Efficiency Improvements Program Section D. Combined Funding § 4280.193 Combined funding. The requirements...

  8. 46 CFR 193.50-5 - Classification.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Classification. 193.50-5 Section 193.50-5 Shipping COAST... Details § 193.50-5 Classification. (a) Hand portable fire extinguishers and semiportable fire...) Classification Type Size Soda-acid and water, gals. Foam, gals. Carbon dioxide, lbs. Dry chemical, lbs. A II...

  9. 49 CFR 193.2441 - Control center.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Control center. 193.2441 Section 193.2441...: FEDERAL SAFETY STANDARDS Equipment Vaporization Equipment § 193.2441 Control center. Each LNG plant must have a control center from which operations and warning devices are monitored as required by this...

  10. 49 CFR 193.2517 - Purging.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Purging. 193.2517 Section 193.2517 Transportation...: FEDERAL SAFETY STANDARDS Operations § 193.2517 Purging. When necessary for safety, components that could accumulate significant amounts of combustible mixtures must be purged in accordance with a procedure...

  11. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  12. Dicty_cDB: SLA193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLA193 (Link to dictyBase) - - - - SLA193E (Link to Original site) - - - - - - SLA...193E 293 Show SLA193 Library SL (Link to library) Clone ID SLA193 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLA1-D/SLA...193Q.Seq.d/ Representative seq. ID SLA193E (Link to Original site) R...epresentative DNA sequence >SLA193 (SLA193Q) /CSM/SL/SLA1-D/SLA193Q.Seq.d/ GTATGTCAAATGATTCCCCAAAGAGTTCAAACA

  13. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  14. 49 CFR 193.2519 - Communication systems.

    Science.gov (United States)

    2010-10-01

    ...: FEDERAL SAFETY STANDARDS Operations § 193.2519 Communication systems. (a) Each LNG plant must have a... operation of safety equipment in time of emergency. The emergency communication system must be independent... 49 Transportation 3 2010-10-01 2010-10-01 false Communication systems. 193.2519 Section...

  15. Labelling prospects of astatine-211 with immunoglobulins (IgG): some general considerations

    International Nuclear Information System (INIS)

    The tumour therapeutic potential of the short lived alpha emitting radiohalogen 211At has been already been well recognised in the field of radioimmuno therapy. There is no evidence as such to show that astatine itself is a tumour seeking isotope. Therefore it has to be tagged to tumour seeking compound such as a drug or a protein preferably an antibody (IgG). In this communication, the labelling parameters which are required to be investigated for obtaining a stable product which could be useful as radioimmuno therapeutic agent, are described. (author). 6 refs

  16. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron anity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photodetachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral linewidth of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in o-line tests by the clear observation of the photodetachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148 [1].

  17. Extraction of 211At-astatine from hydrochloric acid solutions by means of TOPO, TBP, and triphenylphosphine

    International Nuclear Information System (INIS)

    The extraction behaviour of astatine was studied under defined conditions from hydrochloride acid solutions (cHCl>0.1 M or 1 and 2M). Therefore other effects like adsorption, reduction or hydrolysis can be excluded. The present work describes the extraction with tri- n- octylphosphinoxide (TOPO), tri- n-butylphosphate (TBP) and tri-phenylphosphine in chloroform. (orig.)

  18. No-carrier-added astatination of N-succinimidyl-3-(tri-n-butylstannyl) benzoate (ATE) via electrophilic destannylation

    International Nuclear Information System (INIS)

    The no-carrier-added synthesis of N-succinimidyl 3-[211At]astato-benzoate from N-succinimidyl 3-(tri-n-butylstannyl)benzoate (ATE) is described. The nature of the solvent in which the 211At was isolated from the target was an important factor influencing both the radiochemical yields and the nature of the incorporated astatine activity. (orig.)

  19. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    211At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At- to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At- anions, but first of all because of the kinetic inertness of low spin rhodium(III) d6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh3+. The experiments related to optimization of the reaction conditions were performed with the 131I, basing on a chemical similarity of I- to At-. The experiments with 211At were then carried out under the conditions found optimal for I-. The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211At-Rh(16-S4-diol) complex

  20. Configurations of superdeformed bands in 193Pb

    International Nuclear Information System (INIS)

    The six superdeformed bands in 193Pb have been studied with the EUROGAM 2 γ-ray spectrometer using the 168Er(30Si,5n)193Pb reaction. The results are discussed in terms of Cranked-Hartree-Fock-Bogoliubov-Lipkin-Nogami calculations. The bands are interpreted as three pairs of signature partners based on quasineutron excitations. Dipole transitions linking two signature partner superdeformed bands have been observed and, for the first time in lead isotopes, the branching ratio has been extracted. (author)

  1. 46 CFR 193.15-15 - Piping.

    Science.gov (United States)

    2010-10-01

    ... Commandant. (d) A pressure relief valve or equivalent set to relieve between 2,400 and 2,800 pounds per..., DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS FIRE PROTECTION EQUIPMENT Carbon Dioxide Extinguishing Systems, Details § 193.15-15 Piping. (a) The piping, valves, and fittings shall...

  2. Dicty_cDB: SHA193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHA193 (Link to dictyBase) - - - Contig-U16411-1 SHA193P (Link to Original ... kflqihyfykf*DQQHVIKRIMVILILAVDHLILGLLDDRDILSVLGDAG ATK --- ---SRLIGAPPGYVGYDQGGQLTEAVRRRPYSVVLFDEVEKAHQQVW ... kflqihyfykf*DQQHVIKRIMVILILAVDHLILGLLDDRDILSVLGDAG ATK --- ---SRLIGAPPGYVGYDQGGQLTEAVRRRPYSVVLFDEVEKAHQQVW ...

  3. Dicty_cDB: VSH193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSH193 (Link to dictyBase) - G21451 DDB0220127 Contig-U12777-1 VSH193E (Lin ... lvl*IHYVLESYQVNQWNGTRSMQHGGLAVSLLDAMAKKLKFKFQQFTLVPNGS CSR VDKRDVDPPLAYELYGTNDISLGRLFWYRRFDNGMIAFLQCIKELCE ... nyvnislkkiqnslfp tksikni*vecvlnynsqmmilgqnl*nlc*qt*ngs *fgllkmkl*lyliinnfnnqn* iiikiiiiliiixiiilirxiii Fra ... lvl*IHYVLESYQVNQWNGTRSMQHGGLAVSLLDAMAKKLKFKFQQFTLVPNGS CSR VDKRDVDPPLAYELYGTNDISLGRLFWYRRFDNGMIAFLQCIKELCE ... NXNN Homology vs CSM-cDNA Score E Sequences producing s ignificant alignments: (bits) Value VSH193 (VSH193 ...

  4. 49 CFR 192.193 - Valve installation in plastic pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Valve installation in plastic pipe. 192.193 Section 192.193 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND... Components § 192.193 Valve installation in plastic pipe. Each valve installed in plastic pipe must...

  5. 49 CFR 193.2635 - Monitoring corrosion control.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Monitoring corrosion control. 193.2635 Section 193... GAS FACILITIES: FEDERAL SAFETY STANDARDS Maintenance § 193.2635 Monitoring corrosion control. Corrosion protection provided as required by this subpart must be periodically monitored to give...

  6. 49 CFR 193.2707 - Operations and maintenance.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Operations and maintenance. 193.2707 Section 193.2707 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS... GAS FACILITIES: FEDERAL SAFETY STANDARDS Personnel Qualifications and Training § 193.2707...

  7. 49 CFR 193.2187 - Nonmetallic membrane liner.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Nonmetallic membrane liner. 193.2187 Section 193... GAS FACILITIES: FEDERAL SAFETY STANDARDS Design Lng Storage Tanks § 193.2187 Nonmetallic membrane liner. A flammable nonmetallic membrane liner may not be used as an inner container in a storage tank....

  8. 49 CFR 193.2631 - Internal corrosion control.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Internal corrosion control. 193.2631 Section 193... GAS FACILITIES: FEDERAL SAFETY STANDARDS Maintenance § 193.2631 Internal corrosion control. Each component that is subject to internal corrosive attack must be protected from internal corrosion by—...

  9. 27 CFR 24.193 - Conversion into still wine.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Conversion into still wine. 24.193 Section 24.193 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Effervescent Wine § 24.193 Conversion into still wine. Sparkling wine or...

  10. 46 CFR 193.10-5 - Fire pumps.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Fire pumps. 193.10-5 Section 193.10-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS FIRE PROTECTION EQUIPMENT Fire Main System, Details § 193.10-5 Fire pumps. (a) Vessels shall be equipped with...

  11. 49 CFR 193.2057 - Thermal radiation protection.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Thermal radiation protection. 193.2057 Section 193... GAS FACILITIES: FEDERAL SAFETY STANDARDS Siting Requirements § 193.2057 Thermal radiation protection...) The thermal radiation distances must be calculated using Gas Technology Institute's (GTI) report...

  12. 49 CFR 193.2615 - Isolating and purging.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Isolating and purging. 193.2615 Section 193.2615...: FEDERAL SAFETY STANDARDS Maintenance § 193.2615 Isolating and purging. (a) Before personnel begin... component must be purged in accordance with a procedure which meets the requirements of AGA...

  13. Unexpected Behavior of the Heaviest Halogen Astatine in the Nucleophilic Substitution of Aryliodonium Salts.

    Science.gov (United States)

    Guérard, François; Lee, Yong-Sok; Baidoo, Kwamena; Gestin, Jean-François; Brechbiel, Martin W

    2016-08-22

    Aryliodonium salts have become precursors of choice for the synthesis of (18) F-labeled tracers for nuclear imaging. However, little is known on the reactivity of these compounds with heavy halides, that is, radioiodide and astatide, at the radiotracer scale. In the first comparative study of radiohalogenation of aryliodonium salts with (125) I(-) and (211) At(-) , initial experiments on a model compound highlight the higher reactivity of astatide compared to iodide, which could not be anticipated from the trends previously observed within the halogen series. Kinetic studies indicate a significant difference in activation energy (Ea =23.5 and 17.1 kcal mol(-1) with (125) I(-) and (211) At(-) , respectively). Quantum chemical calculations suggest that astatination occurs via the monomeric form of an iodonium complex whereas iodination occurs via a heterodimeric iodonium intermediate. The good to excellent regioselectivity of halogenation and high yields achieved with diversely substituted aryliodonium salts indicate that this class of compounds is a promising alternative to the stannane chemistry currently used for heavy radiohalogen labeling of tracers in nuclear medicine. PMID:27305065

  14. Dicty_cDB: CHQ193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHQ193 (Link to dictyBase) - - - Contig-U11363-1 CHQ193P (Link to Original ... skliqki*lvki*llqvnqvlf*ks*ng*lnihl qqnhlktlsfyqnhh*ngs *ny*sikqyqeriitpssisrs*mlviqlk*enqlikfy*k iqilitliq ... nslk Homology vs CSM-cDNA Score E Sequences producing s ignificant alignments: (bits) Value CHQ193 (CHQ193 ... 004.12.25 Homology vs DNA Score E Sequences producing s ignificant alignments: (bits) Value N AC116982 |AC ... 11. 1 Homology vs Protein Score E Sequences producing s ignificant alignments: (bits) Value AC116982_20( A ...

  15. Study of 193Os beta- decay

    International Nuclear Information System (INIS)

    In this work, the excited levels of 193Ir populated by the beta- decay of 193Os (T1/2 ∼ 30h) were investigated. For that purpose, ∼ 5 mg samples of 99%-enriched 192Os were irradiated under a thermal neutron flux of ∼ 1012 s-1 and then analysed both using single gamma spectroscopy and a 4-detector multi parametric acquisition facility, which provided data for both a gamma gamma coincidence analysis and a directional angular correlation gamma gamma (θ ) study. From these data, 28 transitions were added to this decay scheme, 11 of which were previously known from nuclear reactions and 17 observed for the first time. Eight excited levels were also added to the decay scheme, 3 of which were known from nuclear reaction studies - the remaining 5 are suggested for the first time. Moreover, it was possible to confirm suspicions found in reference that the levels at 848.93 keV and 849.093 keV are indeed the same; it was also possible to confirm the existence of an excited level at 806.9 keV, which had been inferred, but not experimentally confirmed in beta decay studies to date. The angular correlation analysis allowed for the definition of the spin of the excited level at 874 keV as 5/2+; moreover, the results showed a 79% probability that the spin of the 1078 keV level is 5/2/'-, and also restricted the spin possibilities for the new excited level at 960 keV to two values (1/2 or 3/2). It was also possible to measure the multipolarity mixing ratio (δLn+1/Ln) for 43 transitions - 19 of them for the first time and most of the others with a better precision than previously known. Finally, an attempt was made to understand the low-lying levels structure for this nucleus using a theoretical model, which reproduced the ground state and the two lowest-lying excited levels in 193Ir. (author)

  16. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  17. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  18. 49 CFR 193.2627 - Atmospheric corrosion control.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Atmospheric corrosion control. 193.2627 Section 193.2627 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES: FEDERAL SAFETY...

  19. Dicty_cDB: VHG193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHG193 (Link to dictyBase) - - - Contig-U11297-1 VHG193P (Link to Original ... s rs*ri*tssry*rsicn*qrfl**ew*ipfi**n*s*rtrtrgfd*r**crn *kc*isyh *rvcsncs*rvcnncs*rvcnkaskilrkir*krkittnqk* ...

  20. 7 CFR 3015.193 - Other non-profit organizations.

    Science.gov (United States)

    2010-01-01

    ....193 Agriculture Regulations of the Department of Agriculture (Continued) OFFICE OF THE CHIEF FINANCIAL OFFICER, DEPARTMENT OF AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Cost Principles § 3015.193 Other... Circulars published in the Federal Register by OMB, shall be used in determining the allowable costs...

  1. IAU Colloquium 193 - A personal view

    Science.gov (United States)

    Kawaler, S. D.

    2004-05-01

    One of the more famous (or infamous) films of all time was Akira Kurosawa's Rashomon. In this film, Kurosawa tells the story of a terrible crime... and tells it four times. Each telling is from the perspective of a different character. In this masterful film the viewer is never quite sure what really happened; each of the protagonists tells the same tale but with their own personal interpretation. Summarizing a week spent in the cold clear air of wintertime Christchurch (and that was inside the lecture hall) is indeed a daunting task. Each of us who was fortunate enough to have attended IAU Colloquium 193 came away from the meeting with our own impressions, highlights, and revelations. So by writing now about by own reflections, my goal is to rekindle yours, rather than persuade you that my summary is any more authoritative than one you might write. Of course, those of you reading this who were not at the conference are stuck with this summary - but by reading the preceding papers in this volume you, too, can have a sense of the variety we enjoyed. Below, I start with a survey of some broad themes that emerged. A few results were of the `Gee Whiz' variety, and are outlined in the next section. A few old problems were revisited by several participants, and also some new problems have emerged, and I outline them next. After a nod to two very special participants in this Colloquium, I conclude with some final thoughts.

  2. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  3. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  4. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  5. 30 CFR 19.3 - Application procedures and requirements.

    Science.gov (United States)

    2010-07-01

    ..., EVALUATION, AND APPROVAL OF MINING PRODUCTS ELECTRIC CAP LAMPS § 19.3 Application procedures and requirements... accrediting organization; (2) Complete technical explanation of how the product complies with each...

  6. 34 CFR 300.193 - Request to show cause.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false Request to show cause. 300.193 Section 300.193... show cause. An SEA, LEA or other public agency in receipt of a notice under § 300.192 that seeks an opportunity to show cause why a by-pass should not be implemented must submit a written request for a...

  7. 27 CFR 479.193 - Arms Export Control Act.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Arms Export Control Act... CERTAIN OTHER FIREARMS Other Laws Applicable § 479.193 Arms Export Control Act. For provisions relating to... exporting arms, ammunition, or implements of war, see the Arms Export Control Act (22 U.S.C. 2778), and...

  8. Dicty_cDB: SHD193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHD193 (Link to dictyBase) - - - Contig-U11791-1 - (Link to Original site) ... n*kkkkxrxkk--- Translated Amino Acid sequence (All Frames ) Frame A: il*is*k*iisfiiiilinikfr*ninc*eyr*ik*r*ti ...

  9. Alternatives to chemical amplification for 193nm lithography

    Science.gov (United States)

    Baylav, Burak; Zhao, Meng; Yin, Ran; Xie, Peng; Scholz, Chris; Smith, Bruce; Smith, Thomas; Zimmerman, Paul

    2010-04-01

    Research has been conducted to develop alternatives to chemically amplified 193 nm photoresist materials that will be able to achieve the requirements associated with sub-32 nm device technology. New as well as older photoresist design concepts for non-chemically amplified 193 nm photoresists that have the potential to enable improvements in line edge roughness while maintaining adequate sensitivity, base solubility, and dry etch resistance for high volume manufacturing are being explored. The particular platforms that have been explored in this work include dissolution inhibitor photoresist systems, chain scissioning polymers, and photoresist systems based on polymers incorporating formyloxyphenyl functional groups. In studies of two-component acidic polymer/dissolution inhibitor systems, it was found that compositions using ortho-nitrobenzyl cholate (NBC) as the dissolution inhibitor and poly norbornene hexafluoro alcohol (PNBHFA) as the base resin are capable of printing 90 nm dense line/space patterns upon exposure to a 193 nm laser. Studies of chain scission enhancement in methylmethacrylate copolymers showed that incorporating small amounts of absorptive a-cleavage monomers significantly enhanced sensitivity with an acceptable increase in absorbance at 193 nm. Specifically, it was found that adding 3 mol% of α-methyl styrene (α-MS) reduced the dose to clear of PMMA-based resist from 1400 mJ/cm2 to 420 mJ/cm2. Preliminary data are also presented on a direct photoreactive design concept based on the photo-Fries reaction of formyloxyphenyl functional groups in acrylic copolymers.

  10. Stability and in vivo behavior of Rh[16aneS4-diol]211At complex: A potential precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Introduction: The heavy halogen 211At is of great interest for targeted radiotherapy because it decays by the emission of short-range, high-energy α-particles. However, many astatine compounds that have been synthesized are unstable in vivo, providing motivation for seeking other 211At labeling strategies. One relatively unexplored approach is to utilize prosthetic groups based on astatinated rhodium (III) complex stabilized with a tetrathioether macrocyclic ligand – Rh[16aneS4-diol]211At. The purpose of the current study was to evaluate the in vitro and in vivo stability of this complex in comparison to its iodine analog – Rh[16aneS4-diol]131I. Methods: Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I complexes were synthesized and purified by HPLC. The stability of both complexes was evaluated in vitro by incubation in phosphate-buffered saline (PBS) and human serum at different temperatures. The in vivo behavior of the two radiohalogenated complexes was assessed by a paired-label biodistribution study in normal Balb/c mice. Results: Both complexes were synthesized in high yield and purity. Almost no degradation was observed for Rh[16aneS4-diol]131I in PBS over a 72 h incubation. The astatinated analog exhibited good stability in PBS over 14 h. A slow decline in the percentage of intact complex was observed for both tracers in human serum. In the biodistribution study, retention of 211At in most tissues was higher than that of 131I at all time points, especially in spleen and lungs. Renal clearance of Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I predominated, with 84.1 ± 2.3% and 94.6 ± 0.9% of injected dose excreted via the urine at 4 h. Conclusions: The Rh[16aneS4-diol]211At complex might be useful for constructing prosthetic groups for the astatination of biomolecules and further studies are planned to evaluate this possibility

  11. 10 CFR 431.193 - Test procedures for measuring energy consumption of distribution transformers.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Test procedures for measuring energy consumption of distribution transformers. 431.193 Section 431.193 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION ENERGY... § 431.193 Test procedures for measuring energy consumption of distribution transformers. The...

  12. Highly excited Δ3 I=1 structures in 193Hg

    International Nuclear Information System (INIS)

    Highly excited states in the nucleus 193Hg have been investigated by in-beam γ-ray spectroscopic techniques using the EUROGAM array. The reaction 150Nd(48Ca,5n) at a beam energy of 213 MeV was used to populate states of 193Hg. The level scheme has been considerably extended (up to 10.7 MeV) and enriched from earlier studies. Two new structures of competing dipole and quadrupole transitions were observed. Experimental B(M1)/B(E2) ratios were determined for the two structures and compared with theoretical estimates. They were also compared with similar structures in the neighbouring Hg and Pb nuclei. (author)

  13. Novel single-layer photoresist containing cycloolefins for 193 nm

    Science.gov (United States)

    Park, Joo Hyeon; Seo, Dong-Chul; Kim, Ki-Dae; Park, Sun-Yi; Kim, Seong-Ju; Lee, Hosull; Jung, Jae Chang; Bok, Cheol-Kyu; Baik, Ki-Ho

    1998-06-01

    New matrix resins containing maleic anhydride and cycloolefin units for ArF excimer laser resist have been developed. Several series of these matrix resins having good dry-etching durability were prepared by free radical polymerization using AlBN as free radical initiator. All of the resists using the matrix resins revealed good coating uniformity and adhesion to silicon wafer, and were readily soluble in a variety of resist solvents such as MMP, EEP, PGMEA and EL. In preliminary 193 nm testing a resist formulated with the matrix resins sulfonium triflate as photoacid generator afforded positive images with 0.14 micrometers L/S resolution. In this paper, we will discuss the polymerization results and lithographic properties for 193 nm exposure tool.

  14. High-index nanocomposite photoresist for 193-nm lithography

    Science.gov (United States)

    Bae, Woo Jin; Trikeriotis, Makros; Rodriguez, Robert; Zettel, Michael F.; Piscani, Emil; Ober, Christopher K.; Giannelis, Emmanuel P.; Zimmerman, Paul

    2009-03-01

    In immersion lithography, high index fluids are used to increase the numerical aperture (NA) of the imaging system and decrease the minimum printable feature size. Water has been used in first generation immersion lithography at 193 nm to reach the 45 nm node, but to reach the 38 and 32 nm nodes, fluids and resists with a higher index than water are needed. A critical issue hindering the implementation of 193i at the 32 nm node is the availability of high refractive index (n > 1.8) and low optical absorption fluids and resists. It is critical to note that high index resists are necessary only when a high refractive index fluid is in use. High index resist improves the depth of focus (DOF) even without high index fluids. In this study, high refractive index nanoparticles have been synthesized and introduced into a resist matrix to increase the overall refractive index. The strategy followed is to synthesize PGMEA-soluble nanoparticles and then disperse them into a 193 nm resist. High index nanoparticles 1-2 nm in diameter were synthesized by a combination of hydrolysis and sol-gel methods. A ligand exchange method was used, allowing the surface of the nanoparticles to be modified with photoresist-friendly moieties to help them disperse uniformly in the resist matrix. The refractive index and ultraviolet absorbance were measured to evaluate the quality of next generation immersion lithography resist materials.

  15. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D., Scott

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  16. Development of high coherence high power 193nm laser

    Science.gov (United States)

    Tanaka, Satoshi; Arakawa, Masaki; Fuchimukai, Atsushi; Sasaki, Yoichi; Onose, Takashi; Kamba, Yasuhiro; Igarashi, Hironori; Qu, Chen; Tamiya, Mitsuru; Oizumi, Hiroaki; Ito, Shinji; Kakizaki, Koji; Xuan, Hongwen; Zhao, Zhigang; Kobayashi, Yohei; Mizoguchi, Hakaru

    2016-03-01

    We have been developing a hybrid 193 nm ArF laser system that consists of a solid state seeding laser and an ArF excimer laser amplifier for power-boosting. The solid state laser consists of an Yb-fiber-solid hybrid laser system and an Er-fiber laser system as fundamentals, and one LBO and three CLBO crystals for frequency conversion. In an ArF power amplifier, the seed laser passes through the ArF gain media three times, and an average power of 110 W is obtained. As a demonstration of the potential applications of the laser, an interference exposure test is performed.

  17. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    International Nuclear Information System (INIS)

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET α-emitter astatine-211 (211At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 (123I), 340-fold for technetium-99m pertechnetate (99mTcO4-) and 60-fold for 211At. Cellular 211At accumulation was found to be dependent on extracellular Na+ ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and 99mTcO4- uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated 211At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and 211At were rapidly (apparent t1/2 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times (123I), 25 times (99mTcO4-) and 10 times (211At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of 123I and 211At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for 123I, 5.2 h for 211At) and preliminary dosimetric calculations indicate high tumour absorbed doses (3.5 Gy/MBqtumour for 131I and 50.3 Gy/MBqtumour for 211At). In

  18. Unveiling the origin of HESS J1809-193

    CERN Document Server

    Castelletti, G; Petriella, A

    2016-01-01

    The main goal of this paper is to provide new insights on the origin of the observable flux of gamma rays from HESS J1809-193 using new high-quality observations in the radio domain. We used the Expanded Very Large Array (now known as the Karl G. Jansky Very large Array, JVLA) to produce a deep full-synthesis imaging at 1.4 GHz of the vicinity of PSR J1809-1917. These data were used in conjunction with 12CO observations from the James Clerk Maxwell Telescope in the transition line J=3-2 and atomic hydrogen data from the Southern Galactic Plane Survey to investigate the properties of the interstellar medium in the direction of the source HESS J1809-193. The new radio continuum image, obtained with a synthesized beam of 8"x4" and a sensitivity of 0.17 mJy/beam, reveals with unprecedented detail all the intensity structures in the field. No radio counterpart to the observed X-ray emission supposed to be a pulsar wind nebula powered by PSR J1809-1917 is seen in the new JVLA image. We discovered a system of molecu...

  19. Site-directed mutagenesis of lysine 193 in Escherichia coli isocitrate lyase by use of unique restriction enzyme site elimination.

    OpenAIRE

    Diehl, P; McFadden, B A

    1993-01-01

    By a newly developed double-stranded mutagenesis technique, histidine (H), glutamate (E), arginine (R) and leucine (L) have been substituted for the lysyl 193 residue (K-193) in isocitrate lyase from Escherichia coli. The substitutions for this residue, which is present in a highly conserved, cationic region, significantly affect both the Km for Ds-isocitrate and the apparent kcat of isocitrate lyase. Specifically, the conservative substitutions, K-193-->H (K193H) and K193R, reduce catalytic ...

  20. Arm Selection Preference of MicroRNA-193a Varies in Breast Cancer

    OpenAIRE

    Kuo-Wang Tsai; Chung-Man Leung; Yi-Hao Lo; Ting-Wen Chen; Wen-Ching Chan; Shou-Yu Yu; Ya-Ting Tu; Hing-Chung Lam; Sung-Chou Li; Luo-Ping Ger; Wen-Shan Liu; Hong-Tai Chang

    2016-01-01

    MicroRNAs (miRNAs) are short noncoding RNAs derived from the 3′ and 5′ ends of the same precursor. However, the biological function and mechanism of miRNA arm expression preference remain unclear in breast cancer. We found significant decreases in the expression levels of miR-193a-5p but no significant differences in those of miR-193a-3p in breast cancer. MiR-193a-3p suppressed breast cancer cell growth and migration and invasion abilities, whereas miR-193a-5p suppressed cell growth but did n...

  1. 193nm Superlens imaging structure for 20nm lithography node.

    Science.gov (United States)

    Shi, Zhong; Kochergin, Vladimir; Wang, Fei

    2009-07-01

    We are showing that a 20nm lithography resolution is theoretically feasible at a 193nm illumination wavelength if employing aluminum (Al) superlens structure with index matching layer. It is illustrated that transmissivity of evanescent waves for certain wavevector bands can be enhanced by an index matching layer. It is further shown a minimal resolution of approximately lambda/10 can be achieved by appropriately engineering mask material and superlens structure. A depth of focus of several nanometers is predicted to be possible for a periodic structure with 20nm half pitch. Assistant features were adopted in superlens structure to successfully suppress the side lobes and resolve a 20nm two-slit structure. PMID:19582044

  2. Study of {sup 193}Os beta{sup -} decay; Estudo do decaimento beta{sup -} do {sup 193}Os

    Energy Technology Data Exchange (ETDEWEB)

    Zahn, Guilherme Soares

    2006-07-01

    In this work, the excited levels of {sup 193}Ir populated by the beta{sup -} decay of {sup 193}Os (T{sub 1/2} {approx} 30h) were investigated. For that purpose, {approx} 5 mg samples of 99%-enriched {sup 192}Os were irradiated under a thermal neutron flux of {approx} 10{sup 12} s{sup -1} and then analysed both using single gamma spectroscopy and a 4-detector multi parametric acquisition facility, which provided data for both a gamma gamma coincidence analysis and a directional angular correlation gamma gamma ({theta} ) study. From these data, 28 transitions were added to this decay scheme, 11 of which were previously known from nuclear reactions and 17 observed for the first time. Eight excited levels were also added to the decay scheme, 3 of which were known from nuclear reaction studies - the remaining 5 are suggested for the first time. Moreover, it was possible to confirm suspicions found in reference that the levels at 848.93 keV and 849.093 keV are indeed the same; it was also possible to confirm the existence of an excited level at 806.9 keV, which had been inferred, but not experimentally confirmed in beta decay studies to date. The angular correlation analysis allowed for the definition of the spin of the excited level at 874 keV as 5/2{sup +;} moreover, the results showed a 79% probability that the spin of the 1078 keV level is 5/2/'-, and also restricted the spin possibilities for the new excited level at 960 keV to two values (1/2 or 3/2). It was also possible to measure the multipolarity mixing ratio ({delta}{sub Ln+1}/L{sub n}) for 43 transitions - 19 of them for the first time and most of the others with a better precision than previously known. Finally, an attempt was made to understand the low-lying levels structure for this nucleus using a theoretical model, which reproduced the ground state and the two lowest-lying excited levels in {sup 193}Ir. (author)

  3. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    Energy Technology Data Exchange (ETDEWEB)

    Petrich, T.; Helmeke, H.-J.; Meyer, G.J.; Knapp, W.H.; Poetter, E. [Department of Nuclear Medicine, Medizinische Hochschule Hannover (Germany)

    2002-07-01

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET {alpha}-emitter astatine-211 ({sup 211}At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 ({sup 123}I), 340-fold for technetium-99m pertechnetate ({sup 99m}TcO{sub 4}{sup -}) and 60-fold for {sup 211}At. Cellular {sup 211}At accumulation was found to be dependent on extracellular Na{sup +} ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and {sup 99m}TcO{sub 4}{sup -} uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated {sup 211}At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and {sup 211}At were rapidly (apparent t{sub 1/2} 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times ({sup 123}I), 25 times ({sup 99m}TcO{sub 4}{sup -}) and 10 times ({sup 211}At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of {sup 123}I and {sup 211}At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for {sup 123}I, 5.2 h for {sup 211}At) and

  4. 9 CFR 381.193 - Poultry carcasses, etc., not intended for human food.

    Science.gov (United States)

    2010-01-01

    ... Food,” or “(name of species) Food” (e.g., “Dog Food” or “Cat Food”). To be considered conspicuous, the... for human food. 381.193 Section 381.193 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE... food. (a) Except as provided in paragraph (b) of this section, poultry carcasses, and parts...

  5. 47 CFR 61.193 - Vacation of suspension order; supplements announcing same; etc.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Vacation of suspension order; supplements announcing same; etc. 61.193 Section 61.193 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED...; supplements announcing same; etc. If the Commission vacates a suspension order, the affected carrier...

  6. MicroRNA-193b enhances tumor progression via down regulation of neurofibromin 1.

    Directory of Open Access Journals (Sweden)

    Michelle Lenarduzzi

    Full Text Available Despite improvements in therapeutic approaches for head and neck squamous cell carcinomas (HNSCC, clinical outcome has remained disappointing, with 5-year overall survival rates hovering around 40-50%, underscoring an urgent need to better understand the biological bases of this disease. We chose to address this challenge by studying the role of micro-RNAs (miRNAs in HNSCC. MiR-193b was identified as an over-expressed miRNA from global miRNA profiling studies previously conducted in our lab, and confirmed in HNSCC cell lines. In vitro knockdown of miR-193b in FaDu cancer cells substantially reduced cell proliferation, migration and invasion, along with suppressed tumour formation in vivo. By integrating in silico prediction algorithms with in vitro experimental mRNA profilings, plus mRNA expression data of clinical specimens, neurofibromin 1 (NF1 was identified to be a target of miR-193b. Concordantly, miR-193b knockdown decreased NF1 transcript and protein levels significantly. Luciferase reporter assays confirmed the direct interaction of miR-193b with NF1. Moreover, p-ERK, a downstream target of NF1 was also suppressed after miR-193b knockdown. FaDu cells treated with a p-ERK inhibitor (U0126 phenocopied the reduced cell proliferation, migration and invasion observed with miR-193b knockdown. Finally, HNSCC patients whose tumours expressed high levels of miR-193b experienced a lower disease-free survival compared to patients with low miR-193b expression. Our findings identified miR-193b as a potentially novel prognostic marker in HNSCC that drives tumour progression via down-regulating NF1, in turn leading to activation of ERK, resulting in proliferation, migration, invasion, and tumour formation.

  7. 41 CFR 102-193.25 - What type of records management business process improvements should my agency strive to achieve?

    Science.gov (United States)

    2010-07-01

    ...-193.25 What type of records management business process improvements should my agency strive to... management business process improvements should my agency strive to achieve? 102-193.25 Section 102-193.25... that needed records can be found rapidly to conduct agency business, to ensure that records...

  8. 76 FR 53481 - Outer Continental Shelf, Alaska OCS Region, Chukchi Sea Planning Area, Oil and Gas Lease Sale 193

    Science.gov (United States)

    2011-08-26

    ..., Chukchi Sea Planning Area, Oil and Gas Lease Sale 193 AGENCY: Bureau of Ocean Energy Management... Continental Shelf (OCS) Oil and Gas Lease Sale 193, Chukchi Sea, Alaska (OCS EIS/EA BOEMRE 2011-041). BOEMRE... Final EIS, Oil and Gas Lease Sale 193, Chukchi Sea Planning Area (OCS EIS/EA MMS 2007-026). BOEMRE...

  9. Lifetime measurements of yrast and excited superdeformed bands in 192,193Hg

    International Nuclear Information System (INIS)

    Quadrupole moments of the six known superdeformed (SD) bands of 193Hg and the yrast SD band of 192Hg have been determined by a Doppler-shift-attenuation-method measurement utilizing the gammasphere array. The quadrupole moments of all 193Hg SD bands were found to be similar, suggesting the active single-particle orbitals in the mass-190 region exhibit only small shape-driving effects. Additionally, there is evidence for an unexpected difference in the quadrupole moments of SD bands in 192Hg and 193Hg. copyright 1998 The American Physical Society

  10. Inline detection of Chrome degradation on binary 193nm photomasks

    Science.gov (United States)

    Dufaye, Félix; Sippel, Astrid; Wylie, Mark; García-Berríos, Edgardo; Crawford, Charles; Hess, Carl; Sartelli, Luca; Pogliani, Carlo; Miyashita, Hiroyuki; Gough, Stuart; Sundermann, Frank; Brochard, Christophe

    2013-09-01

    193nm binary photomasks are still used in the semiconductor industry for the lithography of some critical layers for the nodes 90nm and 65nm, with high volumes and over long periods. However, these 193nm binary photomasks can be impacted by a phenomenon of chrome oxidation leading to critical dimensions uniformity (CDU) degradation with a pronounced radial signature. If not detected early enough, this CDU degradation may cause defectivity issues and lower yield on wafers. Fortunately, a standard cleaning and repellicle service at the mask shop has been demonstrated as efficient to remove the grown materials and get the photomask CD back on target.Some detection methods have been already described in literature, such as wafer CD intrafield monitoring (ACLV), giving reliable results but also consuming additional SEM time with less precision than direct photomask measurement. In this paper, we propose another approach, by monitoring the CDU directly on the photomask, concurrently with defect inspection for regular requalification to production for wafer fabs. For this study, we focused on a Metal layer in a 90nm technology node. Wafers have been exposed with production conditions and then measured by SEM-CD. Afterwards, this photomask has been measured with a SEM-CD in mask shop and also inspected on a KLA-Tencor X5.2 inspection system, with pixels 125 and 90nm, to evaluate the Intensity based Critical Dimension Uniformity (iCDU) option. iCDU was firstly developed to provide feed-forward CDU maps for scanner intrafield corrections, from arrayed dense structures on memory photomasks. Due to layout complexity and differing feature types, CDU monitoring on logic photomasks used to pose unique challenges.The selection of suitable feature types for CDU monitoring on logic photomasks is no longer an issue, since the transmitted intensity map gives all the needed information, as shown in this paper. In this study, the photomask was heavily degraded after more than 18,000 300

  11. Electron, ion and vacuum ultraviolet photon effects in 193 nm photoresist surface roughening

    International Nuclear Information System (INIS)

    Low temperature plasma exposure of methacrylate-based 193 nm photoresist (PR) can result in enhanced surface roughening or smoothing, but mechanisms are poorly understood. We present measurements of 193 nm PR surface roughness following exposure to 1 keV electron beams in various combinations with positive ion and vacuum ultraviolet (VUV) photon irradiation. Electron beams will scission or cross-link 193 nm PR under low and high fluence exposure, respectively. When coupled to simultaneous ion/VUV photon irradiation, low fluence (scissioning) electrons amplify surface roughening while high fluence (cross-linking) electrons reduce surface roughness. These results further suggest that enhanced roughening of 193 nm PR is initiated by the synergistic interaction between an ion bombardment-induced carbon-rich surface layer (∼2 nm) and a sicssioned bulk layer (∼100 nm). (fast track communication)

  12. Arm Selection Preference of MicroRNA-193a Varies in Breast Cancer

    Science.gov (United States)

    Tsai, Kuo-Wang; Leung, Chung-Man; Lo, Yi-Hao; Chen, Ting-Wen; Chan, Wen-Ching; Yu, Shou-Yu; Tu, Ya-Ting; Lam, Hing-Chung; Li, Sung-Chou; Ger, Luo-Ping; Liu, Wen-Shan; Chang, Hong-Tai

    2016-01-01

    MicroRNAs (miRNAs) are short noncoding RNAs derived from the 3′ and 5′ ends of the same precursor. However, the biological function and mechanism of miRNA arm expression preference remain unclear in breast cancer. We found significant decreases in the expression levels of miR-193a-5p but no significant differences in those of miR-193a-3p in breast cancer. MiR-193a-3p suppressed breast cancer cell growth and migration and invasion abilities, whereas miR-193a-5p suppressed cell growth but did not influence cell motility. Furthermore, NLN and CCND1, PLAU, and SEPN1 were directly targeted by miR-193a-5p and miR-193a-3p, respectively, in breast cancer cells. The endogenous levels of miR-193a-5p and miR-193a-3p were significantly increased by transfecting breast cancer cells with the 3′UTR of their direct targets. Comprehensive analysis of The Cancer Genome Atlas database revealed significant differences in the arm expression preferences of several miRNAs between breast cancer and adjacent normal tissues. Our results collectively indicate that the arm expression preference phenomenon may be attributable to the target gene amount during breast cancer progression. The miRNA arm expression preference may be a means of modulating miRNA function, further complicating the mRNA regulatory network. Our findings provide a new insight into miRNA regulation and an application for breast cancer therapy. PMID:27307030

  13. miR-193a-3p is a potential tumor suppressor in malignant pleural mesothelioma.

    Science.gov (United States)

    Williams, Marissa; Kirschner, Michaela B; Cheng, Yuen Yee; Hanh, Jacky; Weiss, Jocelyn; Mugridge, Nancy; Wright, Casey M; Linton, Anthony; Kao, Steven C; Edelman, J James B; Vallely, Michael P; McCaughan, Brian C; Cooper, Wendy; Klebe, Sonja; Lin, Ruby C Y; Brahmbhatt, Himanshu; MacDiarmid, Jennifer; van Zandwijk, Nico; Reid, Glen

    2015-09-15

    Malignant pleural mesothelioma (MPM) is an asbestos-induced cancer with poor prognosis that displays characteristic alterations in microRNA expression. Recently it was reported that the expression of a subset of microRNAs can distinguish between MPM and adenocarcinoma of the lung. However, the functional importance of these changes has yet to be investigated. We compared expression of miR-192, miR-193a-3p and the miR-200 family in normal pleura and MPM tumor specimens and found a statistically significant reduction in the levels of miR-193a-3p (3.1-fold) and miR-192 (2.8-fold) in MPM. Transfection of MPM cells with a miR-193a-3p mimic resulted in inhibition of growth and an induction of apoptosis and necrosis in vitro. The growth inhibitory effects of miR-193a-3p were associated with a decrease in MCL1 expression and were recapitulated by RNAi-mediated MCL1 silencing. Targeted delivery of miR-193a-3p mimic using EDV minicells inhibited MPM xenograft tumour growth, and was associated with increased apoptosis. In conclusion, miR-193a-3p appears to have importance in the biology of MPM and may represent a target for therapeutic intervention. PMID:26125439

  14. Technological characterization and survival of the exopolysaccharide-producing strain Lactobacillus delbrueckii subsp. lactis 193 and its bile-resistant derivative 193+ in simulated gastric and intestinal juices.

    Science.gov (United States)

    Burns, Patricia; Vinderola, Gabriel; Reinheimer, Jorge; Cuesta, Isabel; de Los Reyes-Gavilán, Clara G; Ruas-Madiedo, Patricia

    2011-08-01

    The capacity of lactic acid bacteria to produce exopolysaccharides (EPS) conferring microorganisms a ropy phenotype could be an interesting feature from a technological point of view. Progressive adaptation to bile salts might render some lactobacilli able to overcome physiological gut barriers but could also modify functional properties of the strain, including the production of EPS. In this work some technological properties and the survival ability in simulated gastrointestinal conditions of Lactobacillus delbrueckii subsp. lactis 193, and Lb. delbrueckii subsp. lactis 193+, a strain with stable bile-resistant phenotype derived thereof, were characterized in milk in order to know whether the acquisition of resistance to bile could modify some characteristics of the microorganism. Both strains were able to grow and acidify milk similarly; however the production of ethanol increased at the expense of the aroma compound acetaldehyde in milk fermented by the strain 193+, with respect to milk fermented by the strain 193. Both microorganisms produced a heteropolysaccharide composed of glucose and galactose, and were able to increase the viscosity of fermented milks. In spite of the higher production yield of EPS by the bile-resistant strain 193+, it displayed a lower ability to increase viscosity than Lb. delbrueckii subsp. lactis 193. Milk increased survival in simulated gastric juice; the presence of bile improved adhesion to the intestinal cell line HT29-MTX in both strains. However, the acquisition of a stable resistance phenotype did not improve survival in simulated gastric and intestinal conditions or the adhesion to the intestinal cell line HT29-MTX. Thus, Lb. delbrueckii subsp. lactis 193 presents suitable technological properties for the manufacture of fermented dairy products; the acquisition of a stable bile-resistant phenotype modified some properties of the microorganism. This suggests that the possible use of bile-resistant derivative strains should be

  15. Durable donor engraftment after radioimmunotherapy using α-emitter astatine-211-labeled anti-CD45 antibody for conditioning in allogeneic hematopoietic cell transplantation.

    Science.gov (United States)

    Chen, Yun; Kornblit, Brian; Hamlin, Donald K; Sale, George E; Santos, Erlinda B; Wilbur, D Scott; Storer, Barry E; Storb, Rainer; Sandmaier, Brenda M

    2012-02-01

    To reduce toxicity associated with external γ-beam radiation, we investigated radioimmunotherapy with an anti-CD45 mAb labeled with the α-emitter, astatine-211 ((211)At), as a conditioning regimen in dog leukocyte antigen-identical hematopoietic cell transplantation (HCT). Dose-finding studies in 6 dogs treated with 100 to 618 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) without HCT rescue demonstrated dose-dependent myelosuppression with subsequent autologous recovery, and transient liver toxicity in dogs treated with (211)At doses less than or equal to 405 μCi/kg. Higher doses of (211)At induced clinical liver failure. Subsequently, 8 dogs were conditioned with 155 to 625 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) before HCT with dog leukocyte antigen-identical bone marrow followed by a short course of cyclosporine and mycophenolate mofetil immunosuppression. Neutropenia (1-146 cells/μL), lymphopenia (0-270 cells/μL), and thrombocytopenia (1500-6560 platelets/μL) with prompt recovery was observed. Seven dogs had long-term donor mononuclear cell chimerism (19%-58%), whereas 1 dog treated with the lowest (211)At dose (155 μCi/kg) had low donor mononuclear cell chimerism (5%). At the end of follow-up (18-53 weeks), only transient liver toxicity and no renal toxicity had been observed. In conclusion, conditioning with (211)At-labeled anti-CD45 mAb is safe and efficacious and provides a platform for future clinical trials of nonmyeloablative transplantation with radioimmunotherapy-based conditioning. PMID:22134165

  16. The structure of 193Au within the Interacting Boson Fermion Model

    International Nuclear Information System (INIS)

    A γγ angular correlation experiment investigating the nucleus 193Au is presented. In this work the level scheme of 193Au is extended by new level information on spins, multipolarities and newly observed states. The new results are compared with theoretical predictions from a general Interacting Boson Fermion Model (IBFM) calculation for the positive-parity states. The experimental data is in good agreement with an IBFM calculation using all proton orbitals between the shell closures at Z=50 and Z=126. As a dominant contribution of the d3/2 orbital to the wave function of the lowest excited states is observed, a truncated model of the IBFM using a Bose–Fermi symmetry is applied to the describe 193Au. Using the parameters of a fit performed for 193Au, the level scheme of 192Pt, the supersymmetric partner of 193Au, is predicted but shows a too small boson seniority splitting. We obtained a common fit by including states observed in 192Pt. With the new parameters a supersymmetric description of both nuclei is established

  17. Ultraviolet (193, 216 and 254 nm) photoinactivation of Escherichia coli strains with different repair deficiencies

    International Nuclear Information System (INIS)

    Escherichia coli K12 bacteria strains AB1157 (repair-deficient wild-type, uvrA+ recA+), AB1886 (uvrA-), AB2463 (recA-) and AB2480 (uvrA- recA-) were exposed to 254 nm germicidal UV and 216 or 193 nm laser radiation. The mean lethal incident dose (D37) for AB1157 does not change significantly with wavelength, whereas it increases for the other strains on going from λirr = 254 to 193 nm, e.g., eightfold for AB2480. Quantum yields for inactivation, due to light absorbed by the chromosomal DNA, have been estimated from the D37 values. The large differences in D37 between uvrA+ and uvrA- strains indicate a significant contribution of pyrimidine dimers and (6-4) photoproducts to photodamage of DNA in the cells. The formation of dimers even with λirr = 193 nm is supported by the result that the photoreactivable sector is larger than 63%. Inactivation of E. coli upon irradiation at 193 and 216 nm is therefore due to damage to intracellular DNA rather than to membrane or protein damage as is the case for mammalian cells. The ratio of the lethal doses for AB1157 vs AB2480 is ∼900 with λirr = 254 nm, but only 160 with λirr = 193 nm. We propose that this is due to the better repair of photodimers and (6-4) photoproducts than of damage induced by photoionization via upper excited states. Irradiation at 193 nm inactivates AB1157 mainly by damage due to photoionization and AB2480 by damage due to photodimers in the chromosomal DNA. 51 refs., 3 figs., 5 tabs

  18. Ultraviolet (193, 216 and 254 nm) photoinactivation of Escherichia coli strains with different repair deficiencies

    Energy Technology Data Exchange (ETDEWEB)

    Gurzadyan, G.G.; Goerner, H.; Schulte-Frohlinde, D. [Max-Planck-Institut fuer Strahlenchemie, Muelheim an der Ruhr (Germany)

    1995-03-01

    Escherichia coli K12 bacteria strains AB1157 (repair-deficient wild-type, uvrA{sup +} recA{sup +}), AB1886 (uvrA{sup {minus}}), AB2463 (recA{sup {minus}}) and AB2480 (uvrA{sup {minus}} recA{sup {minus}}) were exposed to 254 nm germicidal UV and 216 or 193 nm laser radiation. The mean lethal incident dose (D{sub 37}) for AB1157 does not change significantly with wavelength, whereas it increases for the other strains on going from {lambda}{sub irr} = 254 to 193 nm, e.g., eightfold for AB2480. Quantum yields for inactivation, due to light absorbed by the chromosomal DNA, have been estimated from the D{sub 37} values. The large differences in D{sub 37} between uvrA{sup +} and uvrA{sup {minus}} strains indicate a significant contribution of pyrimidine dimers and (6-4) photoproducts to photodamage of DNA in the cells. The formation of dimers even with {lambda}{sub irr} = 193 nm is supported by the result that the photoreactivable sector is larger than 63%. Inactivation of E. coli upon irradiation at 193 and 216 nm is therefore due to damage to intracellular DNA rather than to membrane or protein damage as is the case for mammalian cells. The ratio of the lethal doses for AB1157 vs AB2480 is {approx}900 with {lambda}{sub irr} = 254 nm, but only 160 with {lambda}{sub irr} = 193 nm. We propose that this is due to the better repair of photodimers and (6-4) photoproducts than of damage induced by photoionization via upper excited states. Irradiation at 193 nm inactivates AB1157 mainly by damage due to photoionization and AB2480 by damage due to photodimers in the chromosomal DNA. 51 refs., 3 figs., 5 tabs.

  19. Continuous-wave 193.4 nm laser with 120 mW output power.

    Science.gov (United States)

    Sakuma, Jun; Kaneda, Yushi; Oka, Naoya; Ishida, Takayuki; Moriizumi, Koichi; Kusunose, Haruhiko; Furukawa, Yasunori

    2015-12-01

    This Letter describes an all-solid-state continuous-wave, deep-ultraviolet coherent source that generates more than 100 mW of output power at 193.4 nm. The source is based on nonlinear frequency conversion of three single-frequency infrared fiber laser master-oscillator power-amplifier (MOPA) light sources. PMID:26625058

  20. 34 CFR 403.193 - What are the information requirements regarding special populations?

    Science.gov (United States)

    2010-07-01

    ... TECHNOLOGY EDUCATION PROGRAM What Conditions Must be Met by Local Recipients? § 403.193 What are the... 34 Education 3 2010-07-01 2010-07-01 false What are the information requirements regarding special... their parents information concerning— (i) The opportunities available in vocational education; (ii)...

  1. Evidence for octupole softness of the superdeformed shape from band interactions in 193,4Hg

    International Nuclear Information System (INIS)

    Three superdeformed (SD) bands have been observed in 194Hg and four (or five?) SD bands in 193Hg using the 150Nd+48Ca reaction. All bands except for two in 193Hg show a steady increase in dynamical moment of inertia J(2) with rotational frequency. The two exceptional bands form a classical pair of strongly interacting bands. It is suggested that the strong interaction between the bands is caused by a softness to octupole deformation. Evidence is found for the existence of dipole transitions connecting bands of opposite signature in 193Hg. The strengths of these transitions suggest that they are probably E1 supporting the importance of the role of octupole vibrations. These data suggest the wider importance of octupole softness in enhancing E1 transitions in the SD feeding and decay mechanisms. The spectroscopy of the observed SD bands in 193,4Hg are discussed in detail and attention is drawn to the 'identical' energies of γ-rays in these isotopes with those in lighter isotopes. The similarities in bands relate to the neutron sub-shell closure for SD nuclei at N=112. (orig.)

  2. 26 CFR 1.193-1 - Deduction for tertiary injectant expenses.

    Science.gov (United States)

    2010-04-01

    ... of section 193 and this section, the term hydrocarbon means all forms of natural gas and crude oil... oil. The fair market value of the crude oil used in the injectant is $27x. B is unable to demonstrate... reduced by the lesser of: (i) The fair market value of the hydrocarbon component in the form in which...

  3. First measurement of magnetic properties in a superdeformed nucleus: [sup 193]Hg

    Energy Technology Data Exchange (ETDEWEB)

    Joyce, M.J.; Sharpey-Schafer, J.F.; Twin, P.J.; Beausang, C.W.; Cullen, D.M.; Riley, M.A.; Clark, R.M.; Dagnall, P.J.; Deloncle, I.; Duprat, J.; Fallon, P.; Forsyth, P.D.; Fotiades, N.; Gale, S.J.; Gall, B.; Hannachi, F.; Harissopulos, S.; Hauschild, K.; Jones, P.M.; Kalfas, C.A.; Korichi, A.; Le Coz, Y.; Meyer, M.; Paul, E.S.; Porquet, M.G.; Redon, N.; Schuck, C.; Simpson, J.; Vlastou, R.; Wadsworth, R. (Oliver Lodge Laboratory, University of Liverpool, Liverpool L69 3BX (United Kingdom) Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831 (United States) Department of Physics, Florida State University, Tallahassee, Florida 32306 (United States) Department of Physics, University of York, Heslington, York YO1 5DD (United Kingdom) Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse, IN2P3-CNRS, 91405 Orsay CEDEX (France) Institut de Physique Nucleaire, 91406 Orsay CEDEX (France) Lawrence Berkeley Laboratory, 1 Cyclotron Road, Berkeley, California 94720 (United States) N

    1993-10-04

    Dipole transitions linking signature partner superdeformed bands in [sup 193]Hg have been observed. Measurements of the photon decay branching ratios, taken together with the average superdeformed quadrupole moment measured in neighboring nuclei, enable the absolute [ital M]1 strengths to be determined. From these data, using the strong coupling model, we find ([ital g][sub [ital K

  4. Alpha particle angular distribution of oriented 189,191,193Bi

    International Nuclear Information System (INIS)

    Angular distribution data for α particles emitted in the enhanced decay of on-line oriented neutron deficient isotopes 189,191,193Bi near mid-shell (N=104) are presented. They give additional support for the recent finding that anisotropic α emission in enhanced decays from near-spherical nuclei is mainly determined by nuclear structure effects. (authors)

  5. 14 CFR 121.193 - Airplanes: Turbine engine powered: En route limitations: Two engines inoperative.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplanes: Turbine engine powered: En route... Performance Operating Limitations § 121.193 Airplanes: Turbine engine powered: En route limitations: Two...). No person may operate a turbine engine powered airplane along an intended route unless he...

  6. 36 CFR 223.193 - Procedures for reporting acquisition and disposition of unprocessed Federal timber.

    Science.gov (United States)

    2010-07-01

    ... Regulations at 13 CFR part 121; and (ix) A certificate stating that the certifier has read and understands the... Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER The Forest Resources Conservation and Shortage Relief Act of 1990 Program § 223.193 Procedures for...

  7. Study of barrier coats for application in immersion 193-nm lithography

    Science.gov (United States)

    Houlihan, Francis; Kim, Wookyu; Sakamuri, Raj; Hamilton, Keino; Dimerli, Alla; Abdallah, David; Romano, Andrew; Dammel, Ralph R.; Pawlowski, Georg; Raub, Alex; Brueck, Steve

    2005-05-01

    We will describe our barrier coat approach for use in immersion 193 nm lithography. These barrier coats may act as either simple barriers providing protection against loss of resist components into water or in the case of one type of these formulations which have a refractive index at 193 nm which is the geometric mean between that of the resist and water provide, also top antireflective properties. Either type of barrier coat can be applied with a simple spinning process compatible with PGMEA based resin employing standard solvents such as alcohols and be removed during the usual resist development process with aqueous 0.26 N TMAH. We will discuss both imaging results with these materials on acrylate type 193 nm resists and also show some fundamental studies we have done to understand the function of the barrier coat and the role of differing spinning solvents and resins. We will show LS (55 nm) and Contact Hole (80 nm) resolved with a 193 nm resist exposed with the interferometric tool at the University of New Mexico (213 nm) with and without the use of a barrier coat.

  8. O(P-3(J)) alignment from the photodissociation of SO2 at 193 nm

    NARCIS (Netherlands)

    Brouard, M.; Cireasa, D.R.; Clark, A.P.; Preston, T.J.; Vallance, C.; Groenenboom, G.C.; Vasyutinskii, O.S.

    2004-01-01

    The 193-nm photodissociation Of SO2 has been studied using the resonantly enhanced multiphoton ionization of ground-state O(P-3(J)), coupled with velocity-map ion imaging. The dependence of the ion images on the linear polarization of pump and probe radiation has been used to determine the electroni

  9. Reactive arthritis following an outbreak of Salmonella typhimurium phage type 193 infection

    OpenAIRE

    Hannu, T; Mattila, L; Siitonen, A.; Leirisalo-Repo, M

    2002-01-01

    Methods: An outbreak of S typhimurium phage type DT 193 occurred in several municipalities in Finland in 1999. A questionnaire which had a specific emphasis on musculoskeletal symptoms was mailed to all 78 subjects with a positive stool culture. Based on the answers, all subjects with recent joint complaints were clinically examined or interviewed by telephone.

  10. 49 CFR 173.193 - Bromoacetone, methyl bromide, chloropicrin and methyl bromide or methyl chloride mixtures, etc.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Bromoacetone, methyl bromide, chloropicrin and methyl bromide or methyl chloride mixtures, etc. 173.193 Section 173.193 Transportation Other Regulations... bromide, chloropicrin and methyl bromide or methyl chloride mixtures, etc. (a) Bromoacetone must...

  11. MicroRNA-193b modulates proliferation, migration, and invasion of non-small cell lung cancer cells

    Institute of Scientific and Technical Information of China (English)

    Huajun Hu; Shangao Li; Jun Liu; Bin Ni

    2012-01-01

    MicroRNAs have been reported to be closely related to the development of human lung cancers.However,the functions of microRNAs in non-small cell lung cancer (NSCLC) remain largely undefined.Here,we investigated the role of microRNA-193b (miR-193b) in NSCLC.Our data showed that miR-193b was markedly down-regulated in NSCLC cancer tissues compared with adjacent normal tissues.The NSCLC cell line (A549) transfected with the miR-193b exhibited significantly decreased proliferation,migration,and invasion capacities when compared with the control cells.In contrast,inhibition of miR-193bincreased the proliferation,migration,and invasion of A549 cells.Moreover,miR-193b repressed the expressions of cyclin D1 and urokinase-type plasminogen activator in A549 cells.These data suggest that miR-193b is a tumor suppressor in NSCLC.

  12. Mutagenic potential of a 193-nm excimer laser on fibroblasts in tissue culture

    International Nuclear Information System (INIS)

    In response to concerns regarding possible DNA damage by far ultraviolet radiation during excimer laser corneal surgery, the mutagenic potential of an argon fluoride excimer laser (193 nm) on BALB/3T3 mouse fibroblasts grown in tissue culture was investigated. The cumulative incidence of anaplastic transformation after subablative radiant exposures from 3.5 mJ/cm2/pulse to 13.4 mJ/cm2/pulse was 3.6% of all cell cultures. The incidence of anaplastic transformation in nonirradiated controls was 4.2%. Transformation after exposure to x-ray radiation (60.9 rad) was 98.8%. The difference between the incidence of transformation of nonirradiated controls or excimer-treated cultures compared with x-ray radiation-treated cells was significant P less than 0.0001 (chi square test). In this standard cell line, 193-nm laser energy does not appear to have substantial mutagenic potential

  13. Highly excited {delta}3 I=1 structures in {sup 193}Hg

    Energy Technology Data Exchange (ETDEWEB)

    Fotiades, N.; Harissopulos, S.; Kalfas, C.A.; Kossionides, S.; Papadopoulos, C.T.; Vlastou, R.; Serris, M.; Meyer, M.; Redon, N.; Duffait, R.; Le Coz, Y.; Ducroux, L.; Hannachi, F.; Deloncle, I.; Gall, B.; Porquet, M.G.; Schuck, C.; Azaiez, F.; Duprat, J.; Korichi, A.; Sharpey-Schafer, J.F.; Joyce, M.J.; Beausang, C.W.; Dagnall, P.J.; Forsyth, P.D.; Gale, S.J.; Jones, P.M.; Paul, E.S.; Simpson, J.; Clark, R.M.; Hauschild, K.; Wadsworth, R. [Inst. of Nucl. Phys., NCSR Demokritos, Athens (Greece)

    1995-07-01

    Highly excited states in the nucleus {sup 193}Hg have been investigated by in-beam {gamma}-ray spectroscopic techniques using the EUROGAM array. The reaction {sup 150}Nd({sup 48}Ca,5n) at a beam energy of 213 MeV was used to populate states of {sup 193}Hg. The level scheme has been considerably extended (up to 10.7 MeV) and enriched from earlier studies. Two new structures of competing dipole and quadrupole transitions were observed. Experimental B(M1)/B(E2) ratios were determined for the two structures and compared with theoretical estimates. They were also compared with similar structures in the neighbouring Hg and Pb nuclei. (author)

  14. IBM-JSR 193-nm negative tone resist: polymer design, material properties, and lithographic performance

    Science.gov (United States)

    Patel, Kaushal S.; Lawson, Margaret C.; Varanasi, Pushkara Rao; Medeiros, David R.; Wallraff, Gregory M.; Brock, Phillip J.; DiPietro, Richard A.; Nishimura, Yukio; Chiba, Takashi; Slezak, Mark

    2004-05-01

    It has been previously proposed that negative-tone resist process would have an intrinsic advantage for printing narrow trench geometry. To demonstrate this for 193nm lithography, a negative resist with performance comparable to a leading positive resist is required. In this paper we report the joint development of a hexafluoroalcohol containing, 193nm, negative-tone, chemically amplified resist based on the crosslinking approach. Lithographic performance is presented which includes the ability of the negative-tone resist to print 90nm line/space and isolated trenches with standard resist processing. The impact of the fluorinated polymer on etch performance is also quantified. Finally, key resist characteristics and their influence on performance and limiting factors such as microbridging are discussed.

  15. 450mm etch process development and process chamber evaluation using 193i DSA guided pattern

    Science.gov (United States)

    Collison, Wenli; Lin, Yii-Cheng; Dunn, Shannon; Takikawa, Hiroaki; Paris, James; Chen, Lucy; Detrick, Troy; Belen, Jun; Stojakovic, George; Goss, Michael; Fish, Norman; Park, Minjoon; Sun, Chih-Ming; Kelling, Mark; Lin, Pinyen

    2016-03-01

    In the Global 450mm Equipment Development Consortium (G450C), a 193i guided directed self-assembly (DSA) pattern has been used to create structures at the 14nm node and below. The first guided DSA patterned wafer was ready for etch process development within a month of the G450C's first 193i patterned wafer availability with one litho pass. Etch processes were scaled up from 300mm to 450mm for a 28nm pitch STI stack and a 40nm pitch M1 BEOL stack. The effects of various process parameters were investigated to fine tune each process. Overall process window has been checked and compared. Excellent process stability results were shown for current etch chambers.

  16. Temperature- and pressure-dependent absorption coefficients for CO2 and O2 at 193 nm

    Science.gov (United States)

    Hartinger, K. T.; Nord, S.; Monkhouse, P. B.

    Absorption of laser radiation at 193 nm by CO2 and O2 was studied at a series of different temperatures up to 1273 K and pressures up to 1 bar. The spectrum for CO2 was found to be broadband, so that absorption could be fitted to a Beer-Lambert law. On the other hand, the corresponding O2 spectrum is strongly structured and parameterisation requires a more complex relation, depending on both temperature and the product (pressure × absorption path length). In this context, the influence of spectral structure on the resulting spectrally integrated absorption coefficients is discussed. Using the fitting parameters obtained, effective transmissions at 193 nm can be calculated for a wide range of experimental conditions. As an illustration of the practical application of these data, the calculation of effective transmission for a typical industrial flue gas is described.

  17. Study of the inner Bremsstrahlung following the electron-capture decay of 193 Pt

    International Nuclear Information System (INIS)

    We are measuring the inner Bremsstrahlung (I B) photons emitted in some of the electron-capture decays of 193 Pt. The source was prepared with highly pure metal Pt. It was irradiated with neutron for 52 days and let to cool down for eight months. The remaining activities were due to 193 Ptg (half-life 50 yr) and 192 Ir (half-life 74 d), the latter coming from (n, γ) reactions on a small content of Ir. We have used a radiochemistry method to reduce the Ir content of the source. The resulting Pt compound will be dissolved in a plastic scintillator disk. Most of the 192 Ir decays are β- and their signal in the plastic will be used as a veto for the I B-photon detector. We have performed simulations of the efficiency and absorption effects in the detection geometry. (author)

  18. Rearrangement of a phosphosilicate glass network induced by the 193-nm radiation

    International Nuclear Information System (INIS)

    The IR absorption and Raman spectra of phosphosilicate glass (PSG) are measured during its exposure to radiation at a wavelength of 193 nm. The obtained data demonstrate the complicated rearrangement dynamics of the glass network around phosphor atoms and of the glass network as a whole. The experimental dependences are explained by the model of the PSG network based on the concepts of the theory of rigidity percolation. (interaction of laser radiation with matter)

  19. Topoisomerase II–DNA complexes trapped by ICRF-193 perturb chromatin structure

    OpenAIRE

    Germe, Thomas; Hyrien, Olivier

    2005-01-01

    DNA topoisomerase II (topo II) is involved in unlinking replicating DNA and organizing mitotic chromosomes. Topo II is the target of many antitumour drugs. Topo II inhibition results in extensive catenation of newly replicated DNA and may potentially perturb chromatin assembly. Here, we show that the topo II inhibitor ICRF-193 does not prevent the bulk of nucleosome deposition, but perturbs nucleosome spacing in Xenopus egg extracts. This is due to the trapping of topo II-closed clamps on the...

  20. Anisotropy results from 193 GeV U+U collisions at RHIC

    CERN Document Server

    ,

    2014-01-01

    We report the measurement of azimuthal anisotropy $v_{n}$ for n = 1-5 as a function of transverse momentum $p_{T}$ and centrality in U+U collisions at $\\sqrt{s_{NN}}$ = 193 GeV, recorded with the STAR detector at RHIC. We also present results on $v_{2}$ and azimuthal correlator related to charge separation across the reaction plane due to local parity violation(LPV) in the ultra-central collisions.

  1. Photodissociation dynamics of 2-nitropropane and 2-methyl-2-nitropropane at 248 and 193 nm.

    Science.gov (United States)

    Sengupta, Sumana; Indulkar, Yogesh; Kumar, Awadhesh; Dhanya, Suresh; Naik, Prakash Dattatray; Bajaj, Parma Nand

    2008-12-11

    Dynamics of formation of electronically excited NO2 and formation of OH fragment, during photo dissociation of 2-nitropropane (NP) and 2-methyl-2-nitropropane (MNP), were investigated at 193 and 248 nm. The radiative lifetime of the electronically excited NO2 fragment, observed at 193 nm, was measured to be 1.2 ( 0.1 micros and the rate coefficient of quenching of its emission by MNP was measured as (2.7 ( 0.1) x 10(-10) molecule(-1) cm3 s(-1). Formation of the ground electronic state of OH was confirmed in both molecules. State selective laser induced fluorescence technique was used to detect the nascent OH (X 2Pi, v'', J'') fragments in different ro-vibrational states, and to obtain information on energy partitioning. Though MNP and NP differ in the types of the available H atoms, the dynamics of OH formation is found to be the same in both. The relative population in different rotational states does not follow Boltzmann equilibrium distribution in both the molecules at 193 and 248 nm. The translational energies of the OH fragments, calculated from the Doppler width, are 21.2 ( 7.2 and 25.0 ( 2.5 kcal mol-1 for NP at 248 and 193 nm, respectively. The translational energies of the OH fragments, in the case of MNP, are found to be lower, 17.5 ( 4.1 and 22.0 ( 3.2 kcal mol-1,respectively, at 248 nm 193 nm. These results are compared with the earlier reports on photodissociation of nitromethane (NM), nitroethane (NE), and other nitroalkanes. All possible dissociation pathways of these molecules--NM, NE, NP, and MNPs leading to the formation of the OH fragment were investigated computationally, with geometry optimization at the B3LYP/6-311+G(d,p) level and energy calculation at the MP4(SDQ)/6-311+G (d,p) level. The results suggest that in NM, OH is formed after isomerization to CH2N(OH)O, whereas in all other cases OH is formed from HONO, a primary product of molecular elimination of nitroalkanes, formed with sufficient internal energy. PMID:19053556

  2. Advances in hardware, software, and automation for 193nm aerial image measurement systems

    Science.gov (United States)

    Zibold, Axel M.; Schmid, R.; Seyfarth, A.; Waechter, M.; Harnisch, W.; Doornmalen, H. v.

    2005-05-01

    A new, second generation AIMS fab 193 system has been developed which is capable of emulating lithographic imaging of any type of reticles such as binary and phase shift masks (PSM) including resolution enhancement technologies (RET) such as optical proximity correction (OPC) or scatter bars. The system emulates the imaging process by adjustment of the lithography equivalent illumination and imaging conditions of 193nm wafer steppers including circular, annular, dipole and quadrupole type illumination modes. The AIMS fab 193 allows a rapid prediction of wafer printability of critical mask features, including dense patterns and contacts, defects or repairs by acquiring through-focus image stacks by means of a CCD camera followed by quantitative image analysis. Moreover the technology can be readily applied to directly determine the process window of a given mask under stepper imaging conditions. Since data acquisition is performed electronically, AIMS in many applications replaces the need for costly and time consuming wafer prints using a wafer stepper/ scanner followed by CD SEM resist or wafer analysis. The AIMS fab 193 second generation system is designed for 193nm lithography mask printing predictability down to the 65nm node. In addition to hardware improvements a new modular AIMS software is introduced allowing for a fully automated operation mode. Multiple pre-defined points can be visited and through-focus AIMS measurements can be executed automatically in a recipe based mode. To increase the effectiveness of the automated operation mode, the throughput of the system to locate the area of interest, and to acquire the through-focus images is increased by almost a factor of two in comparison with the first generation AIMS systems. In addition a new software plug-in concept is realised for the tools. One new feature has been successfully introduced as "Global CD Map", enabling automated investigation of global mask quality based on the local determination of

  3. miR-193a-3p regulation of chemoradiation resistance in oesophageal cancer cells via the PSEN1 gene.

    Science.gov (United States)

    Meng, Fang; Qian, Liting; Lv, Lei; Ding, Bojin; Zhou, Gieping; Cheng, Xu; Niu, Sanqiang; Liang, Yu

    2016-04-01

    Chemoradiation therapy is an important component of the curative treatment for oesophageal carcinomas. These therapeutic effects are prevented in patients according to radioresistance and multi-drug resistance, and the cause of such resistance remains unclear. In this study, we identified the role of miR-193a-3p in modulating the radioresistance and chemoresistance of oesophageal cancer cells. We found that KYSE150 and KYSE410 cells could be characterized as relatively radiation-sensitive and radiation-resistant cells, respectively. Similarly, KYSE150 and KYSE410 cells were found to be chemosensitive and chemoresistant, respectively. Over-expression of miR-193a-3p increased the radioresistance and chemoresistance of oesophageal squamous cell carcinoma (ESCC) cells. In contrast, the down-regulation of miR-193a-3p decreased the radioresistance and chemoresistance of ESCC cells. In addition, miR-193a-3p inducing DNA damage has also been demonstrated through measuring the level of gamma-H2AX associated with miR-193a-3p. Moreover, a small interfering RNA(siRNA)-induced repression of the PSEN1 gene had an effect similar to that of miR-193a-3p up-regulation. The above processes also inhibited oesophageal cancer cells apoptosis. These findings suggest that miR-193a-3p contributes to the radiation and chemotherapy resistance of oesophageal carcinoma by down-regulating PSEN1. Thus, miR-193a-3p and PSEN1 might be potential biomarkers for chemoradiation resistant cancers. PMID:26743123

  4. miR-193b Modulates Resistance to Doxorubicin in Human Breast Cancer Cells by Downregulating MCL-1

    Directory of Open Access Journals (Sweden)

    Jingpei Long

    2015-01-01

    Full Text Available MicroRNAs (miRNAs family, which is involved in cancer development, proliferation, apoptosis, and drug resistance, is a group of noncoding RNAs that modulate the expression of oncogenes and antioncogenes. Doxorubicin is an active cytotoxic agent for breast cancer treatment, but the acquisition of doxorubicin resistance is a common and critical limitation to cancer therapy. The aim of this study was to investigate whether miR-193b mediated the resistance of breast cancer cells to doxorubicin by targeting myeloid cell leukemia-1 (MCL-1. In this study, we found that miR-193b levels were significantly lower in doxorubicin-resistant MCF-7 (MCF-7/DOXR cells than in the parental MCF-7 cells. We observed that exogenous miR-193b significantly suppressed the ability of MCF-7/DOXR cells to resist doxorubicin. It demonstrated that miR-193b directly targeted MCL-1 3′-UTR (3′-Untranslated Regions. Further studies indicated that miR-193b sensitized MCF-7/DOXR cells to doxorubicin through a mechanism involving the downregulation of MCL-1. Together, our findings provide evidence that the modulation of miR-193b may represent a novel therapeutic target for the treatment of breast cancer.

  5. Cell cycle-dependent DNA damage signaling induced by ICRF-193 involves ATM, ATR, CHK2, and BRCA1

    International Nuclear Information System (INIS)

    Topoisomerase II is essential for cell proliferation and survival and has been a target of various anticancer drugs. ICRF-193 has long been used as a catalytic inhibitor to study the function of topoisomerase II. Here, we show that ICRF-193 treatment induces DNA damage signaling. Treatment with ICRF-193 induced G2 arrest and DNA damage signaling involving γ-H2AX foci formation and CHK2 phosphorylation. DNA damage by ICRF-193 was further demonstrated by formation of the nuclear foci of 53BP1, NBS1, BRCA1, MDC1, and FANCD2 and increased comet tail moment. The DNA damage signaling induced by ICRF-193 was mediated by ATM and ATR and was restricted to cells in specific cell cycle stages such as S, G2, and mitosis including late and early G1 phases. Downstream signaling of ATM and ATR involved the phosphorylation of CHK2 and BRCA1. Altogether, our results demonstrate that ICRF-193 induces DNA damage signaling in a cell cycle-dependent manner and suggest that topoisomerase II might be essential for the progression of the cell cycle at several stages including DNA decondensation

  6. Defects of a phosphosilicate glass exposed to the 193-nm radiation

    International Nuclear Information System (INIS)

    Induced absorption is measured in a hydrogen-unloaded phosphosilicate glass (PSG) in spectral ranges from 140 to 850 nm and from 1000 to 1700 nm before and after its exposure to the 193-nm radiation. It is shown that the induced-absorption bands in the range between 140 and 300 nm do not coincide with the bands observed earlier after exposing a PSG to X-rays. It is assumed that the photorefractive effect in the PSG is related to variations induced in the glass network rather than to defects responsible for the induced-absorption bands. (fiber and integrated optics)

  7. FIBER AND INTEGRATED OPTICS: Defects of a phosphosilicate glass exposed to the 193-nm radiation

    Science.gov (United States)

    Larionov, Yu V.; Sokolov, V. O.; Plotnichenko, V. G.

    2007-06-01

    Induced absorption is measured in a hydrogen-unloaded phosphosilicate glass (PSG) in spectral ranges from 140 to 850 nm and from 1000 to 1700 nm before and after its exposure to the 193-nm radiation. It is shown that the induced-absorption bands in the range between 140 and 300 nm do not coincide with the bands observed earlier after exposing a PSG to X-rays. It is assumed that the photorefractive effect in the PSG is related to variations induced in the glass network rather than to defects responsible for the induced-absorption bands.

  8. Landau-Zener crossing in superdeformed 193Hg: Evidence for octupole correlations in superdeformed nuclei

    International Nuclear Information System (INIS)

    Four, possibly five, superdeformed bands have been observed in 193Hg. Two of these bands have strikingly different dynamical moments of inertia from all previously observed superdeformed bands in this region. This behavior can be understood in terms of a level or band crossing. Evidence for transitions between two superdeformed bands is observed for the first time. This, together with the reduced alignments observed and the strong interaction between the crossing bands, is the first experimental evidence supporting the prediction for strong octupole correlations in superdeformed nuclei

  9. Collateral damage-free debridement using 193nm ArF laser

    Science.gov (United States)

    Wynne, James J.; Felsenstein, Jerome M.; Trzcinski, Robert; Zupanski-Nielsen, Donna; Connors, Daniel P.

    2011-03-01

    Burn eschar and other necrotic areas of the skin and soft tissue are anhydrous compared to the underlying viable tissue. A 193 nm ArF excimer laser, emitting electromagnetic radiation at 6.4 eV at fluence exceeding the ablation threshold, will debride such necrotic areas. Because such radiation is strongly absorbed by aqueous chloride ions through the nonthermal process of electron photodetachment, debridement will cease when hydrated (with chloride ions) viable tissue is exposed, avoiding collateral damage to this tissue. Such tissue will be sterile and ready for further treatment, such as a wound dressing and/or a skin graft.

  10. First measurement of magnetic properties in a superdeformed nucleus: 193Hg

    International Nuclear Information System (INIS)

    Dipole transitions linking signature partner superdeformed bands in 193Hg have been observed. Measurements of the photon decay branching ratios, taken together with the average superdeformed quadrupole moment measured in neighboring nuclei, enable the absolute M1 strengths to be determined. From these data, using the strong coupling model, we find (gK-gR)K/Q0=-0.14±0.01 (e b)-1, gK=-0.65±0.14 with Ω=2.8±0.8. These data are consistent with the superdeformed neutron orbital being [512]5/2- as predicted by cranked Woods-Saxon calculations

  11. Radiation sensitive developable bottom anti-reflective coatings (DBARC) for 193nm lithography: first generation

    Science.gov (United States)

    Toukhy, Medhat; Oberlander, Joseph; Mullen, Salem; Lu, PingHung; Neisser, Mark

    2007-03-01

    A first generation DBARC applicable for 1 st minimum 193nm lithography is described in this paper. The polymer used in this DBARC is insoluble in the casting solvent of the resist, which is propyleneglycolmonomethyletheracetate (PGMEA). Photo acid generator (PAG) and base extractions from the DBARC coating by the resist casting solvent were examined by the DBARC dissolution rates in the developer, before and after solvent treatments. Although the resist and the DBARC do not appear to intermix, strong interaction between the two is evident by their lithographic performance and dissolution rate study.

  12. Substantial H-atom production from the 193 nm photolysis of triethylaluminum

    Science.gov (United States)

    Brum, Jeffrey L.; Deshmukh, Subhash; Koplitz, Brent

    1990-01-01

    The 193 nm irradiation of triethylaluminum (TEA) produces a significant amount of atomic hydrogen. Doppler profiles at Lyman-α (121.6 nm) reveal that the H atoms have little kinetic energy, the mean kinetic energy being ⩽ 0.35 eV. These observations are interpreted in the context of possible photodissociation pathways. The most likely route involves a single-photon absorption followed by dissociation to form the ethyl radical, which can further dissociate to produce C 2H 4 and H.

  13. Neutron Induced Capture Cross Sections for Ir-191 and Ir-193

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Yong Deok; Lee, Young Ouk [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)

    2006-07-01

    The neutron induced cross sections are calculated on Ir- 191 and Ir-193 from 10 keV up to 20 MeV, on (n, tot), (n, n), (n, n'), (n, {gamma}), (n, p), (n, {alpha}), (n, 2n), (n, 3n), (n, np) and (n, n{alpha}) reactions. Iridium emits intense gamma rays. Specially, Ir-192 is the major gamma ray source material and widely used in the several areas: material assay, nondestructive testing and medical treatment. For the purpose of the above utilization, Ir-192 is mainly produced in the isotopic production nuclear reactor by the neutron capture process from Ir-191. Using threshold reaction with high energy of neutron, Ir-192 can be produced from Ir-194 by the process of the neutron capture and decay as well. Ir- 191 and Ir-193 have 37.3 % and 62.7 % respectively in the natural abundance. Ir-191 and 193 are stable isotopes. Ir-192 has 73.8 days half-life at ground state and 1.45 months at 56.7 keV meta stable state. Ir-192 has the beta decay to produce Pt-192 and the electron capture to produce Os-192. The major emitted gamma rays are 604 keV, 316 keV and 468 keV from the ground state decay. ENDF/B-VI has fairly recent evaluation on Ir-191 and Ir-193, evaluated in 1995 and distributed in 1997 (by R.Q.Wright, ORNL). From 2 to 20 MeV, the capture data was obtained by renormalizing the natural iridium capture to the Macklin data of Ir-191 at 2 MeV energy. ENDF/B-VI has the (n, 2n), (n, 3n), (n, p) and (n, a) cross section data unchanged from the BROND natural iridium evaluation. The evaluations consisted of an optical model potential search followed by a complete nuclear reaction model calculation and a validation for the experimental data. Nuclear reaction cross sections were calculated using the recently released Empire-II code. The direct capture model enhances the capture cross section in the preequilibrium energy region, and the width fluctuation correction influences on the capture and inelastic scattering cross sections in the equilibrium energy region. The

  14. Comparison of 193 nm and 308 nm laser liquid printing by shadowgraphy imaging

    Energy Technology Data Exchange (ETDEWEB)

    Palla-Papavlu, A., E-mail: apalla@nipne.ro [National Institute for Lasers, Plasma and Radiation Physics, P.O. Box MG-36, Magurele, RO-077125 Bucharest (Romania); Shaw-Stewart, J. [EMPA, Swiss Federal Laboratories for Materials Testing and Research, Laboratory for Functional Polymers, Überlandstrasse 129, 8600 Dübendorf (Switzerland); Paul Scherrer Institute, General Energy Research Department, 5232 Villigen PSI (Switzerland); Mattle, T. [Paul Scherrer Institute, General Energy Research Department, 5232 Villigen PSI (Switzerland); Dinca, V. [National Institute for Lasers, Plasma and Radiation Physics, P.O. Box MG-36, Magurele, RO-077125 Bucharest (Romania); Lippert, T.; Wokaun, A. [Paul Scherrer Institute, General Energy Research Department, 5232 Villigen PSI (Switzerland); Dinescu, M. [National Institute for Lasers, Plasma and Radiation Physics, P.O. Box MG-36, Magurele, RO-077125 Bucharest (Romania)

    2013-08-01

    Over the last years laser-induced forward transfer has emerged as a versatile and powerful tool for engineering surfaces with active compounds. Soft, easily damageable materials can be transferred using a triazene polymer as a sacrificial layer which acts as a pressure generator and at the same time protects the material from direct laser irradiation. To understand and optimize the transfer process of biomolecules in liquid solution by using an intermediate triazene polymer photosensitive layer, shadowgraphy imaging is carried out. Two laser systems i.e. an ArF laser operating at 193 nm and a XeCl laser operating at 308 nm are applied for the transfer. Solutions with 50% v/v glycerol concentration are prepared and the influence of the triazene polymer sacrificial layer thickness (60 nm) on the deposits is studied. The shadowgraphy images reveal a pronounced difference between laser-induced forward transfer using 193 nm or 308 nm, i.e. very different shapes of the ejected liquid.

  15. Study of the inner Bremsstrahlung following the electron-capture decay of {sup 193} Pt

    Energy Technology Data Exchange (ETDEWEB)

    Chavez, J.Y.Z.; Cruz, M.T.F. da; Martins, M.N.; Santos, R.T. dos [Sao Paulo Univ., SP (Brazil). Inst. de Fisica; Zamboni, C.B.; Hamada, M.M.; Camargo, S.P. de; Medeiros, J.A.G. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil); Hindi, M.M. [Tennessee Technological Univ., Cookeville, TN (United States). Dept. of Physics

    1997-12-31

    We are measuring the inner Bremsstrahlung (I B) photons emitted in some of the electron-capture decays of {sup 193} Pt. The source was prepared with highly pure metal Pt. It was irradiated with neutron for 52 days and let to cool down for eight months. The remaining activities were due to {sup 193} Pt{sup g} (half-life 50 yr) and {sup 192} Ir (half-life 74 d), the latter coming from (n, {gamma}) reactions on a small content of Ir. We have used a radiochemistry method to reduce the Ir content of the source. The resulting Pt compound will be dissolved in a plastic scintillator disk. Most of the {sup 192} Ir decays are {beta}{sup -} and their signal in the plastic will be used as a veto for the I B-photon detector. We have performed simulations of the efficiency and absorption effects in the detection geometry. (author) 6 refs., 1 fig.; juan at if.usp.br; czamboni at net.ipen.br; hindi at hindi.physics.tntech.edu

  16. Treatment of cultured glioma cells with the EGFR-TKI gefitinib (''Iressa'', ZD1839) increases the uptake of astatinated EGF despite the absence of gefitinib-mediated growth inhibition

    International Nuclear Information System (INIS)

    The EGFR-TKI (epidermal growth factor receptor tyrosine kinase inhibitor) gefitinib (''Iressa'', ZD1839), a reversible growth inhibitor of EGFR-expressing tumour cells, has been shown to enhance the antitumour effect of ionising radiation, and also to increase the uptake of radioiodinated EGF. Thus, combination of gefitinib treatment and radionuclide targeting is an interesting option for therapy of brain tumours that are difficult to treat with conventional methods. The aim of this study was to evaluate how pre-treatment with gefitinib affects binding of astatinated EGF (211At-EGF) to cultured glioma U343 cells, which express high levels of EGFR. The growth of U343 cells in the presence of gefitinib was investigated, and it was found that gefitinib does not significantly inhibit the growth of these cells. Nevertheless, the uptake of 211At-EGF in U343 cells was markedly increased (up to 3.5 times) in cells pre-treated with gefitinib (1 μM). This indicates that a combination of gefitinib treatment and radionuclide targeting to EGFR might be a useful therapeutic modality, even for patients who do not respond to treatment with gefitinib alone. (orig.)

  17. An AC phase measuring interferometer for measuring dn/dT of fused silica and calcium fluoride at 193 nm

    Energy Technology Data Exchange (ETDEWEB)

    Shagam, R.N.

    1998-09-01

    A novel method for the measurement of the change in index of refraction vs. temperature (dn/dT) of fused silica and calcium fluoride at the 193 nm wavelength has been developed in support of thermal modeling efforts for the development of 193 nm-based photolithographic exposure tools. The method, based upon grating lateral shear interferometry, uses a transmissive linear grating to divide a 193 nm laser beam into several beam paths by diffraction which propagate through separate identical material samples. One diffracted order passing through one sample overlaps the undiffracted beam from a second sample and forms interference fringes dependent upon the optical path difference between the two samples. Optical phase delay due to an index change from heating one of the samples causes the interference fringes to change sinusoidally with phase. The interferometer also makes use of AC phase measurement techniques through lateral translation of the grating. Results for several samples of fused silica and calcium fluoride are demonstrated.

  18. Polysulfone based non-CA resists for 193 nm immersion lithography: Effect of increasing polymer absorbance on sensitivity

    International Nuclear Information System (INIS)

    The use of norbornene-based polysulfones as non-chemically amplified resists (non-CARs) for 193 nm immersion lithography was explored. Allylbenzene was incorporated into the polymer backbone to increase the absorbance of the polymers. The effect of polymer absorbance on sensitivity to 193 nm radiation was investigated. Polymer films on silicon wafers have been irradiated with 193 nm photons in the absence of a photo-acid generator. Chemical contrast curves (film thickness versus dose plots prior to solvent development) and contrast curves (film thickness versus dose plots after solvent development) were obtained by spectroscopic ellipsometry. The results show that E0 values could be reduced significantly by increasing the absorbance of the polymer.

  19. A Mathematical Model of Bimodal Epigenetic Control of miR-193a in Ovarian Cancer Stem Cells

    Science.gov (United States)

    Kochańczyk, Marek; Lin, Jora M. J.; Chen, Gary C. W.; Lai, Hung-Cheng; Nephew, Kenneth P.; Hwang, Tzy-Wei; Chan, Michael W. Y.

    2014-01-01

    Accumulating data indicate that cancer stem cells contribute to tumor chemoresistance and their persistence alters clinical outcome. Our previous study has shown that ovarian cancer may be initiated by ovarian cancer initiating cells (OCIC) characterized by surface antigen CD44 and c-KIT (CD117). It has been experimentally demonstrated that a microRNA, namely miR-193a, targets c-KIT mRNA for degradation and could play a crucial role in ovarian cancer development. How miR-193a is regulated is poorly understood and the emerging picture is complex. To unravel this complexity, we propose a mathematical model to explore how estrogen-mediated up-regulation of another target of miR-193a, namely E2F6, can attenuate the function of miR-193a in two ways, one through a competition of E2F6 and c-KIT transcripts for miR-193a, and second by binding of E2F6 protein, in association with a polycomb complex, to the promoter of miR-193a to down-regulate its transcription. Our model predicts that this bimodal control increases the expression of c-KIT and that the second mode of epigenetic regulation is required to generate a switching behavior in c-KIT and E2F6 expressions. Additional analysis of the TCGA ovarian cancer dataset demonstrates that ovarian cancer patients with low expression of EZH2, a polycomb-group family protein, show positive correlation between E2F6 and c-KIT. We conjecture that a simultaneous EZH2 inhibition and anti-estrogen therapy can constitute an effective combined therapeutic strategy against ovarian cancer. PMID:25545504

  20. A mathematical model of bimodal epigenetic control of miR-193a in ovarian cancer stem cells.

    Directory of Open Access Journals (Sweden)

    Frank H C Cheng

    Full Text Available Accumulating data indicate that cancer stem cells contribute to tumor chemoresistance and their persistence alters clinical outcome. Our previous study has shown that ovarian cancer may be initiated by ovarian cancer initiating cells (OCIC characterized by surface antigen CD44 and c-KIT (CD117. It has been experimentally demonstrated that a microRNA, namely miR-193a, targets c-KIT mRNA for degradation and could play a crucial role in ovarian cancer development. How miR-193a is regulated is poorly understood and the emerging picture is complex. To unravel this complexity, we propose a mathematical model to explore how estrogen-mediated up-regulation of another target of miR-193a, namely E2F6, can attenuate the function of miR-193a in two ways, one through a competition of E2F6 and c-KIT transcripts for miR-193a, and second by binding of E2F6 protein, in association with a polycomb complex, to the promoter of miR-193a to down-regulate its transcription. Our model predicts that this bimodal control increases the expression of c-KIT and that the second mode of epigenetic regulation is required to generate a switching behavior in c-KIT and E2F6 expressions. Additional analysis of the TCGA ovarian cancer dataset demonstrates that ovarian cancer patients with low expression of EZH2, a polycomb-group family protein, show positive correlation between E2F6 and c-KIT. We conjecture that a simultaneous EZH2 inhibition and anti-estrogen therapy can constitute an effective combined therapeutic strategy against ovarian cancer.

  1. Low-temperature structure and lattice dynamics of the thermoelectric clathrate Sn24P19.3I8

    International Nuclear Information System (INIS)

    Highlights: ► Sn24P19.3I8 retains the crystal structure of the type-I clathrate even at 10 K. ► Two Einstein and one Debye terms describe the lattice dynamics of Sn24P19.3I8. ► The thermal conductivity for Sn24P19.3I8 is almost entirely phononic. - Abstract: The crystal structure of the thermoelectric clathrate Sn24P19.3I8 was determined down to 10 K showing no variations with the temperature. Even at 10 K Sn24P19.3I8 crystallizes in the type-I clathrate structure, space group Pm3-n, with the cubic unit cell parameter ranging from 10.9173 Å at 10 K to 10.9554 Å at room temperature. In its crystal structure, tin and phosphorus atoms form the framework that traps the guest iodine atoms in the polyhedral cavities of two different shapes. The temperature-dependent crystal structure data and the results of the heat capacity measurements revealed the localized vibrations of the guest atoms inside the oversized cavities with the characteristic Einstein temperatures of θE1 = 60 K and θE2 = 78 K, whereas the characteristic Debye temperature for Sn24P19.3I8 is 265 K. The room temperature lattice thermal conductivity was calculated using the Debye model to be κL = 0.85 W m−1 K−1, which is in excellent agreement with the experimentally measured data and demonstrates that the thermal conductivity is almost entirely phononic.

  2. Research Progress of MicroRNA-193b and Obesity%MicroRNA-193b与肥胖的研究进展*

    Institute of Scientific and Technical Information of China (English)

    孟建忠; 景欣悦; 朱冰梅

    2015-01-01

    microRNAs(miRNAs)是近年来新发现的一类大小为20-25个核苷酸的单链非编码小分子RNA,具有内源性、高保守的特点,通过与靶mRNA碱基互补配对,发挥降解或抑制靶mRNA翻译的作用。近期研究发现,miRNA与肥胖、2型糖尿病等代谢性疾病密切相关。肥胖越来越成为一个遍及全球的严重公共健康问题,主要表现为脂肪细胞数量异常增加和体积异常增大,是以机体能量代谢失衡导致脂肪过度积聚为主要特征的一种代谢性疾病。miRNA-193b-365在脂肪细胞分化和肥胖状态下异常表达,推测其可能参与了脂肪细胞分化以及肥胖的发生发展。深入理解脂肪细胞分化机制对于防治肥胖具有重大意义。本文就此领域的研究进展作一综述。%MicroRNAs (miRNAs) were found as a species of small non-coding single-stranded RNA molecules with the size of 20 to 25 nucleotides in recent years, which featured highly conserved and endogeny. It depredated and inhibited the target mRNA translation by complementary base pairing with the target mRNA. According to the latest study, miRNA was closely related with obesity, type 2 diabetes and other metabolic diseases. Obesity had became a major public health problem worldwide, which showed as an unusual increase in both the number and size of fat cells based on excessive accumulation of fat lead by the body’s energy metabolism imbalance of a metabolic disease. Among them, miRNA-193b-365 had an abnormal expression in adipocyte differentiation and obesity status. It might be involved in adipocyte differentiation and the development of obesity. Thus, it was of great significance to do a deep research in the understanding adipocyte differentiation mechanism to prevent and treat obesity. This paper reviewed research progress in this field.

  3. Depth-of-focus (DoF) analysis of a 193nm superlens imaging structure.

    Science.gov (United States)

    Shi, Zhong; Kochergin, Vladimir; Wang, Fei

    2009-10-26

    We present a design of a 193 nm superlens imaging structure to enable the printing of 20 nm features. Optical image simulations indicate that the 20 nm resolution is feasible for both the periodic grating feature and the two-slit feature. Nominal depth-of-focus (DoF) position for both features is identified through the image contrast calculations. Simulations show that the two features have a common nominal dose at the nominal DoF to resolve 20 nm critical dimension when a suitable dielectric material is placed between mask and superlens layer. A DoF of micro8 nm is shown to be obtainable for the 20 nm half-pitch grating feature while the respective DoF for the two-slit feature is less than 8 nm which potentially can be enhanced by employing existing lithographic resolution enhancement techniques. PMID:19997282

  4. Plasma channel formed by ultraviolet laser pulses at 193 nm in air

    Institute of Scientific and Technical Information of China (English)

    Yuanyuan Ma; Xin Lu; Tingting Xi; Qihuang Gong; Jie Zhang

    2009-01-01

    The propagation of picosecond deep ultraviolet laser pulse at wavelength of 193 nm in air is numerically investigated.Long plasma channel can be formed due to the competition between Kerr self-focusing and ionization induced defocusing.The plasma channel with electron density of above 1013/cma can be formed over 70 m by 50-ps,20-mJ laser pulses.The fluctuation of laser intensity and electron density inside ultraviolet(UV)plasma channel is significantly lower than that of infrared pulse.The linear absorption of UV laser by air is considered in the simulation and it is shown that the linear absorption is important for the limit of the length of plasma channel.

  5. The effect of 193 nm excimer laser radiation on the human corneal endothelial cell density

    International Nuclear Information System (INIS)

    The effect of 193 nm excimer laser radiation on human corneal endothelial cell density was examined. Fifty-five eyes from 35 patients underwent photorefractive keratectomy for myopia. Photomicrographs of the endothelium were taken a short time before the operation and on an average of 7 months postoperatively with a specular microscope. The average endothelial cell densities were preoperatively 3375 ± 266 cells/mm2 (means ± SD) and postoperatively 3348 ± 287 cells/mm2, corresponding to a fall of 27 cells/mm2 (N = 55). This fall in endothelial cell density was not statistically significant. A significant correlation between the change in cell density and age of the patient was found, with older patients losing more cells (N = 35, 2p < 0.05). The magnification of the specular microscope was found to change with corneal thickness. The importance of correcting the endothelial cell densities for corneal thickness is discussed. (au) 14 refs

  6. Electromagnetic properties of low-excitation states in 191Ir and 193Ir and supersymmetry schemes

    International Nuclear Information System (INIS)

    The electromagnetic properties of low-excitation states in 191Ir and 193Ir have been studied following Coulomb excitation. Gyromagnetic ratios were measured by the transient-field technique and level lifetimes were measured by the Doppler-shift recoil distance method. Multipolarity mixing ratios were determined from measured particle-γ angular correlations. The present lifetime and g-factor results extend the data available for comparison with theory and help discriminate between disparate experimental values reported previously in the literature. We compare the experimental data with particle-triaxial-rotor model calculations and with the predictions of the U(6/4) and U(6/20) supersymmetry models based on the interacting-boson-fermion model

  7. White-Light Emission from Silicone Rubber Modified by 193 nm ArF Excimer Laser

    Science.gov (United States)

    Okoshi, Masayuki; Sekine, Daisuke; Inoue, Narumi; Yamashita, Tsugito

    2007-04-01

    The photochemical surface modification of silicone ([SiO(CH3)2]n) rubber has been successfully demonstrated using a 193 nm ArF excimer laser, and white light of strong intensity was emitted upon exposure to a 325 nm He-Cd laser. The photoluminescence spectra of the modified silicone showed broad peaks centered at 410, 550, and 750 nm wavelengths. The modified surface was carbon-free silicon oxide, and the chemical composition ratio of O/Si was approximately 2. However, the surface was not silica glass (SiO2), as clarified by IR spectroscopy. Instead, nanometer-size particles of silicon oxide were formed on the surface of the modified silicone rubber.

  8. Upsilon production in U+U collisions at 193 GeV with the STAR experiment

    CERN Document Server

    Adamczyk, L; Agakishiev, G; Aggarwal, M M; Ahammed, Z; Alekseev, I; Anderson, D M; Aoyama, R; Aparin, A; Arkhipkin, D; Aschenauer, E C; Ashraf, M U; Attri, A; Averichev, G S; Bai, X; Bairathi, V; Bellwied, R; Bhasin, A; Bhati, A K; Bhattarai, P; Bielcik, J; Bielcikova, J; Bland, L C; Bordyuzhin, I G; Bouchet, J; Brandenburg, J D; Brandin, A V; Bunzarov, I; Butterworth, J; Caines, H; Sánchez, M Calderón de la Barca; Campbell, J M; Cebra, D; Chakaberia, I; Chaloupka, P; Chang, Z; Chatterjee, A; Chattopadhyay, S; Chen, J H; Chen, X; Cheng, J; Cherney, M; Christie, W; Contin, G; Crawford, H J; Das, S; De Silva, L C; Debbe, R R; Dedovich, T G; Deng, J; Derevschikov, A A; Didenko, L; Dilks, C; Dong, X; Drachenberg, J L; Draper, J E; Du, C M; Dunkelberger, L E; Dunlop, J C; Efimov, L G; Engelage, J; Eppley, G; Esha, R; Esumi, S; Evdokimov, O; Eyser, O; Fatemi, R; Fazio, S; Federic, P; Fedorisin, J; Feng, Z; Filip, P; Fisyak, Y; Flores, C E; Fulek, L; Gagliardi, C A; Garand, D; Geurts, F; Gibson, A; Girard, M; Greiner, L; Grosnick, D; Gunarathne, D S; Guo, Y; Gupta, A; Gupta, S; Guryn, W; Hamad, A I; Hamed, A; Haque, R; Harris, J W; He, L; Heppelmann, S; Heppelmann, S; Hirsch, A; Hoffmann, G W; Horvat, S; Huang, H Z; Huang, B; Huang, T; Huang, X; Huck, P; Humanic, T J; Igo, G; Jacobs, W W; Jentsch, A; Jia, J; Jiang, K; Jowzaee, S; Judd, E G; Kabana, S; Kalinkin, D; Kang, K; Kauder, K; Ke, H W; Keane, D; Kechechyan, A; Khan, Z; Kikoła, D P; Kisel, I; Kisiel, A; Kochenda, L; Koetke, D D; Kosarzewski, L K; Kraishan, A F; Kravtsov, P; Krueger, K; Kumar, L; Lamont, M A C; Landgraf, J M; Landry, K D; Lauret, J; Lebedev, A; Lednicky, R; Lee, J H; Li, Y; Li, C; Li, X; Li, W; Li, X; Lin, T; Lisa, M A; Liu, F; Liu, Y; Ljubicic, T; Llope, W J; Lomnitz, M; Longacre, R S; Luo, X; Luo, S; Ma, G L; Ma, R; Ma, L; Ma, Y G; Magdy, N; Majka, R; Manion, A; Margetis, S; Markert, C; Matis, H S; McDonald, D; McKinzie, S; Meehan, K; Mei, J C; Miller, Z W; Minaev, N G; Mioduszewski, S; Mishra, D; Mohanty, B; Mondal, M M; Morozov, D A; Mustafa, M K; Nandi, B K; Nasim, Md; Nayak, T K; Nigmatkulov, G; Niida, T; Nogach, L V; Nonaka, T; Novak, J; Nurushev, S B; Odyniec, G; Ogawa, A; Oh, K; Okorokov, V A; Olvitt, D; Page, B S; Pak, R; Pan, Y X; Pandit, Y; Panebratsev, Y; Pawlik, B; Pei, H; Perkins, C; Pile, P; Pluta, J; Poniatowska, K; Porter, J; Posik, M; Poskanzer, A M; Pruthi, N K; Przybycien, M; Putschke, J; Qiu, H; Quintero, A; Ramachandran, S; Ray, R L; Reed, R; Rehbein, M J; Ritter, H G; Roberts, J B; Rogachevskiy, O V; Romero, J L; Roth, J D; Ruan, L; Rusnak, J; Rusnakova, O; Sahoo, N R; Sahu, P K; Sakrejda, I; Salur, S; Sandweiss, J; Sarkar, A; Schambach, J; Scharenberg, R P; Schmah, A M; Schmidke, W B; Schmitz, N; Seger, J; Seyboth, P; Shah, N; Shahaliev, E; Shanmuganathan, P V; Shao, M; Sharma, M K; Sharma, A; Sharma, B; Shen, W Q; Shi, Z; Shi, S S; Shou, Q Y; Sichtermann, E P; Sikora, R; Simko, M; Singha, S; Skoby, M J; Smirnov, D; Smirnov, N; Solyst, W; Song, L; Sorensen, P; Spinka, H M; Srivastava, B; Stanislaus, T D S; Stepanov, M; Stock, R; Strikhanov, M; Stringfellow, B; Sugiura, T; Sumbera, M; Summa, B; Sun, Y; Sun, Z; Sun, X M; Surrow, B; Svirida, D N; Tang, Z; Tang, A H; Tarnowsky, T; Tawfik, A; Thäder, J; Thomas, J H; Timmins, A R; Tlusty, D; Todoroki, T; Tokarev, M; Trentalange, S; Tribble, R E; Tribedy, P; Tripathy, S K; Tsai, O D; Ullrich, T; Underwood, D G; Upsal, I; Van Buren, G; van Nieuwenhuizen, G; Varma, R; Vasiliev, A N; Vertesi, R; Videbæk, F; Vokal, S; Voloshin, S A; Vossen, A; Wang, G; Wang, J S; Wang, F; Wang, Y; Wang, Y; Webb, J C; Webb, G; Wen, L; Westfall, G D; Wieman, H; Wissink, S W; Witt, R; Wu, Y; Xiao, Z G; Xie, G; Xie, W; Xin, K; Xu, Z; Xu, H; Xu, N; Xu, J; Xu, Y F; Xu, Q H; Yang, Y; Yang, Y; Yang, S; Yang, Q; Yang, Y; Yang, C; Ye, Z; Ye, Z; Yi, L; Yip, K; Yoo, I -K; Yu, N; Zbroszczyk, H; Zha, W; Zhang, J; Zhang, Z; Zhang, J; Zhang, S; Zhang, X P; Zhang, J B; Zhang, Y; Zhang, S; Zhao, J; Zhong, C; Zhou, L; Zhu, X; Zoulkarneeva, Y; Zyzak, M

    2016-01-01

    We present a measurement of the inclusive production of Upsilon mesons in U+U collisions at 193 GeV at mid-rapidity (|y| < 1). Previous studies in central Au+Au collisions at 200 GeV show a suppression of Upsilon(1S+2S+3S) production relative to expectations from the Upsilon yield in p+p collisions scaled by the number of binary nucleon-nucleon collisions (Ncoll), with an indication that the Upsilon(1S) state is also suppressed. The present measurement extends the number of participant nucleons in the collision (Npart) by 20% compared to Au+Au collisions, and allows us to study a system with higher energy density. We observe a suppression in both the Upsilon(1S+2S+3S) and Upsilon(1S) yields in central U+U data, which consolidates and extends the previously observed suppression trend in Au+Au collisions.

  9. Breaks in plasmid DNA strand induced by laser radiation at a wavelength of 193 nm

    International Nuclear Information System (INIS)

    DNA of plasmid pB322 irradiated with laser at a wavelength of 193 nm was treated with an extract containing proteins from E.coli K12 AB1157 (wild-type). The enzymes were found to produce single- and double-strand DNA breaks, which was interpreted as a transformation of a portion of cyclobutane pyrimidine dimers and (6-4) photoproducts into nonrepairable single-strand DNA breaks. The products resulted from ionization of DNA, in particular, single-strand breaks, transform to double-strand breaks. A comparison of these data with the data on survival of plasmid upon transformation of E.coli K12 AB1157 enables one to assess the biological significance of single- and double-strand breaks. The inactivation of the plasmid is mainly determined by the number of directly formed laser-induced single-strand breaks. 26 refs.; 2 figs

  10. The effect of 193 nm excimer laser radiation on the human corneal endothelial cell density

    Energy Technology Data Exchange (ETDEWEB)

    Isager, P.; Hjortdal, J.Oe.; Ehlers, N. [Aarhus Univ. Hospital, Dept. of Ophthalmology, Aarhus (Denmark)

    1996-06-01

    The effect of 193 nm excimer laser radiation on human corneal endothelial cell density was examined. Fifty-five eyes from 35 patients underwent photorefractive keratectomy for myopia. Photomicrographs of the endothelium were taken a short time before the operation and on an average of 7 months postoperatively with a specular microscope. The average endothelial cell densities were preoperatively 3375 {+-} 266 cells/mm{sup 2} (means {+-} SD) and postoperatively 3348 {+-} 287 cells/mm{sup 2}, corresponding to a fall of 27 cells/mm{sup 2} (N = 55). This fall in endothelial cell density was not statistically significant. A significant correlation between the change in cell density and age of the patient was found, with older patients losing more cells (N = 35, 2p < 0.05). The magnification of the specular microscope was found to change with corneal thickness. The importance of correcting the endothelial cell densities for corneal thickness is discussed. (au) 14 refs.

  11. Three-body dissociations: The photodissociation of dimethyl sulfoxide at 193 nm

    Energy Technology Data Exchange (ETDEWEB)

    Blank, D.A.; North, S.W.; Stranges, D. [Lawrence Berkeley National Lab., CA (United States)] [and others

    1997-04-01

    When a molecule with two equivalent chemical bonds is excited above the threshold for dissociation of both bonds, how the rupture of the two bonds is temporally coupled becomes a salient question. Following absorption at 193 nm dimethyl sulfoxide (CH{sub 3}SOCH{sub 3}) contains enough energy to rupture both C-S bonds. This can happen in a stepwise (reaction 1) or concerted (reaction 2) fashion where the authors use rotation of the SOCH{sub 3} intermediate prior to dissociation to define a stepwise dissociation: (1) CH{sub 3}SOCH{sub 3} {r_arrow} 2CH{sub 3} + SO; (2a) CH{sub 3}SOCH{sub 3} {r_arrow} CH{sub 3} + SOCH{sub 3}; and (2b) SOCH{sub 3} {r_arrow} SO + CH{sub 3}. Recently, the dissociation of dimethyl sulfoxide following absorption at 193 nm was suggested to involve simultaneous cleavage of both C-S bonds on an excited electronic surface. This conclusion was inferred from laser induced fluorescence (LIF) and resonant multiphoton ionization (2+1 REMPI) measurements of the internal energy content in the CH{sub 3} and SO photoproducts and a near unity quantum yield measured for SO. Since this type of concerted three body dissociation is very interesting and a rather rare event in photodissociation dynamics, the authors chose to investigate this system using the technique of photofragment translational spectroscopy at beamline 9.0.2.1. The soft photoionization provided by the VUV undulator radiation allowed the authors to probe the SOCH{sub 3} intermediate which had not been previously observed and provided good evidence that the dissociation of dimethyl sulfoxide primarily proceeds via a two step dissociation, reaction 2.

  12. Photoinitiated decomposition of substituted ethylenes: The photodissociation of vinyl chloride and acrylonitrile at 193 nm

    Energy Technology Data Exchange (ETDEWEB)

    Blank, D.A.; Suits, A.G.; Lee, Y.T. [Lawrence Berkeley National Lab., CA (United States)] [and others

    1997-04-01

    Ethylene and its substituted analogues (H{sub 2}CCHX) are important molecules in hydrogen combustion. As the simplest {pi}-bonded hydrocarbons these molecules serve as prototypical systems for understanding the decomposition of this important class of compounds. The authors have used the technique of photofragment translational spectroscopy at beamline 9.0.2.1 to investigate the dissociation of vinyl chloride (X=Cl) and acrylonitrile (X=CN) following absorption at 193 nm. The technique uses a molecular beam of the reactant seeded in helium which is crossed at 90 degrees with the output of an excimer laser operating on the ArF transition, 193.3 nm. The neutral photoproducts which recoil out of the molecular beam travel 15.1 cm where they are photoionized by the VUV undulator radiation, mass selected, and counted as a function of time. The molecular beam source is rotatable about the axis of the dissociation laser. The authors have directly observed all four of the following dissociation channels for both systems: (1) H{sub 2}CCHX {r_arrow} H + C{sub 2}H{sub 2}X; (2) H{sub 2}CCHX {r_arrow} X + C{sub 2}H{sub 3}; (3) H{sub 2}CCHX {r_arrow} H{sub 2} + C{sub 2}HX; and (4) H{sub 2}CCHX {r_arrow} HX + C{sub 2}H{sub 2}. They measured translational energy distributions for all of the observed channels and measured the photoionization onset for many of the photoproducts which provided information about their chemical identity and internal energy content. In the case of acrylonitrile, selective product photoionization provided the ability to discriminate between channels 2 and 4 which result in the same product mass combination.

  13. Photodissociation dynamics of 1-propanol and 2-propanol at 193.3 nm

    International Nuclear Information System (INIS)

    193.3-nm photodissociation dynamics of jet-cooled 1-propanol and 2-propanol and their partially deuterated variants are examined by using the high-n Rydberg-atom time-of-flight technique. Isotope labeling studies show that O-H bond fission is the primary H-atom production channel in the ultraviolet photodissociation of both 1-propanol and 2-propanol. Center-of-mass (c.m.) product translational energy release of the RO-H dissociation channel is large, with T>=0.78 for H+1-propoxy (n-propoxy) and 0.79 for H+2-propoxy (isoproxy). Maximum c.m. translational energy release yields an upper limit of the O-H bond dissociation energy: 433±2 kJ/mol in 1-propanol and 435±2 kJ/mol in 2-propanol. H-atom product angular distribution is anisotropic (with β≅-0.79 for 1-propanol and -0.77 for 2-propanol), suggesting an electronic transition moment perpendicular to the H-O-C plane and a short excited-state dissociation lifetime (less than a rotational period). Information about photodissociation dynamics and bond energies of the partially deuterated propanols are also obtained. The 193.3-nm photodissociation dynamics of 1-propanol and 2-propanol are nearly identical to each other and are similar to those of methanol and ethanol. This indicates a common RO-H dissociation mechanism: after the nO→σ*(O-H)/3s excitation localized on the H-O-C moiety, the H atom is ejected promptly in the H-O-C plane in a time scale shorter than a rotational period of the parent molecule, and it dissociates along the O-H coordinate on the repulsive excited-state potential-energy surface with a large translational energy release

  14. Power and status. Administration, appointment policies, and social hierarchies in the Roman Empire (193-284 AD)

    NARCIS (Netherlands)

    Mennen, I.A.M.

    2010-01-01

    This study defines changing power and status relations between the highest ranking representatives of Roman imperial power at the central level, particularly in a period when the central level came under tremendous pressure, AD 193-284. Prosopography has been used as the principal method for analyzi

  15. Advances with the new AIMS fab 193 2nd generation: a system for the 65 nm node including immersion

    Science.gov (United States)

    Zibold, Axel M.; Poortinga, E.; Doornmalen, H. v.; Schmid, R.; Scherubl, T.; Harnisch, W.

    2005-06-01

    The Aerial Image Measurement System, AIMS, for 193nm lithography emulation is established as a standard for the rapid prediction of wafer printability for critical structures including dense patterns and defects or repairs on masks. The main benefit of AIMS is to save expensive image qualification consisting of test wafer exposures followed by wafer CD-SEM resist or wafer analysis. By adjustment of numerical aperture (NA), illumination type and partial coherence (σ) to match any given stepper/ scanner, AIMS predicts the printability of 193nm reticles such as binary with, or without OPC and phase shifting. A new AIMS fab 193 second generation system with a maximum NA of 0.93 is now available. Improvements in field uniformity, stability over time, measurement automation and higher throughput meet the challenging requirements of the 65nm node. A new function, "Global CD Map" can be applied to automatically measure and analyse the global CD uniformity of repeating structures across a reticle. With the options of extended depth-of-focus (EDOF) software and the upcoming linear polarisation capability in the illumination the new AIMS fab 193 second generation system is able to cover both dry and immersion requirements for NA performed to study the effects of polarisation for imaging by comparing the aerial image of the AIMS to the resist image of the scanner.

  16. Advances with the new AIMS fab 193 2nd generation: a system for the 65 nm node including immersion

    Science.gov (United States)

    Zibold, Axel M.; Poortinga, E.; Doornmalen, H. v.; Schmid, R.; Scherubl, T.; Harnisch, W.

    2005-06-01

    The Aerial Image Measurement System, AIMS, for 193nm lithography emulation is established as a standard for the rapid prediction of wafer printability for critical structures including dense patterns and defects or repairs on masks. The main benefit of AIMS is to save expensive image qualification consisting of test wafer exposures followed by wafer CD-SEM resist or wafer analysis. By adjustment of numerical aperture (NA), illumination type and partial coherence (σ) to match any given stepper/ scanner, AIMS predicts the printability of 193nm reticles such as binary with, or without OPC and phase shifting. A new AIMS fab 193 second generation system with a maximum NA of 0.93 is now available. Improvements in field uniformity, stability over time, measurement automation and higher throughput meet the challenging requirements of the 65nm node. A new function, "Global CD Map" can be applied to automatically measure and analyse the global CD uniformity of repeating structures across a reticle. With the options of extended depth-of-focus (EDOF) software and the upcoming linear polarisation capability in the illumination the new AIMS fab 193 second generation system is able to cover both dry and immersion requirements for NA < 1. Rigorous simulations have been performed to study the effects of polarisation for imaging by comparing the aerial image of the AIMS to the resist image of the scanner.

  17. Determination of effective resonance energy for the 193Ir(n,γ)194Ir reaction by the cadmium ratio method

    Science.gov (United States)

    Budak, Mustafa Guray; Karadag, Mustafa; Yücel, Haluk

    2016-04-01

    In this work, the effective resonance energy, Ebarr -value for the 193Ir(n,γ)194Ir reaction was measured using cadmium ratio method. A dual monitor (197Au-98Mo), which has convenient resonance properties, was employed for characterization of the irradiation sites. Then analytical grade iridium oxide samples diluted with CaCO3 to lower neutron self-shielding effect stacked in small cylindrical Teflon boxes were irradiated once with a 1 mm thick Cd cylindrical box placed in a thermalized neutron field of an 241Am-Be neutron source then without it. The activities produced in samples during 193Ir(n,γ)194Ir reaction were measured using a p-type HPGe detector γ-ray spectrometer with a 44.8% relative efficiency. The correction factors for thermal, epithermal neutron self-shielding (Gth, Gepi), true coincidence summing (Fcoi) and gamma-ray self-absorption (Fs) effects were determined with appropriate approaches and programs. Thus, the experimental Ebarr -value was determined to be 2.65 ± 0.61 eV for 193Ir target nuclide. The recent data for Q0 and FCd values for Ebarr determination were based on k0-NAA online database. The present experimental Ebarr value was calculated and compared with more recent values for Q0 and FCd for 193Ir. Additionally, the Ebarr -values was theoretically calculated from the up-to-date resonance data obtained from ENDF/B VII library using two different approaches. Since there is no experimentally determined Ebarr -value for the 193Ir isotope, the results are compared with the calculated ones given in the literature.

  18. Multiwavelength study of the northeastern outskirts of the extended TeV source HESS J1809–193

    Energy Technology Data Exchange (ETDEWEB)

    Rangelov, Blagoy; Kargaltsev, Oleg; Hare, Jeremy; Volkov, Igor [Department of Physics, The George Washington University, 725 21st Street, NW, Washington, DC 20052 (United States); Posselt, Bettina; Pavlov, George G., E-mail: rangelov13@gwu.edu [Pennsylvania State University, 525 Davey Laboratory, University Park, PA 16802 (United States)

    2014-11-20

    HESS J1809–193 is an extended TeV γ-ray source in the Galactic plane. Multiwavelength observations of the HESS J1809–193 field reveal a complex picture. We present results from three Chandra X-Ray Observatory and two Suzaku observations of a region in the northeastern outskirts of HESS J1809-193, where enhanced TeV emission has been reported. Our analysis also includes GeV γ-ray and radio data. One of the X-ray sources in the field is the X-ray binary XTE J1810-189, for which we present the outburst history from multiple observatories and confirm that XTE J1810-189 is a strongly variable type I X-ray burster, which can hardly produce TeV emission. We investigate whether there is any connection between the possible TeV extension of HESS J1809–193 and the sources seen at lower energies. We find that another X-ray binary candidate, Suzaku J1811-1900, and a radio supernova remnant, SNR G11.4–0.1, can hardly be responsible for the putative TeV emission. Our multiwavelength classification of fainter X-ray point sources also does not produce a plausible candidate. We conclude that the northeast extension of HESS J1809–193, if confirmed by deeper observations, can be considered a dark accelerator—a TeV source without a visible counterpart at lower energies.

  19. k193hw.m77t and k193hw.h77t: MGD77T data and header files for single-beam bathymetry data for field activity K-1-93-HW in Oahu, Hawaii from 02/20/1993 to 02/26/1993

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of the U.S. Geological Survey cruise K-1-93-HW. The cruise was conducted in Oahu,...

  20. a193yb.m77t and a193yb.h77t: MGD77T data and header files for single-beam bathymetry data for field activity A-1-93-YB in Yakukat Bay, Alaska from 08/21/1993 to 08/27/1993

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with GPS navigation data was collected as part of the U.S. Geological Survey cruise A-1-93-YB. The cruise was conducted in Yakukat...

  1. LNG containment release: Comparison of NFPA-59A and 49-CFR-193

    International Nuclear Information System (INIS)

    Due to the potential wide area impact of an unplanned LNG (Liquefied Natural Gas) release, the National Fire Protection Association (NFPA) and later the US Department of Transportation issued standards and regulations which included specific methodologies for analyzing the consequence of an accidental LNG release. The concept of a ''design spill'' was defined in order to evaluate the consequences of an accidental LNG release, with particular attention to the influence of safety protective measures. In addition to specifying the magnitude of the unplanned release, the design spill also specified some of the parameters for estimation of the downwind LNG vapor dispersion and the extent of the radiant heat from an LNG pool fire. Since the NFPA-59A and 49-CFR-193 standards were the first in-depth regulation to address consequence analysis estimation for petroleum components, it is particularly important to consider their details in light of the recently proposed EPA 40-CFR-68 regulations [Risk Management for Chemical Accidental Release Prevention] which specifically address consequence analysis as a part of process safety management

  2. Next-generation 193-nm laser for sub-100-nm lithography

    Science.gov (United States)

    Duffey, Thomas P.; Blumenstock, Gerry M.; Fleurov, Vladimir B.; Pan, Xiaojiang; Newman, Peter C.; Glatzel, Holger; Watson, Tom A.; Erxmeyer, J.; Kuschnereit, Ralf; Weigl, Bernhard

    2001-09-01

    The next generation 193 nm (ArF) laser has been designed and developed for high-volume production lithography. The NanoLithTM 7000, offering 20 Watts average output power at 4 kHz repetition rates is designed to support the highest exposure tool scan speeds for maximum productivity and wafer throughput. Fundamental design changes made to the laser core technologies are described. These advancements in core technology support the delivery of highly line-narrowed light with EQ 0.35 pm FWHM and EQ 0.95 pm at 95% included energy integral, enabling high contrast imaging from exposure tools with lens NA exceeding 0.75. The system has been designed to support production lithography, meeting specifications for bandwidth, dose stability (+/- 0.3% in 20 ms window) and wavelength stability (+/- 0.05 pm average line center error in 20 ms window) across 2 - 4 kHz repetition rates. Improvements in optical materials and coatings have led to increased lifetime of optics modules. Optimization of the discharge electrode design has increased chamber lifetime. Early life-testing indicates that the NanoLithTM core technologies have the potential for 400% reduction of cost of consumables as compared to its predecessor, the ELX-5000A and has been discussed elsewhere.

  3. Photodissociation of vinyl cyanide at 193 nm: Nascent product distributions of the molecular elimination channels

    International Nuclear Information System (INIS)

    The photodissociation dynamics of vinyl cyanide (H2CCHCN, acrylonitrile) and deuterated vinyl cyanide (D2CCDCN) at 193 nm are examined using time-resolved Fourier transform infrared emission spectroscopy. Prior photofragment translational spectroscopy studies [D. A. Blank et al., J. Chem. Phys. 108, 5784 (1998)] of the dissociation have observed the presence of four main dissociation channels; two molecular and two radical in nature. However, with the exception of a2) and cyanovinylidene (:C=CHCN), we find this reaction channel to be of little importance as there is no evidence to support any significant presence of rovibrationally excited cyanoacetylene. Spectral modeling of the product distributions allows for the first experimental determination of the relative occurrence of the three-centered (resulting in HCN+vinylidene) versus four-centered (HNC+acetylene) elimination channels as 3.34 to 1.00, in contrast to the previously calculated value of 126:1. Rice-Ramsperger-Kassel-Marcus analysis depicts that the transition state energy of the four-centered reaction should be about 10 kcal mole-1 lower than the three-centered reaction.

  4. Oblate L = 1 bands in 194,196-201Pb, and 193Hg

    International Nuclear Information System (INIS)

    Reports of recent experiments have included observations of regular and irregular bands in neutron deficient Pb isotopes with A=194, 196--201. The bands are populated strongly in HI,xn reactions. The shared characteristics of the bands include: (1) Bandhead energies of few MeV; (2) High bandhead spin; (3) Large alignments; (4) Small dynamic moments of inertia, and (5) Strong L = 1 transitions and weaker L = 2 crossover transitions, with B(Ml/B(E2)) ∼ 20 μ2/e2b2. Lifetimes of band members in the 198Pb regular band are B(Ml) ∼ 1 W.u., and B(E2) ∼ 10 W.u. (with large errors). These observations are consistent with an interpretation of the regular structures as collective oblate bands with both proton and neutron excitations involved; the closed proton shell at Z = 82 is broken, and coupled to v(il3/2)-n excitations. The irregular structures may correspond to triaxial shapes, with similar orbits involved. A similar structure has been also found in 193Hg

  5. 193 nm Ultraviolet Photodissociation Mass Spectrometry for Phosphopeptide Characterization in the Positive and Negative Ion Modes.

    Science.gov (United States)

    Robinson, Michelle R; Taliaferro, Juliana M; Dalby, Kevin N; Brodbelt, Jennifer S

    2016-08-01

    Advances in liquid chromatography tandem mass spectrometry (LC-MS/MS) have permitted phosphoproteomic analysis on a grand scale, but ongoing challenges specifically associated with confident phosphate localization continue to motivate the development of new fragmentation techniques. In the present study, ultraviolet photodissociation (UVPD) at 193 nm is evaluated for the characterization of phosphopeptides in both positive and negative ion modes. Compared to the more standard higher energy collisional dissociation (HCD), UVPD provided more extensive fragmentation with improved phosphate retention on product ions. Negative mode UVPD showed particular merit for detecting and sequencing highly acidic phosphopeptides from alpha and beta casein, but was not as robust for larger scale analysis because of lower ionization efficiencies in the negative mode. HeLa and HCC70 cell lysates were analyzed by both UVPD and HCD. While HCD identified more phosphopeptides and proteins compared to UVPD, the unique matches from UVPD analysis could be combined with the HCD data set to improve the overall depth of coverage compared to either method alone. PMID:27425180

  6. Photolysis of pure solid O3 and O2 films at 193 nm

    CERN Document Server

    Raut, U; Famá, M; Baragiola, R A

    2010-01-01

    We studied quantitatively the photochemistry of solid O3 and O2 films at 193 nm and 22 K with infrared spectroscopy and microgravimetry. Photolysis of pure ozone destroyed O3, but a small amount of ozone remained in the film at high fluence. Photolysis of pure O2 produced O3 in an amount that increased with photon fluence to a stationary level. For both O2 and O3 films, the O3:O2 ratio at saturation is 0.03, nearly 10-30 times larger than those obtained in gas phase photolysis. This enhancement is attributed to the increased photodissociation of O2 due to photoabsorption by O2 dimers, a process significant at solid state densities. We obtain initial quantum yield for ozone synthesis from solid oxygen, {\\Phi} (O3) = 0.18 and for destruction of ozone and oxygen in their parent solids, {\\Phi} (- O3) = 1.7 and {\\Phi} (-O2) = 0.28. Combined with known photoabsorption cross sections, we estimate probabilities for germinate recombination of 0.15 for O3 fragments and 0.90 for oxygen atoms from O2 dissociation. Using ...

  7. Photoacoustic injury and bone healing following 193nm excimer laser ablation.

    Science.gov (United States)

    Lustmann, J; Ulmansky, M; Fuxbrunner, A; Lewis, A

    1992-01-01

    The argon-fluoride excimer laser was investigated as a cutting-ablating tool for bone surgery. A total of 52 rats were divided into two experimental groups and two control groups. In one experimental group cortical bone defects were made; in another experimental group defects penetrating into the medullary space were performed. In the two control groups similar defects were achieved using water-cooled carbide burs. The rats were sacrificed on each of the 3, 7, 10, 20, 30, and 40 postoperative day. The cortical bone, the medullary space, and the extrabony tissue were examined by means of light microscopy. In both experimental groups, bone damage, represented by osteocyte destruction, extended to 1,050-1,450 microns ahead from the irradiated site, and bone healing was very much impaired. In the control groups no histological changes could be identified and bone healing appeared to be within normal limits. We believe this extensive bone damage, following 193 nm irradiation, to be a result of photoacoustic waves propagating in the bone following each pulse. In view of our results we feel that excimer lasers presently in use are not suitable for bone surgery. This problem of photoacoustic damage can be overcome in one of two ways: by designing a CW excimer laser or by reducing the pulse width to the picosecond regime. PMID:1495367

  8. OH formation dynamics in 193 nm photolysis of 2-methoxyethanol: A laser induced fluorescence study

    Energy Technology Data Exchange (ETDEWEB)

    SenGupta, Sumana; Upadhyaya, Hari P., E-mail: haripu@barc.gov.in; Kumar, Awadhesh; Naik, Prakash D.

    2014-10-31

    Highlights: • First results on dynamics of OH radical formation in the photodissociation of 2-methoxyethanol. • At least three types of mechanisms for OH radical formation is reported. • Dissociation from excited as well ground state, supported by theoretical calculation. • Effect of hydrogen bonding in the photodissociation process is reported. - Abstract: Dynamics of OH radical formation in the 193 nm photolysis of 2-methoxyethanol is studied using Laser Photolysis–Laser Induced Fluorescence technique. The nascent state distribution of the OH radical is measured. The OH fragments are formed vibrationally cold, characterized by a Boltzmann-like single rotational temperature of 450 ± 100 K. The spin–orbit and Λ-doublet ratios of OH fragments are measured. The relative average translational energy of the OH channel is determined to be 17.0 ± 3.0 kcal/mol. The experimental studies along with theoretical calculations suggest a complex mechanism for OH formation consisting of at least three pathways. The prominent pathway at shorter timescale (<50 ns) involves crossing over to the nearby repulsive state, whereas, at longer timescale (>1 ms) involves a series of reaction with initial H{sub 3}C–OCH{sub 2}CH{sub 2}OH bond cleavage, followed by rearrangement of {sup ·}OCH{sub 2}CH{sub 2}OH to {sup ·}CH{sub 2}OCH{sub 2}OH, and a final concerted step to generate OH and ethylene epoxide.

  9. A medium-resolution monochromator for 73 keV x-rays - Nuclear resonant scattering of synchrotron radiation from 193-Ir

    CERN Document Server

    Alexeev, Pavel; Wille, Hans-Christian; Sergeev, Ilya; Herlitschke, Marcus; Leupold, Olaf; McMorrow, Desmond F; Röhlsberger, Ralf

    2016-01-01

    We report on the development and characterization of a medium resolution monochromator for synchrotron-based hyperfine spectroscopy at the 73 keV nuclear resonance of 193-Ir. The device provides high throughput of 6*10^8 ph/s in an energy bandwidth of 300(20) meV. We excited the nuclear resonance in 193-Ir at 73.04 keV and observed nuclear fluorescence of 193-Ir in Iridium metal. The monochromator allows for Nuclear Forward Scattering spectroscopy on Ir and its compounds.

  10. Improving vacuum-UV (VUV) photolysis of organic compounds in water with a phosphor converted xenon excimer lamp emitting at 193 nm.

    Science.gov (United States)

    Schulze-Hennings, U; Pötschke, L; Wietor, C; Bringmann, S; Braun, N; Hayashi, D; Linnemann, V; Pinnekamp, J

    2016-01-01

    A novel vacuum ultraviolet excimer lamp emitting light at 193 nm was used to investigate the degradation of organic micropollutants in ultrapure water and wastewater treatment plant (WWTP) effluent. Overall, light at 193 nm proved to be efficient to degrade the investigated micropollutants (diclofenac, diatrizoic acid, sulfamethoxazole). Experiments with WWTP effluent proved the ability of radiation at 193 nm to degrade micropollutants which are hardly removed with commonly used oxidation technologies like ozonation (diatrizoic acid, ethylenediaminetetraacetic acid, perfluorooctanoic acid, and perfluorooctanesulfonic acid). PMID:27533863

  11. Molecular gas heating mechanisms, and star formation feedback in merger/starbursts: NGC 6240 and Arp 193 as case studies

    International Nuclear Information System (INIS)

    We used the SPIRE/FTS instrument aboard the Herschel Space Observatory to obtain the Spectral Line Energy Distributions (SLEDs) of CO from J = 4-3 to J = 13-12 of Arp 193 and NGC 6240, two classical merger/starbursts selected from our molecular line survey of local Luminous Infrared Galaxies (L IR ≥ 1011 L ☉). The high-J CO SLEDs are then combined with ground-based low-J CO, 13CO, HCN, HCO+, CS line data and used to probe the thermal and dynamical states of their large molecular gas reservoirs. We find the two CO SLEDs strongly diverging from J = 4-3 onward, with NGC 6240 having a much higher CO line excitation than Arp 193, despite their similar low-J CO SLEDs and L FIR/L CO, 1 –0, L HCN/L CO (J = 1-0) ratios (proxies of star formation efficiency and dense gas mass fraction). In Arp 193, one of the three most extreme starbursts in the local universe, the molecular SLEDs indicate a small amount (∼5%-15%) of dense gas (n ≥ 104 cm–3) unlike NGC 6240 where most of the molecular gas (∼60%-70%) is dense (n ∼ (104-105) cm–3). Strong star-formation feedback can drive this disparity in their dense gas mass fractions, and also induce extreme thermal and dynamical states for the molecular gas. In NGC 6240, and to a lesser degree in Arp 193, we find large molecular gas masses whose thermal states cannot be maintained by FUV photons from Photon-Dominated Regions. We argue that this may happen often in metal-rich merger/starbursts, strongly altering the initial conditions of star formation. ALMA can now directly probe these conditions across cosmic epoch, and even probe their deeply dust-enshrouded outcome, the stellar initial mass function averaged over galactic evolution.

  12. INTERACTION OF LASER RADIATION WITH MATTER: Rearrangement of a phosphosilicate glass network induced by the 193-nm radiation

    Science.gov (United States)

    Larionov, Yu V.; Sokolov, V. O.; Plotnichenko, V. G.

    2008-10-01

    The IR absorption and Raman spectra of phosphosilicate glass (PSG) are measured during its exposure to radiation at a wavelength of 193 nm. The obtained data demonstrate the complicated rearrangement dynamics of the glass network around phosphor atoms and of the glass network as a whole. The experimental dependences are explained by the model of the PSG network based on the concepts of the theory of rigidity percolation.

  13. Development of high coherence, 200mW, 193nm solid-state laser at 6 kHz

    Science.gov (United States)

    Nakazato, T.; Tsuboi, M.; Onose, T.; Tanaka, Y.; Sarukura, N.; Ito, S.; Kakizaki, K.; Watanabe, S.

    2015-02-01

    The high coherent, high power 193-nm ArF lasers are useful for interference lithography and microprosessing applications. In order to achieve high coherence ArF lasers, we have been developing a high coherence 193 nm solid state laser for the seeding to a high power ArF laser. We used the sum frequency mixing of the fourth harmonic (FH) of a 904-nm Ti:sapphire laser with a Nd:YVO4 laser (1342 nm) to generate 193-nm light. The laser system consists of a single-mode Ti:sapphire oscillator seeded by a 904-nm external cavity laser diode, a Pockels cell, a 6-pass amplifier, a 4-pass amplifier, a 2-pass amplifier and a wavelength conversion stage. The required repetition rate of 6 kHz corresponding to the ArF laser, along with a low gain at 904 nm induces serious thermal lens effects; extremely short focal lengths of the order of cm and bi-foci in the vertical and horizontal directions. From the analysis of thermal lens depending on pump intensity, we successfully compensated the thermal lens by dividing a 527-nm pump power with 15, 25 and 28 W to 3-stage amplifiers with even passes, resulting in the output power above 10W with a nearly diffraction limited beam. This 904-nm output was converted to 3.8 W in the second harmonic by LBO, 0.5 W in FH by BBO sequentially. Finally the output power of 230 mW was obtained at 193 nm by mixing the FH with a 1342-nm light in CLBO.

  14. CFTR suppresses tumor progression through miR-193b targeting urokinase plasminogen activator (uPA) in prostate cancer.

    Science.gov (United States)

    Xie, C; Jiang, X H; Zhang, J T; Sun, T T; Dong, J D; Sanders, A J; Diao, R Y; Wang, Y; Fok, K L; Tsang, L L; Yu, M K; Zhang, X H; Chung, Y W; Ye, L; Zhao, M Y; Guo, J H; Xiao, Z J; Lan, H Y; Ng, C F; Lau, K M; Cai, Z M; Jiang, W G; Chan, H C

    2013-05-01

    Cystic fibrosis (CF) transmembrane conductance regulator (CFTR) is expressed in the epithelial cells of a wide range of organs/tissues from which most cancers are derived. Although accumulating reports have indicated the association of cancer incidence with genetic variations in CFTR gene, the exact role of CFTR in cancer development and the possible underlying mechanism have not been elucidated. Here, we report that CFTR expression is significantly decreased in both prostate cancer cell lines and human prostate cancer tissue samples. Overexpression of CFTR in prostate cancer cell lines suppresses tumor progression (cell growth, adhesion and migration), whereas knockdown of CFTR leads to enhanced malignancies both in vitro and in vivo. In addition, we demonstrate that CFTR knockdown-enhanced cell proliferation, cell invasion and migration are significantly reversed by antibodies against either urokinase plasminogen activator (uPA) or uPA receptor (uPAR), which are known to be involved in various malignant traits of cancer development. More interestingly, overexpression of CFTR suppresses uPA by upregulating the recently described tumor suppressor microRNA-193b (miR-193b), and overexpression of pre-miR-193b significantly reverses CFTR knockdown-enhanced malignant phenotype and abrogates elevated uPA activity in prostate cancer cell line. Finally, we show that CFTR gene transfer results in significant tumor repression in prostate cancer xenografts in vivo. Taken together, the present study has demonstrated a previously undefined tumor-suppressing role of CFTR and its involvement in regulation of miR-193b in prostate cancer development. PMID:22797075

  15. The ground and excited state potential energy surfaces of nitromethane related to its dissociation dynamics after excitation at 193 nm

    International Nuclear Information System (INIS)

    The relevant low-lying singlet and triplet potential energy surfaces in the photolysis of nitromethane have been studied by using the multistate extension of the multiconfigurational second-order perturbation theory in conjunction with large atomic natural orbital-type basis sets. The proposed mechanism for the photolytic decomposition of CH3NO2 provides a consistent and reinterpreted picture of the available experimental results. Two reaction paths are found in the photolysis of nitromethane after excitation at 193 nm: (1) Major Channel, CH3NO2(1A')+hν(193 nm)→CH3NO2(2A'')→(lim(lu-tag)lu-tag(bu(IC))))CH3NO2(2A')→CH3(1A1')+NO2(1 2B1)→(lim(lu-tag(-hν')lu-tag(bu(IC))))CH3(1A1')+NO2(1 2A1)→(lim(lu-tag(193 nm)lu-tag(bu(hν))))CH3(1A1')+NO(A 2Σ+)+αO(3P)+βO(1D). (2) Minor Channel, CH3NO2(1A')+hν(193 nm)→CH3NO2(2A'')→CH3(1A1')+NO2(1 2A2)→CH3(1A1')+NO(X 2Π)+αO(3P)+βO(1D), being α and β fractional numbers. No ionic species are found in any dissociation path. Additionally, the respective low-lying Rydberg states of nitromethane and nitrogen dioxide have been studied too.

  16. Generation of intense 10-ps, 193-nm pulses using simple distributed feedback dye lasers and an ArF(*) amplifier.

    Science.gov (United States)

    Hatten, D L; Cui, Y; Iii, W T; Mikes, T; Goldhar, J

    1992-11-20

    A pair of holographic distributed feedback dye lasers is used to generate 10-ps pulses at two selected wavelengths that are mixed in a BBO crystal to produce a pulse ~ 10 ps in duration at 193 nm. This seed pulse is subsequently amplified in an ArF(*) excimer laser to an energy of 10-15 mJ with <40 microJ in amplified spontaneous emission. The pulses are nearly transform limited and diffraction limited. PMID:20802565

  17. Photolysis of Pure Solid O3 and O2 Films at 193nm

    Science.gov (United States)

    Raut, U.; Loeffler, M. J.; Fama, M.; Baragiola, R. A.

    2011-01-01

    We studied quantitatively the photochemistry of solid O3 and O2 films at 193 nm and 22 K with infrared spectroscopy and microgravimetry. Photolysis of pure ozone destroyed O3, but a small amount of ozone remained in the film at high fluence. Photolysis of pure O2 produced O3 in an amount that increased with photon fluence to a stationary level. For both O2 and O3 films, the O3:O2 ratio at large fluences is ?0.07, about two orders of magnitude larger than those obtained in gas phase photolysis. This enhancement is attributed to the increased photodissociation of O2 due to photoabsorption by O2 dimers, a process significant at solid-state densities. We obtain initial quantum yield for ozone synthesis from solid oxygen, phi (O3) = 0.24 0.06, and quantum yields for destruction of O3 and O2 in their parent solids, phi(-O3) = 1.0 0.2 and phi(-O2) = 0.36 0.1. Combined with known photoabsorption cross sections, we estimate probabilities for geminate recombination of 0.5 0.1 for O3 fragments and 0.88 0.03 for oxygen atoms from O2 dissociation. Using a single parameter kinetic model, we deduce the ratio of reaction cross sections for an O atom with O2 vs. O3 to be 0.1 0.2. The general good agreement of the model with the data suggests the validity of the central assumption of efficient energy and spin relaxation of photofragments in the solid prior to their reactions with other species.

  18. New insights into the photodissociation of methyl iodide at 193 nm: stereodynamics and product branching ratios.

    Science.gov (United States)

    Marggi Poullain, Sonia; González, Marta G; Samartzis, Peter C; Kitsopoulos, Theofanis N; Rubio-Lago, Luis; Bañares, Luis

    2015-11-28

    The stereodynamics of methyl iodide photodissociation after excitation at 193 nm has been studied using a combination of slice imaging and resonance enhanced multiphoton ionization (REMPI) detection of the methyl and iodine products. A weak anisotropic ring appearing in the image corresponding to vibrationally excited CH3(ν1 = 1) confirms the production of ground state I((2)P3/2) atoms at this excitation wavelength as a signature of the predissociation channel reported previously [M. G. González et al., J. Chem. Phys., 2011, 135, 021102] tentatively assigned to the coupling between the B-band (3)R1 Rydberg state and the A-band (1)Q1 repulsive state. Direct REMPI detection of ground state iodine atoms indicates that most of the I((2)P3/2) species are produced in correlation with highly internally excited methyl radicals, in excellent agreement with the recent results of Xu and Pratt [Xu et al., J. Chem. Phys., 2013, 139, 214310; Xu et al., J. Phys. Chem. A, 2015, 119, 7548]. From the comparison between the CH3(ν) second order Dixon's bipolar moments β(2)(0)(20), β(0)(0)(22), β(2)(0)(02) and β(2)(0)(22) measured in this work and those reported previously for the B-band origin and the A-band, a general picture of the CH3I photodissociation stereodynamics in terms of different effects, such as the breakdown of the unique recoil direction (URD) approximation, the non-adiabatic curve crossings and the depolarization induced by the parent molecule rotation, is drawn. PMID:26489797

  19. Breast ultrasound elastography-Results of 193 breast lesions in a prospective study with histopathologic correlation

    International Nuclear Information System (INIS)

    Purpose: To evaluate the diagnostic performance of ultrasound elastography in breast masses. Material and methods: 193 lesions (129 benign, 64 malignant) were analyzed with the EUB 8500 Logos-ultrasonic-unit (Hitachi Medical, Japan) and a linear-array-transducer of 7.5-13-MHz. Standard of reference was cytology (FNAfine needle aspiration) or histology (core biopsy). The elastic-score was classified according to a 6-point colour-scale (Ueno classification; 1-3 = benign, 4-5 = malignant). Conventional B-mode ultrasound (US) findings were classified according to the BI-RADS classification. Statistical analysis included sensitivity, specificity, ROC-analysis and kappa-values for intra-/interobserver reliability. Results: The mean score for elasticity was 4.1 ± 0.9 for malignant lesions, and 2.1 ± 1.0 for benign lesions (p < 0.001). With a best cut-off point between elasticity scores 3 and 4, sensitivity was 96.9%, and specificity 76%. Setting a best cut-off point for conventional US between BI-RADS 4 and 5, sensitivity was 57.8%, and specificity 96.1%. Elastography provided higher sensitivity and lower specificity than conventional US, but two lesions with elasticity score 1 were false negative, whereas no lesion scored BI-RADS 1-3 were false negative. ROC-curve was 0.884 for elastography, and 0.820 for conventional US (p < 0.001). Weighted kappa-values for intra-/interobserver reliability were 0.784/0.634 for BI-RADS classification, and 0.720/0.561 for elasticity scores. Conclusion: In our study setting, elastography does not have the potential to replace conventional B-mode US for the detection of breast cancer, but may complement conventional US to improve the diagnostic performance.

  20. Biological responses on NIH 3T3 to 193 NM excimer laser irradiation comparison with 254 irradiation

    International Nuclear Information System (INIS)

    During conventional UV radiations, activation of genes is tightly linked to the presence of DNA damages. At 254 nm, the major cellular chromophore is the nuclear DNA, with cyclobutane pyrimidine dimers being the major photoproduct. At 193 nm, DNA is more strongly absorbing than at 254 nm. However, the quantum yields of the photoproducts induced at these two wavelengths are different and damage to cellular DNA in the form of pyrimidine dimers or single-strand breaks was reported to be only marginal or undetected. Peptide bonds, many amino acid side chains, insaturated lipids, esters, and other cellular molecules absorb at 193 nm. Consequently, the most of the energy is thought to be absorbed by proteins, leaving the DNA shielded. About 60 % of the radiation can apparently be blocked by 1 μm of cytoplasm. However, exposures of cultured human fibroblasts to subablative doses of 193 nm laser radiation resulted in changes of genes expression such as collagenase, metallothionein and c-fos. The mechanisms by which the 193 nm radiation affects gene expression are not known. The site of primary interaction of the radiation could be different from the site of the genetic response. Thus, the signal transfer could pass through the cytoplasm via the nucleus. One hypothesis is that cytokines may regulate the transduction pathway event. By example, the TNF-alpha which is induced by UV-radiations. More, it can activate transcription factors such as AP-1 or c-fos and stimulate the growth of normal fibroblasts. Moreover, TNF-alpha plays a major role in the inflammatory processes by enhancing the remodeling of extracellular matrix in which mainly matrix metalloproteinases and collagenase participate. Besides, matrix metalloproteinases are responsive to cytokines and particularly the 92 kDa gelatinate (gelatinase B or metalloproteinase 9 or MMP 9) is induced and regulated by TNF-alpha. To understand the cellular response to high energy laser radiation, we investigated cell

  1. Kindlin-2 phosphorylation by Src at Y193 enhances Src activity and is involved in Migfilin recruitment to the focal adhesions.

    Science.gov (United States)

    Liu, Zhaoli; Lu, Danyu; Wang, Xiang; Wan, Junhu; Liu, Chang; Zhang, Hongquan

    2015-07-01

    Kindlin-2 regulates external to internal cell signaling by interaction with integrins in a process that involves the tyrosine kinase, Src. However, the underlying mechanisms remain elusive. Here we report that Src binds to and phosphorylates Kindlin-2 at Y193. Reciprocally, Kindlin-2-Y193 phosphorylation activates and maintains Src kinase activity. Kindlin-2-Y193 phosphorylation is also involved in its binding capacity with Migfilin and the recruitment of Migfilin to the focal adhesions. Functionally, we demonstrate that Kindlin-2-Y193 phosphorylation regulates Kindlin-2-mediated cell spreading and migration. These findings suggest that Src, Kindlin-2 and Migfilin together constitute a positive feedback loop that controls Src activity and regulates integrin-mediated cellular functions. PMID:26037143

  2. Long noncoding RNA MIR31HG exhibits oncogenic property in pancreatic ductal adenocarcinoma and is negatively regulated by miR-193b.

    Science.gov (United States)

    Yang, H; Liu, P; Zhang, J; Peng, X; Lu, Z; Yu, S; Meng, Y; Tong, W-M; Chen, J

    2016-07-14

    Long noncoding RNAs (lncRNAs) play important regulatory roles in a variety of diseases, including many tumors. However, the functional roles of these transcripts and mechanisms responsible for their deregulation in pancreatic ductal adenocarcinoma (PDAC) are not thoroughly understood. In this study, we discovered that lncRNA MIR31HG is markedly upregulated in PDAC. Knockdown of MIR31HG significantly suppressed PDAC cell growth, induced apoptosis and G1/S arrest, and inhibited invasion, whereas enhanced expression of MIR31HG had the opposite effects. Online database analysis tools showed that miR-193b could target MIR31HG and we found an inverse correlation between MIR31HG and miR-193b in PDAC specimens. Inhibition of miR-193b expression significantly upregulated the MIR31HG level, while overexpression of miR-193b suppressed MIR31HG's expression and function, suggesting that MIR31HG is negatively regulated by miR-193b. Moreover, using luciferase reporter and RIP assays, we provide evidence that miR-193b directly targeted MIR31HG by binding to two microRNA binding sites in the MIR31HG sequence. On the other hand, MIR31HG may act as an endogenous 'sponge' by competing for miR-193b binding to regulate the miRNA targets. Collectively, these results demonstrate that MIR31HG functions as an oncogenic lncRNA that promotes tumor progression, and miR-193b targets not only protein-coding genes but also the lncRNA, MIR31HG. PMID:26549028

  3. Strangeness production in Ni+Ni collisions at 1.93 AGeV

    International Nuclear Information System (INIS)

    This work deals with the production of strange particles in Ni + Ni collisions at 1.93 A GeV detected with the Fopi (four pi) detector at the heavy ion synchrotron SIS (GSI - Germany). We have limited our investigation to the study of Λ and Ξ hyperons. The first chapter presents the models used to describe ultra-relativistic heavy ions collisions. In the second chapter we present the main experimental results concerning the production and transport of strange particles in an energy domain ranging from SIS to RHIC (relativistic heavy ion collider) energies. The third chapter is dedicated to the specificities of the Fopi detector. The fourth chapter deals with the production of Λ particles in Ni + Ni collisions. An analysis method based on neuron network has been used in parallel with a more classical method. The production rate and temperature of Λ have been deduced from both methods. The neuron network method gives a statistical gain and allows a better identification of particles with low transverse impulses. The fifth chapter is dedicated to the detection of the doubly strange Ξ- particle. A detailed study about the stability of the signal is presented. In the last chapter all our experimental results are confronted with theoretical predictions. The UrQMD model that uses a hard equation of state, can simulate satisfactorily the production rates of Λ and K+ as well as their dependency on collision centrality despite the fact that this model does not use a potential linked to the medium density. The comparison between experimental results and predictions given by the IQMD model (that is based on a soft equation of state) is better when the version of the model that does not take into account the effects of the media is used. We see that the choices for the nuclear matter compressibility, for the particles involved in Kaon and Λ creation process, or for the interaction potential with dense medium, appear to be degrees of freedom that are difficult to adjust

  4. Implementation of INFCIRC/193 and its additional protocol in the Slovak Republic

    International Nuclear Information System (INIS)

    requirements resulting from the Protocol. To enable the ratification of the Protocol Additional, first of all it was necessary to amend the Atomic Law and associated regulations. On 21 June 2004 the president of the Slovak Republic has signed the letter of accession of Slovakia to the safeguards agreement INFCIRC/193 including the relevant Additional Protocol. On 1 December 2005 this agreement entered into force. During the period between 1 May 2004 and 1 December 2005 the Slovak Republic had to report both to the IAEA (according INFCIRC/173) and to the European Commission (according to the Euratom Treaty and Regulation No. 302/2005). Starting from 1 December 2005 the UJD has begun with the implementation of INFCIRC/193 and its Protocol Additional. As an instrument supporting non-proliferation of nuclear weapons a control of export/import of nuclear material, nuclear related and dual-use material, equipment and technologies is being used. The government of the Slovak Republic like many other governments uses for this purpose licensing system. Basic principles for control of export/import of selected goods were defined in the Act No. 26/2002. The act clearly describes requirement of exporters/importers and also responsibility and powers of the regulator which is the Ministry of Economy of SR issuing license. In like manner as for safeguards, after accession to the EU, Regulation 1334/2000 setting up a Community regime for the control of exports of dual-use items and technology entered into force. The role of the UJD in the export/import control system is anchored in the Act No. 541/2004 Coll. The act gives the UJD power to issue permission for export/import of nuclear material, nuclear-related or dual-use material, equipment and technologies a list of which is included in Regulation 1334/2000. In issuing the permission the UJD strictly follows recommendations and requirements of the Regulation 1334/2000 and NSG guidelines published in the IAEA INFCIRC/254 and guidelines of the

  5. X-Ray Photoelectron Spectroscopy study for far UV-Excimer laser (λ = 193nm) surface modifications of polyethylene terephtalate

    International Nuclear Information System (INIS)

    We have studied by X-Ray Photoelectron Spectroscopy (XPS), the surface of Polyethylene Terephtalate treated by pulsed far Ultra Violet (UV) radiation delivered by an Excimer laser (λ = 193nm). Treatments were carried out under different gaseous atmospheres to discriminate the mechanisms leading to the modifications of the polymer surface. In particular, a pronounced deoxidation due to the loss of CO and CO2 is observed below the ablation threshold. Furthermore, treatments under oxygen and nitrogen atmospheres reveal the opportunity of grafting new functionalities at the polymer surfaces. (author). 13 refs, 4 figs, 3 tabs

  6. Statistical Examination of the a and a + 1 Fragment Ions from 193 nm Ultraviolet Photodissociation Reveals Local Hydrogen Bonding Interactions

    Science.gov (United States)

    Morrison, Lindsay J.; Rosenberg, Jake A.; Singleton, Jonathan P.; Brodbelt, Jennifer S.

    2016-05-01

    Dissociation of proteins and peptides by 193 nm ultraviolet photodissociation (UVPD) has gained momentum in proteomic studies because of the diversity of backbone fragments that are produced and subsequent unrivaled sequence coverage obtained by the approach. The pathways that form the basis for the production of particular ion types are not completely understood. In this study, a statistical approach is used to probe hydrogen atom elimination from a + 1 radical ions, and different extents of elimination are found to vary as a function of the identity of the C-terminal residue of the a product ions and the presence or absence of hydrogen bonds to the cleaved residue.

  7. Study of effects of sidewall angle on process window using 193nm CPL masks in a 300mm wafer manufacturing environment

    Science.gov (United States)

    Cheng, Yung Feng; Chou, Yueh Lin; Lin, C. L.; Huang, Peter

    2005-11-01

    As semiconductor process technology moves down below 90nm and 65nm, more and more wafer fabs are starting to apply 193nm CPL (Chromeless Phase Lithography) technology as the main lithography strategy for their most critical layers. However the 3D pattern profile is another critical factor, which affects image intensity and final process window. Since 193nm CPL is a relatively new technology in the semiconductor industry, it is important for us to understand the key mask specifications of 193nm CPL and their impact on wafer-level imaging. In this paper, we will study the effects of sidewall angle on process window and wafer CD using 193nm CPL masks in a 300mm wafer manufacturing environment. We begin our experiment by making several special 193nm CPL masks. These masks have been specially designed with different sidewall angles (SWA) with phase of 180 degrees. The sidewall angle spread represents approximately 10 degrees. We use specially designed test patterns that are compatible at the 65nm technology node. In our experiment, we first study the correlation between AFM (atomic force microscope)-determined profile angle and lithographic process behavior. In addition, simulation was also used to predict the impact of 3D profile on process performance. All lithographic experiments were performed on 300mm wafers using a high NA ASML 193nm scanner and high contrast resist. In this study, we have focused on the impact of sidewall angle on wafer process performance by comparing the wafer CD and pattern profile through focus. In order to establish more effective specifications of angle control in 193nm CPL between mask shop and wafer fabs, all AFM, wafer CD, and simulation results will be compared and correlated.

  8. MicroRNA-193a-3p Reduces Intestinal Inflammation in Response to Microbiota via Down-regulation of Colonic PepT1.

    Science.gov (United States)

    Dai, Xin; Chen, Xi; Chen, Qun; Shi, Lei; Liang, Hongwei; Zhou, Zhen; Liu, Qian; Pang, Wenjing; Hou, Dongxia; Wang, Cheng; Zen, Ke; Yuan, Yaozong; Zhang, Chen-Yu; Xia, Lu

    2015-06-26

    Intestinal inflammation is characterized by epithelial disruption, leading to the loss of barrier function, recruitment of immune cells, and host immune responses to gut microbiota. PepT1, a di/tripeptide transporter that uptakes bacterial products, is up-regulated in inflamed colon tissue, which implies its role in bacterium-associated intestinal inflammation. Although microRNA (miRNA)-mediated gene regulation has been found to be involved in various processes of inflammatory bowel disease (IBD), the biological function of miRNAs in the pathogenesis of IBD remains to be explored. In this study we detected miRNA expression patterns in colon tissues during colitis and investigated the mechanism underlying the regulation of colonic PepT1 by miRNAs. We observed an inverse correlation between PepT1 and miR-193a-3p in inflamed colon tissues with active ulcerative colitis, and we further demonstrated that miR-193a-3p reduced PepT1 expression and activity as a target gene and subsequently suppressed the NF-κB pathway. Intracolonic delivery of miR-193a-3p significantly ameliorated dextran sodium sulfate-induced colitis, whereas the overexpression of colonic PepT1 via PepT1 3'-untranslated region mutant lentivirus vector abolished the anti-inflammatory effect of miR-193a-3p. Furthermore, antibiotic treatment eliminated the difference in the dextran sodium sulfate-induced inflammation between the presence and absence of miR-193a-3p. These findings suggest that miR-193a-3p regulation of PepT1 mediates the uptake of bacterial products and is a potent mechanism during the colonic inflammation process. Overall, we believe miR-193a-3p may be a potent regulator of colonic PepT1 for maintaining intestinal homeostasis. PMID:25931122

  9. A study on effect of point-of-use filters on defect reduction for advanced 193nm processes

    Science.gov (United States)

    Vitorino, Nelson; Wolfer, Elizabeth; Cao, Yi; Lee, DongKwan; Wu, Aiwen

    2009-03-01

    Bottom Anti-Reflective Coatings (BARCs) have been widely used in the lithography process for decades. BARCs play important roles in controlling reflections and therefore improving swing ratios, CD variations, reflective notching, and standing waves. The implementation of BARC processes in 193nm dry and immersion lithography has been accompanied by defect reduction challenges on fine patterns. Point-of-Use filters are well known among the most critical components on a track tool ensuring low wafer defects by providing particle-free coatings on wafers. The filters must have very good particle retention to remove defect-causing particulate and gels while not altering the delicate chemical formulation of photochemical materials. This paper describes a comparative study of the efficiency and performance of various Point-of-Use filters in reducing defects observed in BARC materials. Multiple filter types with a variety of pore sizes, membrane materials, and filter designs were installed on an Entegris Intelligent(R) Mini dispense pump which is integrated in the coating module of a clean track. An AZ(R) 193nm organic BARC material was spin-coated on wafers through various filter media. Lithographic performance of filtered BARCs was examined and wafer defect analysis was performed. By this study, the effect of filter properties on BARC process related defects can be learned and optimum filter media and design can be selected for BARC material to yield the lowest defects on a coated wafer.

  10. Effect of excimer laser (Arf, 193 nm) on aqueous humor during photorefractive keratectomy biophysical and biochemical study

    International Nuclear Information System (INIS)

    Ultraviolet light (193 nm) produced by an excimer laser has been used to produce precise tissue ablation with minimal thermal damage to adjacent tissue. The present study was designed to investigate the effect of excimer laser during photo refractive keratectomy (PRK) on aqueous humor constituents and also the effect of antioxidant enzyme superoxide dismutase (SOD)- applied topically- on these changes if exist. Five groups of schenchilla rabbits were involved in this study, where four groups underwent corneal stromal ablation using argon fluoride excimer laser (Ar F, 193 nm). Two of these four groups were treated with superoxide dismutase intra operatively. The fifth group was used as control one. The obtained results revealed depletion of aqueous humor ascorbate and glutathione contents. Aqueous humor refractive index, cholesterol, phospholipids, malondialdehyde (MDA) and total protein were measured. In conclusion, the excimer laser can induce changes in aqueous humor constituents during PRK. These changes lasted at least for 24 hours and as the time increased to 4 weeks, these changes became limited. The use of exogenous SOD seems to exert beneficial effect on aqueous humor refractive index and total protein

  11. Pulsed transfer etching of PS-PDMS block copolymers self-assembled in 193 nm lithography stacks.

    Science.gov (United States)

    Girardot, Cécile; Böhme, Sophie; Archambault, Sophie; Salaün, Mathieu; Latu-Romain, Eddy; Cunge, Gilles; Joubert, Olivier; Zelsmann, Marc

    2014-09-24

    This work presents the graphoepitaxy of high-χ block copolymers (BCP) in standard industry-like lithography stacks and their transfer into the silicon substrate The process includes conventional 193 nm photolithography, directed self-assembly of polystyrene-block-polydimethylsiloxane (PS-b-PDMS) and pulsed plasma etching to transfer the obtained features into the substrate. PS-b-PDMS has a high Flory-Huggins interaction parameter (high-χ) and is capable of achieving sub-10 nm feature sizes. The photolithography stack is fabricated on 300 mm diameter silicon wafers and is composed of three layers: spin-on-carbon (SoC), silicon-containing anti-reflective coating (SiARC) and 193 nm photolithography resist. Sixty-nanometer-deep trenches are first patterned by plasma etching in the SiARC/SoC stack using the resist mask. The PS-b-PDMS is then spread on the substrate surface. Directed self-assembly (DSA) of the BCP is induced by a solvent vapor annealing process and PDMS cylinders parallel to the substrate surface are obtained. The surface chemistry based on SoC permits an efficient etching process into the underlying silicon substrate. The etching process is performed under dedicated pulsed plasma etching conditions. Fifteen nanometer half-pitch dense line/space features are obtained with a height up to 90 nm. PMID:25111901

  12. 300-mW narrow-linewidth deep-ultraviolet light generation at 193 nm by frequency mixing between Yb-hybrid and Er-fiber lasers.

    Science.gov (United States)

    Xuan, Hongwen; Zhao, Zhigang; Igarashi, Hironori; Ito, Shinji; Kakizaki, Kouji; Kobayashi, Yohei

    2015-04-20

    A narrow-linewidth, high average power deep-ultraviolet (DUV) coherent laser emitting at 193 nm is demonstrated by frequency mixing a Yb-hybrid laser with an Er-fiber laser. The Yb-hybrid laser consists of Yb-fiber lasers and an Yb:YAG amplifier. The average output power of the 193 nm laser is 310 mW at 6 kHz, which corresponds to a pulse energy of 51 μJ. To the best of our knowledge, this is the highest average power and pulse energy ever reported for a narrow-linewidth 193 nm light generated by a combination of solid-state and fiber lasers with frequency mixing. We believe this laser will be beneficial for the application of interference lithography by seeding an injection-locking ArF eximer laser. PMID:25969096

  13. The effect of acute Lithium and AMI-193, a new 5HT2 antagonist, on Apomorphine-induced pecking in pigeon

    OpenAIRE

    Bagheri T; Ejtemaei Mehr Sh; Shamshirgaran Sh

    2002-01-01

    Intramascular (IM) administration of apomorphine (a mixed D1/D2 dopamine receptors agonist 0.2-1.6 mg/kg) induced pecking, a stereotype behavior in pigeons in a dose- dependent manner. In this study the effect of lithium (Li+, 240 mg/kg, IM) and AMI-193 (a new 5-HT2 antagonist, 0.003 mg/pigeon) on apomorphine-induced peking (AIP) were investigated. This study showed that Li+ and AMI-193 did not induce pecking by itself but administration of each of these agents before apomorphine increased an...

  14. Moessbauer effect of 197Au, 99Ru, 193Ir, 195Pt, and 151Eu diluted in hydrogenated palladium

    International Nuclear Information System (INIS)

    The study of hidrogenation in transition metals by Moessbauer spectroscopy of 197Au, 99Ru, 195Pt, 193Ir and 151Eu diluted in palladium is presented. The measured parameters in the Moessbauer effect are sensitive to hydrogenation and allow to obtain information about phases of hydrogened systems, modifications of electronic structure and effects related to hydrogen mobility. The (Pd1-x Agx)0.99 Au0.01 was also investigated by 197Au Moessbauer effect. The relantioship between α and β phase Debye - Waller factors by Moessbauer effect was estimated. Source and absorber Moessbauer experiments to verifying isomer shift variation in function of hydrogen concentration were done. A proposal for description of the isomer shift of transition (or rare) impurities in transition matrices from state density of each system is presented. The contribution of H+ ions bound to IS is discussed qualitatively. (M.C.K.)

  15. Long-lived three-quasiparticle isomers in {sup 191}Ir and {sup 193}Ir with triaxial deformation

    Energy Technology Data Exchange (ETDEWEB)

    Dracoulis, G.D., E-mail: george.dracoulis@anu.edu.au [Department of Nuclear Physics, R.S.P.E., Australian National University, Canberra, A.C.T. 0200 (Australia); Lane, G.J.; Byrne, A.P. [Department of Nuclear Physics, R.S.P.E., Australian National University, Canberra, A.C.T. 0200 (Australia); Watanabe, H. [Department of Nuclear Physics, R.S.P.E., Australian National University, Canberra, A.C.T. 0200 (Australia); RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Hughes, R.O.; Palalani, N. [Department of Nuclear Physics, R.S.P.E., Australian National University, Canberra, A.C.T. 0200 (Australia); Kondev, F.G. [Nuclear Engineering Division, Argonne National Laboratory, Argonne IL (United States); Carpenter, M.; Janssens, R.V.F.; Lauritsen, T.; Lister, C.J.; Seweryniak, D.; Zhu, S. [Physics Division, Argonne National Laboratory, Argonne IL (United States); Chowdhury, P. [Department of Physics, University of Massachusetts Lowell, Lowell, MA 01854 (United States); Shi, Y.; Xu, F.R. [School of Physics, Peking University, Beijing 100871 (China)

    2012-03-13

    Deep-inelastic reactions have been used to populate high-spin states in the iridium isotopes. New results include the identification of particularly long-lived three-quasiparticle isomers in {sup 191}Ir and {sup 193}Ir, with mean-lives of 8.2(7) s and 180(3) {mu}s respectively, decaying into newly identified states of the h{sub 11/2} proton bands and into other structures. Spins and parities of J{sup {pi}}=31/2{sup +} are suggested for both, consistent with coupling of the 11/2{sup -}[505] proton to the 10{sup -}two-neutron excitations in the cores. These and other configurations are discussed in the context of configuration constrained potential-energy-surface calculations. All calculated intrinsic states are expected to be associated with triaxial shapes and the extreme isomerism observed is attributed to spin-trapping rather than K-hindrance.

  16. Observation of high vibrational excitation in HCN molecules produced from 193 nm photolysis of 1,3,5-triazine

    International Nuclear Information System (INIS)

    Infrared emission from the ν2 bending mode and ν3 C--H stretching mode of HCN have been observed following 193 nm pulsed excimer laser photolysis of 1,3,5-triazine. Using a simple harmonic oscillator analysis, the number of ν2 bending quanta produced in HCN from photolysis of sym-triazine was found to be 70 times larger than the number of ν3 C--H stretching quanta. The combination of a high density of bending vibrational states in HCN and favorable geometry changes which occur in going from 1,3,5-triazine to three HCN molecules, appear to give an unusually pure distribution which maximizes vibrational energy in the HCN bending mode

  17. 3D microscopic imaging at 193nm with single beam Fresnel intensity sampling and iterative phase retrieval

    Science.gov (United States)

    Anand, Arun; Faridian, Ahmad; Chhaniwal, Vani K.; Pedrini, Giancarlo; Osten, Wolfgang; Javidi, Bahram

    2012-06-01

    3D imaging requires the retrieval of both amplitude and phase of the wavefront interacting with the object. Quantitative phase contrast imaging technique like digital holography uses the interference of object and a known reference wavefront for whole field reconstructions. And for higher lateral resolution, uses of shorter wavelengths become necessary. For short wavelength sources, due to short coherence lengths, it becomes very difficult to implement a two-beam interferometric setup. We have developed a technique for reconstructing the amplitude and phase of object wavefront from the volume diffraction field by sampling it at several axial positions and implementing the scalar diffraction integral iteratively. This technique is extended to 3D microscopic imaging at 193 nanometers.

  18. Shelf Edge Exchange Processes: 2, SEEP2-09, R/V ENDEAVOR cruise 193: Hydrographic data report

    Energy Technology Data Exchange (ETDEWEB)

    Behrens, W.J.; Wilson, C.; Flagg, C.N.; Wallace, D.W.R.; Wilke, R.J.; Wyman, K.D.

    1990-01-01

    The R/V ENDEAVOR cruise 193, SEEP2-09, took place from 17--23 March 1989 and focused primarily on biological processes in the SEEP2 area. Mooring 1 was recovered and re-deployed and a replacement for mooring 4 was deployed. A 24 hour time series was conducted at mooring 1 to study primary and secondary production. The time series involved sampling nutrients, dissolved oxygen, chlorophyll {und a}, zooplankton abundance and distribution and fecal pellet production. Experiments to estimate grazing rates the fecal pellet production of the dominant copepods were also done. MOCNESS tows and box core samples were also taken during the cruise. Sediment and zooplankton data are not reported here. During this cruise 46 CTD casts were made measuring pressure, temperature, conductivity, dissolved oxygen, fluorescence and light transmission. Discrete samples were taken in rosette-mounted Niskin bottles and analyzed for concentration of nutrients, chlorophyll {und a}, dissolved oxygen, and particulate organic carbon and nitrogen.

  19. Astatination of closo-dodecaborate(2-) anion

    Czech Academy of Sciences Publication Activity Database

    Orlova, A.; Lebeda, Ondřej; Tolmachev, V.; Lundquist, H.; Carlsson, J.; Sjöberg, S.

    Cambridge : The Royal Society of Chemistry , 2000 - (Davidson, M.; Hughes, A.; Marder, T.; Wade , K.), s. 144-147 [Conference "Contemporary Boron Chemistry ". Durham (GB), 11.07.1999-15.07.1999] Institutional research plan: CEZ:AV0Z1048901 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  20. Quantitative Proteomic Analysis of the Metastasis-Inhibitory Mechanism of miR-193a-3p in Non-Small Cell Lung Cancer

    Directory of Open Access Journals (Sweden)

    Wei Deng

    2015-03-01

    Full Text Available Background: microRNAs can repress the expression of target genes by destabilizing their mRNAs or by inhibiting their translation. Our previous findings suggested that miR-193a-3p inhibited the progression of NSCLC both in vitro and in vivo. However, the biological processes and molecular pathways through which this miRNA exerts its positive effects are unknown. Methods: To explore the molecular mechanisms by which miR-193a-3p inhibited NSCLC metastasis, we investigated the changes in the protein profile of SPC-A-1sci (highly metastatic cells in response to the up-regulation of miR-193a-3p expression using a proteomics approach (iTRAQ combined with NanoLC-MS/MS. Changes in the profiles of the expressed proteins were verified using western blotting and were analyzed using the DAVID and STRING programs. Results: In the two replicated experiments, 4962/4946 proteins were identified, and the levels of expression of 4923/4902 proteins were quantified. In total, 112 of these proteins were differentially expressed. Among them, the up-regulated levels of expression of two of the 62 proteins with up-regulated expression (PPP2R2A and GSN and the down-regulated levels of expression four of the 50 proteins with down-regulated expression (LMNB2, UHRF1, G3BP1, and HNRNPU were verified using western blotting. The bioinformatics analysis revealed the interactions and signaling networks of these differentially expressed proteins. Conclusion: miR-193a-3p inhibited the metastasis of lung cancer cells by deregulating the expression of tumor-related proteins. These findings may improve the understanding of the molecular mechanisms underlying the metastatic-inhibitory effect of miR-193a-3p on lung cancer cells.

  1. A founder effect for p47(phox)Trp193Ter chronic granulomatous disease in Kavkazi Jews.

    Science.gov (United States)

    de Boer, Martin; Tzur, Shay; van Leeuwen, Karin; Dencher, Paula C D; Skorecki, Karl; Wolach, Baruch; Gavrieli, Ronit; Nasidze, Ivane; Stoneking, Mark; Tanck, Michael W T; Roos, Dirk

    2015-12-01

    Chronic granulomatous disease (CGD) is a rare congenital immune deficiency caused by mutations in any of the five genes encoding NADPH oxidase subunits. One of these genes is NCF1, encoding the p47(phox) protein. A group of 39 patients, 14 of whom are of Kavkazi Jewish descent, was investigated for a founder effect for the mutation c.579G>A (p.Trp193Ter) in NCF1. We analyzed various genetic markers in the NCF1 region, including two single nucleotide polymorphisms (SNPs) in NCF1 and two short tandem repeats (STRs) located near NCF1. Most patients were homozygous for the c.579G>A mutation, but three patients were hemizygotes, with a deletion of NCF1 on the other allele, and three patients were compound heterozygotes with another mutation in NCF1. All Kavkazi Jewish patients had a c.295G_c.345T SNP combination in NCF1 and shared a common number of repeats in STR3. In addition, 90% of the Kavkazi Jewish patients shared a common number of repeats in STR1. This uniformity indicates that the c.579G>A mutation in NCF1 was introduced some 1200-2300 years ago in the Kavkazi Jewish population. Variation amongst the other investigated populations from the Middle East indicates that this mutation exists in these non-Kavkazi populations already for more than 5000 years. PMID:26460255

  2. Revisiting the mechanisms involved in Line Width Roughness smoothing of 193 nm photoresist patterns during HBr plasma treatment

    Energy Technology Data Exchange (ETDEWEB)

    Brihoum, M.; Ramos, R.; Menguelti, K.; Cunge, G.; Pargon, E.; Joubert, O. [LTM (CNRS/UJF-Grenoble1/CEA), 17 avenue des Martyrs, 38054 Grenoble cedex 9 (France)

    2013-01-07

    HBr plasma treatments are widely used in nanoscale lithographic technologies to increase the plasma etch resistance of 193 nm photoresist masks as well as to decrease their Line Width Roughness (LWR). VUV irradiation of the photoresist is known to play a major role in this process by inducing polymer chains rearrangement and finally LWR reduction. However, in the plasma environment (i.e., with radical and ion bombardment), the interaction layer formed at the resist surface perturbs this mechanism and a lower LWR reduction is achieved compared to VUV only treatment. So far the nature of the interaction layer, its formation mechanism and its relation with the resist pattern LWR were all unclear. In this paper, we show that a graphite-like layer is formed on the resist patterns by the redeposition of carbon-based species originating from the plasma dissociation of outgassed photo-etched resist moieties. We show that the presence of this layer inhibits the LWR minimization and causes an increase in the LWR when it becomes thick enough (i.e., a few nanometers). We present evidences that the difference in the mechanical properties of the graphite-like top layer which coats the resist patterns and the bulk of the resist patterns is correlated to the LWR after plasma treatment. We can conclude that the optimization of an HBr cure process relies on the minimization of the carbon redeposition while keeping a significant VUV light flux and we show that this can be achieved by using pulsed plasma processes.

  3. The AAT/WFI survey of the Monoceros Ring and Canis Major Dwarf galaxy: I. from l = (193 - 276)o

    CERN Document Server

    Conn, B C; Lewis, G F; Gil-Merino, R; Irwin, M J; Ibata, R A; Martin, N F; Bellazzini, M; Sharp, R; Tuntsov, A V; Ferguson, A M N; Conn, Blair C.; Lane, Richard R.; Lewis, Geraint F.; Gil-Merino, Rodrigo; Irwin, Mike J.; Ibata, Rodrigo A.; Martin, Nicolas F.; Bellazzini, Michele; Sharp, Robert; Tuntsov, Artem V.; Ferguson, Annette M. N.

    2007-01-01

    We present the results of an AAT wide-field camera survey of the stars in the Monoceros Ring and purported Canis Major overdensity in the Galactic longitudes of {\\it l} = (193 - 276)$^\\circ$. Current numerical simulations suggest that both of these structures are the result of a single on-going accretion event, although an alternative solution is that the warped and flared disc of the Galaxy can explain the origin of both of these structures. Our results show that, with regards the Monoceros Ring, the warped and flared disc is unable to reproduce the locations and strengths of the detections observed around the Galaxy. This supports a non-Galactic origin for this structure. We report 8 new detections and 2 tentative detections of the Monoceros Ring in this survey. The exact nature of the Canis Major overdensity is still unresolved although this survey provides evidence that invoking the Galactic warp is not a sufficient solution when compared with observation. Several fields in this survey are highly inconsis...

  4. Testing of nuclear grade lubricants and their effect on A540 B24 and A193 B7 bolting materials

    International Nuclear Information System (INIS)

    An increase in the number of bolting failures attributed to lubricant/coolant interaction at nuclear power plants has caused a great deal of concern regarding the more judicious use of lubricants by the nuclear power industry. An investigation was performed on eleven commonly used lubricants by the nuclear power industry. The investigation included EDS analysis of the lubricants, notched-tensile constant extension rate testing of bolting materials with the lubricants, frictional testing of the lubricants and weight loss testing of a bonded solid film lubricant. The report generally concludes that there is a significant amount of variance in the mechanial properties of common bolting materials, that MoS2 can hydrolyze to form H2S at 1000C and cause stress corrosion cracking (SCC) of bolting materials, and that the use of copper-containing lubricants can be potentially detrimental to high strength steels in an aqueous environment. Additionally, the testing of various lubricants disclosed that some lubricants contain potentially detrimental elements (e.g. S, Sb) which can promote SCC of the common bolting materials. One of the most significant findings of this report is the observation that both A193 B7 and A540 B24 bolting materials are susceptible to transgranular stress corrosion cracking in demineralized H2O at 2800C in notched tensile tests. 139 figures

  5. UV and optical emission lines from the z=2.6 radio galaxy 0828+193: spatially resolved measurements

    CERN Document Server

    Humphrey, A; Villar-Martin, M; Binette, L; Fosbury, R; Alighieri, S di Serego

    2007-01-01

    We present an investigation into the spatial variation of the rest-frame UV and optical line and continuum emission along the radio axis of the z=2.6 radio galaxy 0828+193, using long-slit spectra from the Keck II and Subaru telescopes. Line brightnesses, line ratios and electron temperatures are examined, and their relationship with the arm-length asymmetry of the radio source is also investigated. We find that on the side of the nucleus with the shortest radio lobe, the gas covering factor is higher, and the ionization parameter is lower. The contrasts in environmental density required to explain the asymmetries in the line brightness and the radio arm-length asymmetries are in fair agreement with each other. These results add further weight to the conclusion of McCarthy, van Breugel & Kapahi (1991) - lobe distance asymmetries in powerful radio sources are the result of an asymmetry in the environmental density. We also note that the brightness of both the UV and optical continuum emission shows a simil...

  6. Photodissociation of the CHFCl2 and CHCl3 molecules and the CHCl2 radical in a beam at 193 nm

    Science.gov (United States)

    Yang, Xuefeng; Felder, Peter; Huber, J. Robert

    1994-11-01

    The collision-free photodissociation of CHFCl2 and CHCl3 at 193 nm has been studied by photofragment translational spectroscopy. In both systems the primary dissociation proceeds exclusively via the rupture of a C-Cl bond. The broad and unstructured UV spectra of the parent molecules and the rather high kinetic energy release (approximately = 45% of the available energy) in conjunction with the narrow translational energy distributions of the fragments are consistent with the C-Cl bond fission being a direct dissociation process. The photofragment angular distributions are characterized by anisotropy parameters beta = 0.5 +/- 0.1 (CHFCl2) and beta = 0.0 +/- 0.1 (CHCl3). Therefore, the photolysis of CHFCl2 involves an electronic transition polarised parallel to the line connecting the two Cl atoms. In the case of CHCl3, the nearly isotropic fragment recoil is attributed to the excitation of overlapping transitions of A(sub 1) from A(sub 1) and E from A(sub 1) type, respectively, hence leading to an effective anisotropy parameter beta(sub eff) = a(beta) A(sub 1) +b(beta)(sub E) approximately = 0. The CHCl2 radical produced in the primary reaction CHCl3 + h(nu) yields CHCl2 + Cl can absorb a further photon and is then selectively dissociated by molecular elimination of HCl according to CHCl2 + h(nu) yields CCl + HCl.

  7. High-performance 193-nm photoresist materials based on a new class of polymers containing spaced ester finctionalities

    Science.gov (United States)

    Khojasteh, Mahmoud; Chen, K. Rex; Kwong, Ranee W.; Lawson, Margaret C.; Varanasi, Pushkara R.; Patel, Kaushal S.; Kobayashi, Eiichi

    2003-06-01

    ArF lithography has been selected as the imaging method for the 90 nm technology node. Manufacturing related issues will have to be addressed when designing advanced 193 nm resists that are production worthy. Post exposure bake (PEB) sensitivity, dissolution properties and process window are some issues that need continuous improvement. Initially our investigation focused on a cyclic olefin (CO) platform which led us to a better understanding of the relationship between polymer structure and physical properties and how to improve cyclic olefin resist performance. Since then we have developed a new class of acrylate polymers with pendant "spaced ester" functionality. We have investigated the potential use of "spaced ester" functionality on improving the lithographic performance of CO and acrylate resist platforms. We have found that with "spaced ester" as pending group in CO polymer structures, it can lower the Tg and improve the dissolution properties of the CO resists. Resists formulated with acrylate containing "spaced ester" group exhibit excellent PEB temperature sensitivity (1 nm/°C), and are soluble in PGMEA. In addition, we have demonstrated sub-100 nm resolution with excellent process window through formulation optimization for acrylate based resists. This paper will focus on the "spaced ester" based polymer design, material properties; resist characteristics, and the lithographic performance for logic dense line applications.

  8. In situ characterisation of supported iron-iridium catalysts by iron-57 and iridium-193 Moessbauer spectroscopy

    International Nuclear Information System (INIS)

    Some silica-supported iron-iridium catalysts with different iron to iridium ratios and formed by the incipient wetness technique have been examined in situ by 57Fe and 193Ir Moessbauer spectroscopy following pretreatment in hydrogen. The results show that the reduction of the iron component is enhanced by the presence of iridium metal. The pretreated catalysts were evaluated for the hydrogenation of carbon monoxide at 2700C and 50 atmospheres pressure. The presence of iridium, which was shown by Moessbauer spectroscopy to result in the formation of reduced iron, iridium, and iron iridium alloy in the pretreated catalyst, was found to increase the catalytic activity and also influence selectivity. However, the systematic variation of the iridium content which was shown by Moessbauer spectroscopy to determine the exact phase composition of the pretreated catalysts, appeared to have little effect on catalytic performance. The 57Fe Moessbauer spectra recorded from all the used catalysts showed the formation of large and small particle ε'-Fe2.2C under the high pressure of the catalytic reaction. The results suggest that the formation of iron carbides on reduced iron, perhaps at the surface, and the adsorption of hydrogen on reduced iridium are important features of this catalytic system. (orig.)

  9. Potential impacts of 40 CFR 193 on the development of low-level radioactive waste disposal facilities

    Energy Technology Data Exchange (ETDEWEB)

    Alvarado, R.A. [Texas Low-Level Radioactive Waste Disposal Authority, Austin, TX (United States)

    1989-11-01

    Since the publication of the Advanced Notice of Proposed Rulemaking in August, 1983, the proposed environmental regulations regarding low-level radioactive waste have become a serious uncertainty in the development of new low-level radioactive waste disposal facilities. The proposed rule has been discussed on several occasions by the Technical Coordinating Committee and the purpose of this paper is to present the results of the Committee`s discussions regarding the proposed rule. The proposed standard has several closely related elements. The rule would prescribe limits on radiation exposure to individuals during processing, management and storage of low-level radioactive waste. It would set BRC levels and also set dose standards for the period following site closure. An important portion of the standard, as far as developing new facilities, is the ground water protection standard. The comments received during developing of 40 CFR 193 has also led the Environmental Protection Agency to propose 40 CFR 764 governing the disposal of naturally occurring radioactive material or NORM.

  10. Testing of nuclear grade lubricants and their effects on A540 B24 and A193 B7 bolting materials

    International Nuclear Information System (INIS)

    An investigation was performed on eleven commonly used lubricants by the nuclear power industry. The investigation included EDS analysis of the lubricants, notched-tensile constant extension rate testing of bolting materials with the lubricants, frictional testing of the lubricants and weight loss testing of a bonded solid film lubricant. The report generally concludes that there is a significant amount of variance in the mechanical properties of common bolting materials; that MoS2 can hydrolyze to form H2S at 1000C and cause stress corrosion cracking (SCC) of bolting materials, and that the use of copper-containing lubricants can be potentially detrimental to high strength steels in an aqueous environment. Additionally, the testing of various lubricants disclosed that some lubricants contain potentially detrimental elements (e.g. S, Sb) which can promote SCC of the common bolting materials. One of the most significant findings of this report is the observation that both A193 B7 and A540 B24 bolting materials are susceptible to transgranular stress corrosion cracking in demineralized H2O at 2800C in notched tensile tests

  11. Forward $J/\\psi$ production in U$+$U collisions at $\\sqrt{s_{NN}}$=193 GeV

    CERN Document Server

    Adare, A; Ajitanand, N N; Akiba, Y; Akimoto, R; Alexander, J; Alfred, M; Aoki, K; Apadula, N; Asano, H; Atomssa, E T; Awes, T C; Azmoun, B; Babintsev, V; Bai, M; Bai, X; Bandara, N S; Bannier, B; Barish, K N; Bathe, S; Baublis, V; Baumann, C; Baumgart, S; Bazilevsky, A; Beaumier, M; Beckman, S; Belmont, R; Berdnikov, A; Berdnikov, Y; Black, D; Blau, D S; Bok, J S; Boyle, K; Brooks, M L; Bryslawskyj, J; Buesching, H; Bumazhnov, V; Butsyk, S; Campbell, S; Chen, C -H; Chi, C Y; Chiu, M; Choi, I J; Choi, J B; Choi, S; Christiansen, P; Chujo, T; Cianciolo, V; Citron, Z; Cole, B A; Cronin, N; Crossette, N; Csanád, M; Csörgő, T; Danley, D; Datta, A; Daugherity, M S; David, G; DeBlasio, K; Dehmelt, K; Denisov, A; Deshpande, A; Desmond, E J; Ding, L; Dion, A; Diss, P B; Do, J H; D'Orazio, L; Drapier, O; Drees, A; Drees, K A; Durham, J M; Durum, A; Engelmore, T; Enokizono, A; Esumi, S; Eyser, K O; Fadem, B; Feege, N; Fields, D E; Finger, M; Jr., \\,; Fleuret, F; Fokin, S L; Frantz, J E; Franz, A; Frawley, A D; Fukao, Y; Fusayasu, T; Gainey, K; Gal, C; Gallus, P; Garg, P; Garishvili, A; Garishvili, I; Ge, H; Giordano, F; Glenn, A; Gong, X; Gonin, M; Goto, Y; de Cassagnac, R Granier; Grau, N; Greene, S V; Perdekamp, M Grosse; Gu, Y; Gunji, T; Guragain, H; Hachiya, T; Haggerty, J S; Hahn, K I; Hamagaki, H; Hamilton, H F; Han, S Y; Hanks, J; Hasegawa, S; Haseler, T O S; Hashimoto, K; Hayano, R; He, X; Hemmick, T K; Hester, T; Hill, J C; Hollis, R S; Homma, K; Hong, B; Hoshino, T; Hotvedt, N; Huang, J; Huang, S; Ichihara, T; Ikeda, Y; Imai, K; Imazu, Y; Inaba, M; Iordanova, A; Isenhower, D; Isinhue, A; Ivanishchev, D; Jacak, B V; Jeon, S J; Jezghani, M; Jia, J; Jiang, X; Johnson, B M; Joo, K S; Jouan, D; Jumper, D S; Kamin, J; Kanda, S; Kang, B H; Kang, J H; Kang, J S; Kapustinsky, J; Kawall, D; Kazantsev, A V; Key, J A; Khachatryan, V; Khandai, P K; Khanzadeev, A; Kijima, K M; Kim, C; Kim, D J; Kim, E -J; Kim, G W; Kim, M; Kim, Y -J; Kim, Y K; Kimelman, B; Kistenev, E; Kitamura, R; Klatsky, J; Kleinjan, D; Kline, P; Koblesky, T; Kofarago, M; Komkov, B; Koster, J; Kotchetkov, D; Kotov, D; Krizek, F; Kurita, K; Kurosawa, M; Kwon, Y; Lacey, R; Lai, Y S; Lajoie, J G; Lebedev, A; Lee, D M; Lee, G H; Lee, J; Lee, K B; Lee, K S; Lee, S; Lee, S H; Leitch, M J; Leitgab, M; Lewis, B; Li, X; Lim, S H; Liu, M X; Lynch, D; Maguire, C F; Makdisi, Y I; Makek, M; Manion, A; Manko, V I; Mannel, E; Maruyama, T; McCumber, M; McGaughey, P L; McGlinchey, D; McKinney, C; Meles, A; Mendoza, M; Meredith, B; Miake, Y; Mibe, T; Mignerey, A C; Milov, A; Mishra, D K; Mitchell, J T; Miyasaka, S; Mizuno, S; Mohanty, A K; Mohapatra, S; Montuenga, P; Moon, T; Morrison, D P; Moskowitz, M; Moukhanova, T V; Murakami, T; Murata, J; Mwai, A; Nagae, T; Nagamiya, S; Nagashima, K; Nagle, J L; Nagy, M I; Nakagawa, I; Nakagomi, H; Nakamiya, Y; Nakamura, K R; Nakamura, T; Nakano, K; Nattrass, C; Netrakanti, P K; Nihashi, M; Niida, T; Nishimura, S; Nouicer, R; Novak, T; Novitzky, N; Nyanin, A S; O'Brien, E; Ogilvie, C A; Oide, H; Okada, K; Koop, J D Orjuela; Osborn, J D; Oskarsson, A; Ozawa, K; Pak, R; Pantuev, V; Papavassiliou, V; Park, I H; Park, J S; Park, S; Park, S K; Pate, S F; Patel, L; Patel, M; Peng, J -C; Perepelitsa, D V; Perera, G D N; Peressounko, D Yu; Perry, J; Petti, R; Pinkenburg, C; Pinson, R; Pisani, R P; Purschke, M L; Qu, H; Rak, J; Ramson, B J; Ravinovich, I; Read, K F; Reynolds, D; Riabov, V; Riabov, Y; Richardson, E; Rinn, T; Riveli, N; Roach, D; Rolnick, S D; Rosati, M; Rowan, Z; Rubin, J G; Ryu, M S; Sahlmueller, B; Saito, N; Sakaguchi, T; Sako, H; Samsonov, V; Sarsour, M; Sato, S; Sawada, S; Schaefer, B; Schmoll, B K; Sedgwick, K; Seele, J; Seidl, R; Sekiguchi, Y; Sen, A; Seto, R; Sett, P; Sexton, A; Sharma, D; Shaver, A; Shein, I; Shibata, T -A; Shigaki, K; Shimomura, M; Shoji, K; Shukla, P; Sickles, A; Silva, C L; Silvermyr, D; Singh, B K; Singh, C P; Singh, V; Skolnik, M; Slunečka, M; Snowball, M; Solano, S; Soltz, R A; Sondheim, W E; Sorensen, S P; Sourikova, I V; Stankus, P W; Steinberg, P; Stenlund, E; Stepanov, M; Ster, A; Stoll, S P; Stone, M R; Sugitate, T; Sukhanov, A; Sumita, T; Sun, J; Sziklai, J; Takahara, A; Taketani, A; Tanaka, Y; Tanida, K; Tannenbaum, M J; Tarafdar, S; Taranenko, A; Tennant, E; Tieulent, R; Timilsina, A; Todoroki, T; Tomášek, M; Torii, H; Towell, C L; Towell, R; Towell, R S; Tserruya, I; van Hecke, H W; Vargyas, M; Vazquez-Zambrano, E; Veicht, A; Velkovska, J; Vértesi, R; Virius, M; Vrba, V; Vznuzdaev, E; Wang, X R; Watanabe, D; Watanabe, K; Watanabe, Y; Watanabe, Y S; Wei, F; Whitaker, S; White, A S; Wolin, S; Woody, C L; Wysocki, M; Xia, B; Xue, L; Yalcin, S; Yamaguchi, Y L; Yanovich, A; Yokkaichi, S; Yoo, J H; Yoon, I; You, Z; Younus, I; Yu, H; Yushmanov, I E; Zajc, W A; Zelenski, A; Zhou, S; Zou, L

    2015-01-01

    The invariant yields for $J/\\psi$ production at forward rapidity $(1.2<|y|<2.2)$ in U$+$U collisions at $\\sqrt{s_{_{NN}}}$=193 GeV have been measured as a function of collision centrality. The invariant yields and nuclear-modification factor $R_{AA}$ are presented and compared with those from Au$+$Au collisions in the same rapidity range. Additionally, the direct ratio of the invariant yields from U$+$U and Au$+$Au collisions within the same centrality class is presented, and used to investigate the role of $c\\bar{c}$ coalescence. Two different parameterizations of the deformed Woods-Saxon distribution were used in Glauber calculations to determine the values of the number of nucleon-nucleon collisions in each centrality class, $N_{\\rm coll}$, and these were found to give significantly different $N_{\\rm coll}$ values. Results using $N_{\\rm coll}$ values from both deformed Woods-Saxon distributions are presented. The measured ratios show that the $J/\\psi$ suppression, relative to binary collision scaling...

  12. Characterization of Therapeutic Monoclonal Antibodies at the Subunit-Level using Middle-Down 193 nm Ultraviolet Photodissociation.

    Science.gov (United States)

    Cotham, Victoria C; Brodbelt, Jennifer S

    2016-04-01

    Monoclonal antibodies (mAbs) are a rapidly advancing class of therapeutic glycoproteins that possess wide clinical utility owing to their biocompatibility, high antigen specificity, and targeted immune stimulation. These therapeutic properties depend greatly on the composition of the immunoglobulin G (IgG) structure, both in terms of primary sequence and post-translational modifications (PTMs); however, large-scale production in cell culture often results in heterogeneous mixtures that can profoundly affect clinical safety and efficacy. This places a high demand on analytical methods that afford comprehensive structural characterization of mAbs to ensure their stringent quality control. Here we report the use of targeted middle-down 193 nm ultraviolet photodissociation (UVPD) to provide detailed primary sequence analysis and PTM site localization of therapeutic monoclonal antibody subunits (∼25 kDa) generated upon digestion with recombinant immunoglobulin G-degrading enzyme of Streptococcus pyogenes (IdeS) followed by chemical reduction. Under optimal conditions, targeted UVPD resulted in approximately 60% overall coverage of the IgG sequence, in addition to unambiguous glycosylation site localization and extensive coverage of the antigen-binding complementarity determining regions (CDRs) in a single LC-MS/MS experiment. Combining UVPD and ETD data afforded even deeper sequencing and greater overall characterization of IgG subunits. Overall, this targeted UVPD approach represents a promising new strategy for the comprehensive characterization of antibody-based therapeutics. PMID:26947921

  13. Review of the EPA's radionuclide release analyses from LLW disposal trenches used in support of proposed dose limits in 40 CFR 193

    International Nuclear Information System (INIS)

    The April 1989 draft EPA standard for low-level waste (LLW) disposal, 40 CFR 193, would require disposal site performance to satisfy very stringent dose-limit criteria. The EPA suggests that these limits can be achieved by relying extensively on waste solidification before disposal. The EPA justifies the achievability of the proposed criteria based on performance assessment analyses in the general context of trench burial of the LLW. The core models implemented in those analyses are codified in the EPA's PRESTO family of codes. Because a key set of models for predicting potential releases are the leach-and-transport models from a disposal trench, these have been reviewed for completeness and applicability to trench disposal methods. The overall conclusion of this review is that the generic analyses performed by the EPA are not sufficiently comprehensive to support the proposed version of 40 CFR 193. More rigorous analyses may find the draft standard criteria to be unattainable

  14. Molecular characterization of Salmonella enterica serovar 4,[5],12:i:- DT193 ASSuT strains from two outbreaks in Italy

    DEFF Research Database (Denmark)

    Barco, Lisa; Ramon, Elena; Cortini, Enzo; Longo, Alessandra; Dalla Pozza, Maria Cristina; Lettini, Antonia Anna; Dionisi, Anna Maria; Olsen, John Elmerdahl; Ricci, Antonia

    2014-01-01

    mixture between two profiles of Salmonella 4,[5],12:i:- described as the "Spanish" and the "U.S." clones. This study demonstrated that although strains of Salmonella 4,[5],12:i:- DT193 ASSuT are highly clonal, minor differences between strains may be seen during the same outbreak by using in parallel PFGE......Abstract Salmonella enterica subsp. enterica serovar 4,[5],12:i:- DT193 is recognized as an emerging monophasic variant of Salmonella Typhimurium in many European countries. Resistance to ampicillin, streptomycin, sulphonamides, and tetracycline (R-type ASSuT) is described as one of the most common...... profiles of resistance within this clone. Recently, strains presenting such features were isolated from two unrelated outbreaks in Italy. Strains were characterized by pulsed-field gel electrophoresis (PFGE), performed with XbaI, BlnI, and SpeI, and multiple-locus variable-number tandem repeat analysis...

  15. Analysis of Large Phenotypic Variability of EEC and SHFM4 Syndromes Caused by K193E Mutation of the TP63 Gene

    OpenAIRE

    Jianhua Wei; Yang Xue; Lian Wu; Jie Ma; Xiuli Yi; Junrui Zhang; Bin Lu; Chunying Li; Dashuang Shi; Songtao Shi; Xinghua Feng; Tao Cai

    2012-01-01

    EEC (ectrodactyly, ectodermal dysplasia, clefting; OMIM 604292) is an autosomal dominant developmental disorder resulting mainly from pathogenic mutations of the DNA-binding domain (DBD) of the TP63 gene. In this study, we showed that K193E mutation in nine affected individuals of a four-generation kindred with a large degree of phenotypic variability causes four different syndromes or TP63-related disorders: EEC, Ectrodactyly-ectodermal dysplasia (EE), isolated ectodermal dysplasia, and isol...

  16. Point mutation in the NF2 gene of HEI-193 human schwannoma cells results in the expression of a merlin isoform with attenuated growth suppressive activity

    International Nuclear Information System (INIS)

    Neurofibromatosis type 2 (NF2) is a genetic disorder characterized by the formation of bilateral schwannomas of the eighth cranial nerve. Although the protein product of the NF2 gene (merlin) is a classical tumor suppressor, the mechanism by which merlin suppresses cell proliferation is not fully understood. The availability of isolated tumor cells would facilitate a better understanding of the molecular function of merlin, but primary schwannoma cells obtained from patients grow slowly and do not yield adequate numbers for biochemical analysis. In this study, we have examined the NF2 mutation in HEI-193 cells, an immortalized cell line derived from the schwannoma of an NF2 patient. Previous work showed that the NF2 mutation in HEI-193 cells causes a splicing defect in the NF2 transcript. We have confirmed this result and further identified the resultant protein product as an isoform of merlin previously designated as isoform 3. The level of isoform 3 proteins in HEI-193 cells is comparable to the levels of merlin isoforms 1 and 2 in normal human Schwann cells and several other immortalized cell lines. In contrast to many mutant forms of merlin, isoform 3 is as resistant to proteasomal degradation as isoforms 1 and 2 and can interact with each of these isoforms in vivo. Cell proliferation assays showed that, in NF2-/- mouse embryonic fibroblasts, exogenously expressed merlin isoform 3 does exhibit growth suppressive activity although it is significantly lower than that of identically expressed merlin isoform 1. These results indicate that, although HEI-193 cells have undetectable levels of merlin isoforms 1 and 2, they are, in fact, not a merlin-null model because they express the moderately active growth suppressive merlin isoform 3

  17. Point mutation in the NF2 gene of HEI-193 human schwannoma cells results in the expression of a merlin isoform with attenuated growth suppressive activity

    Energy Technology Data Exchange (ETDEWEB)

    Lepont, Pierig; Stickney, John T.; Foster, Lauren A.; Meng, Jin-Jun; Hennigan, Robert F. [Department of Cell and Cancer Biology, Vontz Center for Molecular Studies, University of Cincinnati College of Medicine, 3125 Eden Avenue, Cincinnati, OH 45267-0521 (United States); Ip, Wallace [Department of Cell and Cancer Biology, Vontz Center for Molecular Studies, University of Cincinnati College of Medicine, 3125 Eden Avenue, Cincinnati, OH 45267-0521 (United States)], E-mail: wallace.ip@uc.edu

    2008-01-01

    Neurofibromatosis type 2 (NF2) is a genetic disorder characterized by the formation of bilateral schwannomas of the eighth cranial nerve. Although the protein product of the NF2 gene (merlin) is a classical tumor suppressor, the mechanism by which merlin suppresses cell proliferation is not fully understood. The availability of isolated tumor cells would facilitate a better understanding of the molecular function of merlin, but primary schwannoma cells obtained from patients grow slowly and do not yield adequate numbers for biochemical analysis. In this study, we have examined the NF2 mutation in HEI-193 cells, an immortalized cell line derived from the schwannoma of an NF2 patient. Previous work showed that the NF2 mutation in HEI-193 cells causes a splicing defect in the NF2 transcript. We have confirmed this result and further identified the resultant protein product as an isoform of merlin previously designated as isoform 3. The level of isoform 3 proteins in HEI-193 cells is comparable to the levels of merlin isoforms 1 and 2 in normal human Schwann cells and several other immortalized cell lines. In contrast to many mutant forms of merlin, isoform 3 is as resistant to proteasomal degradation as isoforms 1 and 2 and can interact with each of these isoforms in vivo. Cell proliferation assays showed that, in NF2{sup -/-} mouse embryonic fibroblasts, exogenously expressed merlin isoform 3 does exhibit growth suppressive activity although it is significantly lower than that of identically expressed merlin isoform 1. These results indicate that, although HEI-193 cells have undetectable levels of merlin isoforms 1 and 2, they are, in fact, not a merlin-null model because they express the moderately active growth suppressive merlin isoform 3.

  18. Low-dose irradiation promotes Rad51 expression by down-regulating miR-193b-3p in hepatocytes

    Science.gov (United States)

    Lee, Eon-Seok; Won, Yeo Jin; Kim, Byoung-Chul; Park, Daeui; Bae, Jin-Han; Park, Seong-Joon; Noh, Sung Jin; Kang, Yeong-Rok; Choi, Si Ho; Yoon, Je-Hyun; Heo, Kyu; Yang, Kwangmo; Son, Tae Gen

    2016-05-01

    Current evidence indicates that there is a relationship between microRNA (miRNA)-mediated gene silencing and low-dose irradiation (LDIR) responses. Here, alterations of miRNA expression in response to LDIR exposure in male BALB/c mice and three different types of hepatocytes were investigated. The miRNome of the LDIR-exposed mouse spleens (0.01 Gy, 6.5 mGy/h) was analyzed, and the expression of miRNA and mRNA was validated by qRT-PCR. Western blotting, chromatin immunoprecipitation (ChIP), and luciferase assays were also performed to evaluate the interaction between miRNAs and their target genes and to gain insight into the regulation of miRNA expression. The expression of miRNA-193b-3p was down-regulated in the mouse spleen and liver and in various hepatocytes (NCTC, Hepa, and HepG2 cell lines) in response to LDIR. The down-regulation of miR-193b-3p expression was caused by histone deacetylation on the miR-193b-3p promoter in the HepG2 cells irradiated with 0.01 Gy. However, the alteration of histone deacetylation and miR-193b-3p and Rad51 expression in response to LDIR was restored by pretreatment with N-acetyl-cyctein. In conclusion, we provide evidence that miRNA responses to LDIR include the modulation of cellular stress responses and repair mechanisms.

  19. Clinical significance of miR-140-5p and miR-193b expression in patients with breast cancer and relationship to IGFBP5

    Directory of Open Access Journals (Sweden)

    Gökçe Güllü

    2015-03-01

    Full Text Available The functional role of IGFBP5 in breast cancer is complicated. Experimental and bioinformatics studies have shown that IGFBP5 is targeted by miR-140-5p and miR-193b, although this has not yet been proven in clinical samples. The aim of this study was to evaluate the expression of miR-140-5p and miR-193b in breast cancer and adjacent normal tissue and assess its correlation with IGFBP5 and the clinicopathological characteristics of the tumors. IGFBP5 protein expression was analyzed immunohistochemically and IGFBP5, miR-140 and miR-193b mRNA expression levels were analyzed with real-time RT-PCR. Tumor tissue had higher miR-140-5p expression than adjacent normal tissue (p = 0.015. Samples with no immunohistochemical staining for IGFBP5 showed increased miR-140-5p expression (p = 0.009. miR-140-5p expression was elevated in invasive ductal carcinomas (p = 0.002, whereas basal-like tumors had decreased expression of miR-140-5p compared to other tumors (p = 0.008. Lymph node-positive samples showed an approximately 13-fold increase in miR-140-5p expression compared to lymph node-negative tissue (p = 0.049. These findings suggest that miR-140-5p, but not miR-193b, could be an important determinant of IGFBP5 expression and clinical phenotype in breast cancer patients. Further studies are needed to clarify the expressional regulation of IGFBP5 by miR-140-5p.

  20. Analysis of large phenotypic variability of EEC and SHFM4 syndromes caused by K193E mutation of the TP63 gene.

    Directory of Open Access Journals (Sweden)

    Jianhua Wei

    Full Text Available EEC (ectrodactyly, ectodermal dysplasia, clefting; OMIM 604292 is an autosomal dominant developmental disorder resulting mainly from pathogenic mutations of the DNA-binding domain (DBD of the TP63 gene. In this study, we showed that K193E mutation in nine affected individuals of a four-generation kindred with a large degree of phenotypic variability causes four different syndromes or TP63-related disorders: EEC, Ectrodactyly-ectodermal dysplasia (EE, isolated ectodermal dysplasia, and isolated Split Hand/Foot Malformation type 4 (SHFM4. Genotype-phenotype and DBD structural modeling analysis showed that the K193-located loop L2-A is associated with R280 through hydrogen bonding interactions, while R280 mutations also often cause large phenotypic variability of EEC and SHFM4. Thus, we speculate that K193 and several other DBD mutation-associated syndromes may share similar pathogenic mechanisms, particularly in the case of the same mutation with different phenotypes. Our study and others also suggest that the phenotypic variability of EEC is attributed, at least partially, to genetic and/or epigenetic modifiers.

  1. The effect of acute Lithium and AMI-193, a new 5HT2 antagonist, on Apomorphine-induced pecking in pigeon

    Directory of Open Access Journals (Sweden)

    Bagheri T

    2002-06-01

    Full Text Available Intramascular (IM administration of apomorphine (a mixed D1/D2 dopamine receptors agonist 0.2-1.6 mg/kg induced pecking, a stereotype behavior in pigeons in a dose- dependent manner. In this study the effect of lithium (Li+, 240 mg/kg, IM and AMI-193 (a new 5-HT2 antagonist, 0.003 mg/pigeon on apomorphine-induced peking (AIP were investigated. This study showed that Li+ and AMI-193 did not induce pecking by itself but administration of each of these agents before apomorphine increased and decreased the AIP (apomor-phine 0.8 mg/kg respectively whereas concomitant use of Li+ (240 mg/kg IM and AMI-193 decreased AIP significantly. These results suggested that 5-HT2 antagonists inhibit the inhibitory effect of serotonin on the dopamine release in the raphe-striatal pathway but Li+ can modulate dopamine and serotonin function by different mechanisms and decrease this effect. As a result, it is mechanisms and decrease this effect. As a result, it is concluded serotonin can decrease the AIP through 5-HT2 receptors indirectly by decrease the dopamine release.

  2. Molecular gas heating mechanisms, and star formation feedback in merger/s tarbursts: NGC 6240 and Arp 193 as case studies

    CERN Document Server

    Papadopoulos, Padelis P; Xilouris, E M; Weiss, Axel; van der Werf, Paul; Israel, Frank P; Greve, Thomas R; Isaak, Kate G; Gao, Yu

    2014-01-01

    We used the SPIRE/FTS instrument aboard the Herschel Space Observatory (HSO) to obtain the Spectral Line Energy Distributions (SLEDs) of CO from J=4-3 to J=13-12 of Arp 193 and NGC 6240, two classical merger/starbursts selected from our molecular line survey of local Luminous Infrared Galaxies (LIRGs: L_{IR}>=10^{11} L_{sol}). The high-J CO SLEDs are then combined with ground-based low-J CO, {13}CO, HCN, HCO+, CS line data and used to probe the thermal and dynamical states of their large molecular gas reservoirs. We find the two CO SLEDs strongly diverging from J=4-3 onwards, with NGC6240 having a much higher CO line excitation than Arp193, despite their similar low-J CO SLEDs and L_{FIR}/L_{CO,1-0}, L_{HCN}/L_{CO} (J=1-0) ratios (proxies of star formation efficiency and dense gas mass fraction). In Arp193, one of the three most extreme starbursts in the local Universe, the molecular SLEDs indicate a small amount ~(5-15)% of dense gas (n>=10^{4}cm^{-3}) unlike NGC6240 where most of the molecular gas (~(60-70)...

  3. Chemonuclear studies for identification for new production routes for the therapeutically useful radionuclides 140Nd, 192Ir, 191Pt, 193mPt, und 195mPt

    International Nuclear Information System (INIS)

    New production routes for the therapeutically useful radionuclides 140Nd, 192Ir, 191Pt, 193mPt and 195mPt were investigated. Cross section data were measured using the stacked-foil technique and compared with theoretical calculations. A production method for the platinum nuclides was developed. The 141Pr(p, 2n)140Nd and natCe(3He, xn)140Nd reactions were investigated for production of 140Nd. Cross section data of nuclear reactions leading to the side products 141Nd, 139Nd and 139Ce could also be achieved. The experimental data were compared with theoretical calculations using the code ALICE-IPPE. A comparison of the calculated thick target yields showed that the 141Pr(p, 2n)140Nd reaction gives a higher yield. The 192Os(p, n)192Ir reaction was examined in the context of the production of 192Ir. Cross section data were determined and compared with theoretical calculations using the codes ALICE-IPPE and EMPIRE II. The yield of this reaction was compared with the yield of the reactor production of this nuclide. The reactor production seems to be more suitable because of a higher purity and yield. Cross section data were measured for the 192Os(α, n)195mPt, 192Os(α, 3n)193mPt and 192Os(3He, 4n)191Pt reactions. The activity of 193mPt and 195mPt was determined by X-ray spectroscopy after a chemical separation procedure. The ALICE-IPPE code was found to be inappropriate to reproduce the experimental values. The calculated yields were compared with the yields of other reactions, especially the reactor production of 195mPt. The yield of the 192Os(α, n)195mPt reaction is lower compared to the yield of the reactor production, but offers lower target costs and higher specific activity. A production method for 193mPt and 195mPt was developed. Batch yields of 0.9 MBq 195mPt (specific activity of about 150 GBq/g Pt) and 8.7 MBq 193mPt (ca. 3 TBq/g Pt) could be achieved. The experimental yields were compared with the calculated yields. The agreement between these two data sets

  4. Comment: 193 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available Database Center for Life Science) licensed under CC Attribution2.1 Japan 撮影:仲里猛留(ライフサイエンス統合データベースセンター) Photo...: Takeru Nakazato (Database Center for Life Science) ウグイス Cettia diphone cantans nakazato 2008/12/22 10:09:51 2010/01/14 20:05:22 ...

  5. AB193. Rectourethral fistula

    Science.gov (United States)

    Jiang, Hai

    2016-01-01

    Objective To investigate the treatment of rectourethral fistula. Methods Eleven cases of male patients with rectourethral fistula were treated in our department from 2011 to 2015. Age 16–66 years old. Causes: three cases of patients with congenital closed anus, four cases of traumatic pelvic fracture with urethral distraction and rectum injury, four cases after radical prostatectomy. The size of the fistula was 0.5–1.5 cm. In addition to the leakage of urine in the large fistula, urine mixed with stool samples. Three patients with congenital closed anal postoperative patients with posterior or anterior median sagittal approach for resection of the fistula, hierarchical closed urethral and rectal wall defect, at least three layer (between the urethral and rectal suture layer), indwelling catheter for 3–4 weeks, no cystostomy. Sigmoid colostomy underwent prior to the surgery. Of which six cases were repaired by perineal approach, one case by abdominal perineal approach, one case by abdominal repair. According to size of fistula and the surrounding scar decide whether or not to adopt tissue interposition, this group of five cases with gracilis muscle flap, one case with bulbocavernosus muscle flap interposed between the rectum and urethra; one case repaired by sigmoid colon pull-through procedure. Post-operation indwelling catheterization for 3–4 weeks with cystostomy. Results A total of 10 patients were successful, and no leakage of urine was found after removal of the catheter. One patient improved, occasionally a small amount of drops of urine voiding from anus. Reoperation was successful after 6 months. Recovered enteric continuity 3–6 months post-operation. Conclusions The median sagittal approach provide good exposure for the repair of congenital rectourethral fistula; perineal approach is a good choice for patients caused by trauma or surgery; complete resection of scar around the fistula, tension-free anastomosis, tissue interposition and sigmoid colostomy provide necessary guarantee for successful operation.

  6. Strangeness production in Ni+Ni collisions at 1.93 AGeV; Production d'etrangete dans les collisions Ni+Ni a 1.93 AGeV

    Energy Technology Data Exchange (ETDEWEB)

    Lopez, X

    2004-12-15

    This work deals with the production of strange particles in Ni + Ni collisions at 1.93 A GeV detected with the Fopi (four pi) detector at the heavy ion synchrotron SIS (GSI - Germany). We have limited our investigation to the study of {lambda} and {xi} hyperons. The first chapter presents the models used to describe ultra-relativistic heavy ions collisions. In the second chapter we present the main experimental results concerning the production and transport of strange particles in an energy domain ranging from SIS to RHIC (relativistic heavy ion collider) energies. The third chapter is dedicated to the specificities of the Fopi detector. The fourth chapter deals with the production of {lambda} particles in Ni + Ni collisions. An analysis method based on neuron network has been used in parallel with a more classical method. The production rate and temperature of {lambda} have been deduced from both methods. The neuron network method gives a statistical gain and allows a better identification of particles with low transverse impulses. The fifth chapter is dedicated to the detection of the doubly strange {xi}{sup -} particle. A detailed study about the stability of the signal is presented. In the last chapter all our experimental results are confronted with theoretical predictions. The UrQMD model that uses a hard equation of state, can simulate satisfactorily the production rates of {lambda} and K{sup +} as well as their dependency on collision centrality despite the fact that this model does not use a potential linked to the medium density. The comparison between experimental results and predictions given by the IQMD model (that is based on a soft equation of state) is better when the version of the model that does not take into account the effects of the media is used. We see that the choices for the nuclear matter compressibility, for the particles involved in Kaon and {lambda} creation process, or for the interaction potential with dense medium, appear to be

  7. Cross section measurement for reaction 193Ir(n,2n)192m2Ir at 14.7 MeV

    International Nuclear Information System (INIS)

    The cross sections induced by neutron on long-lived radionuclides of importance in fusion reactor technology are measured by activation method for 193Ir(n,2n)192m2Ir reaction at 14.7 MeV. The neutron fluences are determined by the cross section of 93Nb(n,2n)92mNb. The neutron energies in these measurements are determined by cross section ratios for 90Zr(n,2n)89Zr and 93Nb(n,2n)92mNb reactions. (2 tabs.)

  8. Nuclear stopping from 0.09A GeV to 1.93A GeV and its correlation to flow

    CERN Document Server

    Reisdorf, W; Gobbi, A; Hartmann, O N; Herrmann, N; Hildenbrand, K D; Kim, Y J; Kirejczyk, M; Koczón, P; Kress, T; Leifels, Y; Schüttauf, A; Tyminski, Z; Xiao, Z G; Alard, J P; Barret, V; Basrak, Z; Bastid, N; Benabderrahmane, M L; Caplar, R; Crochet, Philippe; Dupieux, P; Dzelalija, M; Fodor, Z; Grishkin, Y; Hong, B; Kecskeméti, J; Korolija, M; Kotte, R; Lebedev, A; López, X; Merschmeyer, M; Mösner, J; Neubert, W; Pelte, D; Petrovici, M; Rami, F; De, B; Schauenburg; Seres, Z; Sikora, B; Sim, K S; Simion, V; Siwek-Wilczynska, K; Smolyankin, V T; Stockmeier, M R; Stoicea, G; Wagner, P; Wisniewski, K; Wohlfarth, D; Yushmanov, I E; Zhilin, A

    2004-01-01

    We present a complete systematics (excitation functions and system-size dependences) of global stopping and sideflow for heavy ion reactions in the energy range between 0.09A GeV and 1.93A GeV. For the heaviest system, Au+Au, we observe a plateau of maximal stopping extending from about 0.2A to 0.8A GeV with a fast drop on both sides. The degree of stopping, which is shown to remain significantly below the expectations of a full stopping scenario, is found to be highly correlated to the amount of sideflow.

  9. Search for signatures of the supersymmetry in 193Pt and mixed-symmetric states in 194Pt by means of γ spectroscopy

    International Nuclear Information System (INIS)

    After the general renovation of the experimental halls at the Institute for Nuclear Physics in Cologne, the HORUS-Spectrometer was rebuilt within the scope of this thesis. Following this, two experiments were performed to conduct a γγ-angular correlation analysis. The nuclei 194Pt and 193Pt were measured to complete existing data and the results are presented in this thesis. Both nuclei were measured in β-decay experiments. The mother nuclei were produced in fusion evaporation reactions. In case of 194Pt 10 spins were determined experimentally for the first time. 57 multipole mixing ratios were determined. For the nucleus 193Pt three spins were measured for the first time. After the general renovation a new data acquisition system was set up for experimental measurements. During the measurement of 194Pt two data acquisitions were used, the ''old'' analog data acquistion and the ''new'' digital data acquisition. A short comparison of those two data acquistion systems for nuclear-physical measurements are shown in this thesis. The aim is to measure permanently with the new digital data acquistion. In the region of the gold and platin isotopes there exist even-even nuclei, which can be described via the Interacting-Boson-Model (IBM) and Interacting-Boson-Model-2 (IBM-2). Odd-A nuclei can be illustrated with the Interacting-Boson-Fermion-Model (IBFM). An application of the IBFM is the Uν(6/12) x Uπ(6/4) supersymmetry, consisting of the nuclei that are described by the same Hamiltonian and one set of parameters. To test predictions of 194Pt and 193Pt, multipole-mixing-ratios of γ-transitions and spins were determined. The IBM describes the complex structure of a nucleus in a very simplified way. Very good fits of 194Pt and 193Pt in the O(6)-Limits of the IBM could be made. In addition fits of the even-even platin isotopes are shown to discuss the systematics of the platin isotopes.

  10. Synthesis of Narrow Molecular Weight Distribution Norbornene-Lactone Functionalized Polymers by Nitroxide-Mediated Polymerization: Candidates for 193-nm Photoresist Materials

    Directory of Open Access Journals (Sweden)

    Zi Jun Wang

    2014-02-01

    Full Text Available One hundred ninety three-nanometer candidate photoresist materials were synthesized by nitroxide-mediated polymerization (NMP. Statistical copolymerizations of 5-methacryloyloxy-2,6-norboranecarbolactone (NLAM with 5–10 mol% of controlling co-monomers (which are necessary for controlled polymerizations of methacrylates by NMP with the initiator used in the feed, such as styrene (ST, p-acetoxystyrene (AcOST, 2-vinyl naphthalene (VN and pentafluorostyrene (PFS, using the unimolecular BlocBuilder® initiator in 35 wt% dioxane solution at 90 °C were performed. As little as 5 mol% controlling comonomer in the feed was demonstrated to be sufficient to lead to linear evolution of number average molecular weight  with respect to conversion up to 50%, and the resulting copolymers had dispersities  of ~1.3 in most cases, an attractive feature for reducing line width roughness (LWR in photoresists. The copolymers generally showed relatively low absorbance at 193 nm, comparable to other 193-nm candidate photoresists reported previously, despite the inclusion of a small amount of the styrenic co-monomers in the copolymer.

  11. Effect of the rinse solution to avoid 193-nm resist line collapse: a study for modification of resist polymer and process conditions

    Science.gov (United States)

    Masuda, Seiya; Kobayashi, Masakazu; Kim, Woo-Kyu; Anyadiegwu, Clement; Padmanaban, Munirathna; Dammel, Ralph R.; Tanaka, Keiichi; Yamada, Yoshiaki

    2004-05-01

    The device design rule is continuously shrinking toward optical resolution limit where k1 factor is below 0.3. The requirement for 193 nm photoresist below 90 nm node is quite challenging at the manufacturing phase. Using DI water rinse after development gives a significant amount of line collapse when the aspect ratio is over 3. To avoid line collapse, we co-developed special rinse solution for FIRM process with Tokyo Electron Ltd. Utilizing FIRM process, 90 nm dense line collapse was measured by CD SEM using focus-exposure matrices. The line collapse property has been observed using experimental 193 nm positive tone resist by varying monomer ratio of the polymer and process conditions. The surface property of the resist was also studied to investigate the interaction with rinse solution at the de-protected polymer region. However, a high surfactant concentration in the DI water rinse leads the swelling of the resist pattern profile. The resist component is the key to determine adequate surfactant concentration in rinse solution to minimize line collapse and pattern deformation

  12. 两性畸形外阴整形探讨(附193例)%Investigation of external genital plastic surgery in hermaphroditism

    Institute of Scientific and Technical Information of China (English)

    张恒; 卢根生; 沈文浩; 刘丽梅; 彭大振; 郑霁

    2010-01-01

    Objective To explore the related issues of external genital plastic surgery in hermaphroditism.Methods The data of 193 cases of hermaphroditism who were hospitalized in our department were reviewed and analyzed to summarize our experience of the external genital plastic surgery.Results From March 2005 to December 2009,the medical records and data of follow up of 193 hermaphroditism patients with age ranging from 2 to 38(mean 15 years old) were retrospectively analyzed.Among the 193 patients,73 were female pseudohermaphroditism,80 male pseudohermaphroditism,25 true hermaphroditism,and the other 15 gonadal dysgenesis.128 patients were reared as female and 65 male.138 cases accepted the external genital plastic surgery of female gender.Both the patients and parents were satisfied with the male aedea appearance without enuresis and dysuresia.29 patients were performed colpectasia regularly (6 patients were performed colpoplasty),79 were follow-up,30 were not performed colpoplasty.35 cases accepted the external genital plastic surgery of male gender.The average length of penis was 4.3cm and the urethral orifice was at the balanus after operation.3 cases were performed repairing because of urinary fistula and 4 were performed urethral sounding due to urethral stricture.20 patients were not performed any surgical operation at all.Conclusions It is critical to have a comprehensive consideration including choice of patients and parents of which,dominance gonad,psychological sex and the situation of aedea for the gender selection of hermaphroditism patients.The successful external genital plastic surgery was important to adapt the society for hermaphroditism patients.%目的 探讨两性畸形的外生殖器整形方法 .方法 回顾193例两性畸形的外科治疗资料.结果 193例均住院治疗;年龄2~38岁,平均15岁;社会性别:男:65;女:128.女性假两性畸形73例,男性假两性畸形80例,真两性畸形25例,性腺发育不全15例.分别对138

  13. Chemonuclear studies for identification for new production routes for the therapeutically useful radionuclides {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt, und {sup 195m}Pt; Kernchemische Studien zur Entwicklung neuerer Produktionsverfahren fuer die therapierelevanten Radionuklide {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt, und {sup 195m}Pt

    Energy Technology Data Exchange (ETDEWEB)

    Hilgers, K.

    2005-12-15

    New production routes for the therapeutically useful radionuclides {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt and {sup 195m}Pt were investigated. Cross section data were measured using the stacked-foil technique and compared with theoretical calculations. A production method for the platinum nuclides was developed. The {sup 141}Pr(p, 2n){sup 140}Nd and {sup nat}Ce({sup 3}He, xn){sup 140}Nd reactions were investigated for production of {sup 140}Nd. Cross section data of nuclear reactions leading to the side products {sup 141}Nd, {sup 139}Nd and {sup 139}Ce could also be achieved. The experimental data were compared with theoretical calculations using the code ALICE-IPPE. A comparison of the calculated thick target yields showed that the {sup 141}Pr(p, 2n){sup 140}Nd reaction gives a higher yield. The {sup 192}Os(p, n){sup 192}Ir reaction was examined in the context of the production of {sup 192}Ir. Cross section data were determined and compared with theoretical calculations using the codes ALICE-IPPE and EMPIRE II. The yield of this reaction was compared with the yield of the reactor production of this nuclide. The reactor production seems to be more suitable because of a higher purity and yield. Cross section data were measured for the {sup 192}Os({alpha}, n){sup 195m}Pt, {sup 192}Os({alpha}, 3n){sup 193m}Pt and {sup 192}Os({sup 3}He, 4n){sup 191}Pt reactions. The activity of {sup 193m}Pt and {sup 195m}Pt was determined by X-ray spectroscopy after a chemical separation procedure. The ALICE-IPPE code was found to be inappropriate to reproduce the experimental values. The calculated yields were compared with the yields of other reactions, especially the reactor production of {sup 195m}Pt. The yield of the {sup 192}Os({alpha}, n){sup 195m}Pt reaction is lower compared to the yield of the reactor production, but offers lower target costs and higher specific activity. A production method for {sup 193m}Pt and {sup 195m}Pt was developed. Batch yields of 0.9 MBq

  14. Demethylation of miR-9-3 and miR-193a Genes Suppresses Proliferation and Promotes Apoptosis in Non-Small Cell Lung Cancer Cell Lines

    Directory of Open Access Journals (Sweden)

    Jinliang Wang

    2013-12-01

    Full Text Available Background: MicroRNAs miR-9-3 and miR-193a have recently been found to be hypermethylated in a variety of non-small cell lung cancer (NSCLC cells and primary human tumors. The objectives of this study were to investigate the role of demethylation of miR-9-3 and miR-193a genes in regulating proliferation and apoptosis in NSCLCs, and to decipher the potential mechanisms underlying the properties. Methods: MTT and population doubling time by flow cytometry were used to assess cell proliferation. Enzyme-Linked Immunosorbent Assay and caspase-3 activity assay were employed to evaluate apoptosis. Real-time RT-PCR and Western blot were used to quantify gene expression at mRNA and protein levels, respectively. Methylation-specific PCR was utilized to assess methylation status. Results: We found that demethylation agent 5-Aza-2'-deoxycytidine (5-AzaC reduced cell numbers and prolonged population doubling time (PDT, and promoted doxorubicin-induced apoptosis in seven NSCLC cell lines with different methylation statuses on miR-9-3 and miR-193a promoter regions: NCI-H1993/NCI-H1915 (miR-9-3+/miR-193a+, NCI-H1975/NCI-H200 (miR-9-3+/miR-193a-, A427/NCI-H2073 (miR-9-3-/miR-193a+, and NCI-H1703 (miR-9-3-/miR-193a-. Treatment with 5-AzaC concomitantly upregulated expression of miR-9-3 and miR-193a, and downregulated their respective target genes NF-κB and Mcl-1. The effects of 5-AzaC were abolished by concomitant knockdown of miR-9-3 and miR-193a using the complex antisense technique, whereas forced ectopic expression of miR-9-3 and miR-193a mimicked the effects of 5-AzaC. We further observed that the strength of proliferation inhibition and apoptosis promotion elicited by 5-AzaC was in the order of NCI-H1993/NCI-H1915 > A427/NCI-H2073 > NCI-H1975/NCI-H200 > NCI-H1703. Conclusions: Methylation-silencing of miR-9-3 and miR-193a may be an important epigenetic mechanisms favoring NSCLC cell growth and survival for carcinogenesis and cancer progression, and

  15. Competing C-Br and O-NO Photofission upon Excitation of BrCH2CH2ONO at 193 nm.

    Science.gov (United States)

    Wang, Lei; Scrape, Preston G; Roberts, Trevor D; Joshi, Prakriti P; Butler, Laurie J

    2015-12-17

    This study characterizes two of the primary photodissociation channels of 2-bromoethyl nitrite, BrCH2CH2ONO, at 193 nm and the subsequent unimolecular dissociation channels of the nascent vibrationally excited BrCH2CH2O radicals produced from the O-NO bond photofission. We use a crossed laser-molecular beam scattering apparatus with electron bombardment detection. Upon photodissociation of BrCH2CH2ONO at 193 nm, the measured branching ratio between primary O-NO photofission and C-Br photofission is 3.9:1 (O-NO/C-Br). The measured O-NO photofission recoil kinetic energy distribution (P(ET)) peaks near 30 kcal/mol and extends from 20 to 50 kcal/mol. We use the O-NO photofission P(ET) to characterize the internal energy distribution in the nascent ground-electronic-state BrCH2CH2O radicals. At 193 nm, all of the BrCH2CH2O radicals are formed with enough internal energy to unimolecularly dissociate to CH2Br + H2CO or to BrCH2CHO + H. We also investigated the possibility of the BrCH2CH2O → CH2CHO + HBr reaction arising from the vibrationally excited BrCH2CH2O radicals produced from O-NO primary photodissociation. Signal strengths at HBr(+), however, demonstrate that the vinoxy product does not have HBr as a cofragment, so the BrCH2CH2O → HBr + vinoxy channel is negligible compared to the CH2Br + H2CO channel. We also report our computational prediction of the unimolecular dissociation channels of the vibrational excited CH2CH2ONO radical resulting from C-Br bond photofission. Our theoretical calculations on the ground-state CH2CH2ONO potential energy surface at the G4//B3LYP/6-311++G(3df,2p) level of theory give the energetics of the zero-point corrected minima and transition states. The lowest accessible barrier height for the unimolecular dissociation of CH2CH2ONO is a 12.7 kcal/mol barrier from the cis-ONO conformer, yielding NO2 + ethene. Our measured internal energy distribution of the nascent CH2CH2ONO radicals together with this computational result suggests

  16. Electron Photodetachment from Aqueous Anions. I. Quantum Yields for Generation of Hydrated Electron by 193 and 248 nm Laser Photoexcitation of Miscellaneous Inorganic Anions

    CERN Document Server

    Sauer, M C; Shkrob, I A; Sauer, Myran C.; Shkrob, Ilya A.

    2004-01-01

    Time resolved transient absorption spectroscopy has been used to determine quantum yields for electron photodetachment in 193 nm and (where possible) 248 nm laser excitation of miscellaneous aqueous anions, including hexacyanoferrate(II), sulfate, sulfite, halide anions (Cl-, Br-, and I-), pseudohalide anions (OH-, HS-, CNS-), and several common inorganic anions for which no quantum yields have been reported heretofore: SO3=, NO2-, NO3-, ClO3- and ClO4-. Molar extinction coefficients for these anions and photoproducts of electron detachment from these anions at the excitation wavelengths were also determined. These results are discussed in the context of recent ultrafast kinetic studies and compared with the previous data obtained by product analyses. We suggest using electron photodetachment from the aqueous halide and pseudohalide anions as actinometric standard for time-resolved studies of aqueous photosystems in the UV.

  17. Optimal design and fabrication method for antireflection coatings for P-polarized 193 nm laser beam at large angles of incidence (68°-74°).

    Science.gov (United States)

    Jin, Jingcheng; Jin, Chunshui; Li, Chun; Deng, Wenyuan; Chang, Yanhe

    2013-09-01

    Most of the optical axes in modern systems are bent for optomechanical considerations. Antireflection (AR) coatings for polarized light at oblique incidence are widely used in optical surfaces like prisms or multiform lenses to suppress undesirable reflections. The optimal design and fabrication method for AR coatings with large-angle range (68°-74°) for a P-polarized 193 nm laser beam is discussed in detail. Experimental results showed that after coating, the reflection loss of a P-polarized laser beam at large angles of incidence on the optical surfaces is reduced dramatically, which could greatly improve the output efficiency of the optical components in the deep ultraviolet vacuum range. PMID:24323257

  18. Search for signatures of the supersymmetry in {sup 193}Pt and mixed-symmetric states in {sup 194}Pt by means of γ spectroscopy; Suche nach Signaturen der Supersymmetrie in {sup 193}Pt und gemischt-symmetrischer Zustaende in {sup 194}Pt mittels γ-Spektroskopie

    Energy Technology Data Exchange (ETDEWEB)

    Friessner, Gunnar

    2013-10-14

    After the general renovation of the experimental halls at the Institute for Nuclear Physics in Cologne, the HORUS-Spectrometer was rebuilt within the scope of this thesis. Following this, two experiments were performed to conduct a γγ-angular correlation analysis. The nuclei {sup 194}Pt and {sup 193}Pt were measured to complete existing data and the results are presented in this thesis. Both nuclei were measured in β-decay experiments. The mother nuclei were produced in fusion evaporation reactions. In case of {sup 194}Pt 10 spins were determined experimentally for the first time. 57 multipole mixing ratios were determined. For the nucleus {sup 193}Pt three spins were measured for the first time. After the general renovation a new data acquisition system was set up for experimental measurements. During the measurement of {sup 194}Pt two data acquisitions were used, the ''old'' analog data acquistion and the ''new'' digital data acquisition. A short comparison of those two data acquistion systems for nuclear-physical measurements are shown in this thesis. The aim is to measure permanently with the new digital data acquistion. In the region of the gold and platin isotopes there exist even-even nuclei, which can be described via the Interacting-Boson-Model (IBM) and Interacting-Boson-Model-2 (IBM-2). Odd-A nuclei can be illustrated with the Interacting-Boson-Fermion-Model (IBFM). An application of the IBFM is the U{sub ν}(6/12) x U{sub π}(6/4) supersymmetry, consisting of the nuclei that are described by the same Hamiltonian and one set of parameters. To test predictions of {sup 194}Pt and {sup 193}Pt, multipole-mixing-ratios of γ-transitions and spins were determined. The IBM describes the complex structure of a nucleus in a very simplified way. Very good fits of {sup 194}Pt and {sup 193}Pt in the O(6)-Limits of the IBM could be made. In addition fits of the even-even platin isotopes are shown to discuss the systematics

  19. Fast neutron capture cross sections of 169Tm, 191Ir, 193Ir, and 175Lu for 3 less than or equal to E/sub n/ less than or equal to 2000 keV

    International Nuclear Information System (INIS)

    Fast neutron capture cross sections of 169Tm, 191Ir, 193Ir, and 175Lu, and the 6Li(n,α)3H cross sections to which they are normalized are presented in tabular form for neutron energies between 3 and 2000 keV

  20. Oxalyl chloride, ClC(O)C(O)Cl: UV/vis spectrum and Cl atom photolysis quantum yields at 193, 248, and 351 nm

    Science.gov (United States)

    Ghosh, Buddhadeb; Papanastasiou, Dimitrios K.; Burkholder, James B.

    2012-10-01

    Oxalyl chloride, (ClCO)2, has been used as a Cl atom photolytic precursor in numerous laboratory kinetic and photochemical studies. In this study, the UV/vis absorption spectrum of (ClCO)2 and the Cl atom quantum yields in its photolysis at 193, 248, and 351 nm are reported. The UV/vis spectrum was measured between 200 and 450 nm at 296 K using diode array spectroscopy in conjunction with an absolute cross section obtained at 213.9 nm. Our results are in agreement with the spectrum reported by Baklanov and Krasnoperov [J. Phys. Chem. A 105, 97-103 (2001), 10.1021/jp0019456], which was obtained at 11 discrete wavelengths between 193.3 and 390 nm. Cl atom quantum yields, Φ(λ), were measured using pulsed laser photolysis coupled with time resolved atomic resonance fluorescence detection of Cl. The UV photolysis of (ClCO)2 has been shown in previous studies to occur via an impulsive three-body dissociation mechanism, (COCl)2 + hv → ClCO* + Cl + CO (2), where the excited ClCO radical, ClCO*, either dissociates or stabilizes ClCO* → Cl + CO (3a), → ClCO (3b). ClCO is thermally unstable at the temperatures (253-298 K) and total pressures (13-128 Torr) used in our experiments ClCO + M → Cl + CO + M (4) leading to the formation of a secondary Cl atom that was resolvable in the Cl atom temporal profiles obtained in the 248 and 351 nm photolysis of (ClCO)2. Φ(193 nm) was found to be 2.07 ± 0.37 independent of bath gas pressure (25.8-105.7 Torr, N2), i.e., the branching ratio for channel 2a or the direct formation of 2Cl + 2CO in the photolysis of (ClCO)2 is >0.95. At 248 nm, the branching ratio for channel 2a was determined to be 0.79 ± 0.15, while the total Cl atom yield, i.e., following the completion of reaction (4), was found to be 1.98 ± 0.26 independent of bath gas pressure (15-70 Torr, N2). Φ(351 nm) was found to be pressure dependent between 7.8 and 122.4 Torr (He, N2). The low-pressure limit of the total Cl atom quantum yield, Φ0(351 nm), was 2.05

  1. Nonlinear absorption in single LaF3 and MgF2 layers at 193 nm measured by surface sensitive laser induced deflection technique

    International Nuclear Information System (INIS)

    We report nonlinear absorption data of LaF3 and MgF2 single layers at 193 nm. A highly surface sensitive measurement strategy of the laser induced deflection technique is introduced and applied to measure the absorption of highly transparent thin films independently of the substrate absorption. Linear absorptions k=(αxλ)/4π of 2x10-4 and 8.5x10-4 (LaF3) and 1.8x10-4 and 6.9x10-4 (MgF2) are found. Measured two photon absorption (TPA) coefficients are β=1x10-4 cm/W (LaF3), 1.8x10-5, and 5.8x10-5 cm/W (MgF2). The TPA coefficients are several orders of magnitude higher than typical values for fluoride single crystals, which is likely to result from sequential two step absorption processes.

  2. MicroRNA-193b-3p acts as a tumor suppressor by targeting the MYB oncogene in T-cell acute lymphoblastic leukemia.

    Science.gov (United States)

    Mets, E; Van der Meulen, J; Van Peer, G; Boice, M; Mestdagh, P; Van de Walle, I; Lammens, T; Goossens, S; De Moerloose, B; Benoit, Y; Van Roy, N; Clappier, E; Poppe, B; Vandesompele, J; Wendel, H-G; Taghon, T; Rondou, P; Soulier, J; Van Vlierberghe, P; Speleman, F

    2015-04-01

    The MYB oncogene is a leucine zipper transcription factor essential for normal and malignant hematopoiesis. In T-cell acute lymphoblastic leukemia (T-ALL), elevated MYB levels can arise directly through T-cell receptor-mediated MYB translocations, genomic MYB duplications or enhanced TAL1 complex binding at the MYB locus or indirectly through the TAL1/miR-223/FBXW7 regulatory axis. In this study, we used an unbiased MYB 3'untranslated region-microRNA (miRNA) library screen and identified 33 putative MYB-targeting miRNAs. Subsequently, transcriptome data from two independent T-ALL cohorts and different subsets of normal T-cells were used to select miRNAs with relevance in the context of normal and malignant T-cell transformation. Hereby, miR-193b-3p was identified as a novel bona fide tumor-suppressor miRNA that targets MYB during malignant T-cell transformation thereby offering an entry point for efficient MYB targeting-oriented therapies for human T-ALL. PMID:25231743

  3. The Environmental Protection Agency`s proposed regulation of low level radioactive waste (40 CFR Part 193): A Department of Energy overview

    Energy Technology Data Exchange (ETDEWEB)

    Frangos, T.G. [Dept. of Energy, Washington, DC (United States)

    1989-11-01

    The Department of Energy (DOE) manages one of the world`s largest programs for storage, treatment, and disposal of low-level radioactive wastes. This system with facilities located at sites across the nation has evolved over some forty years in response to changing needs, technologies, and increasing public awareness and concerns for environmental protection. The DOE has operated in a self regulatory mode in most aspects of its low-level waste (LLW) programs. It has been DOE`s policy and practice to provide at least the same level of safety and protection for the public, DOE and contractor employees, and the general environment, as that required by the Nuclear Regulatory Commission for commercial operations. DOE`s policies have been implemented through a management system that historically has been highly decentralized so as to be responsive to the needs of DOE sites which generate a wide variety of wastes at some 25 locations. In addition to concerns with the LLW that it manages, DOE has an interest in the US Environmental Protection Agency`s (EPA) promulgation of 40 CFR Part 193 because of its responsibilities under the Low Level Radioactive Waste Policy Amendments Act (LLRWPAA) to manage certain classes of waste and to assist and encourage the development of interstate compact-managed regional low-level waste disposal sites.

  4. 基于生态事件的企业社会回应研究——以蓬莱19-3油田溢油案为例%Research on Corporate Social Responsiveness Based on Ecological Events: A Case Study of Penglai 19-3 Field Incident in Bohai Bay

    Institute of Scientific and Technical Information of China (English)

    胡建军; 金炜东; 董大勇

    2013-01-01

    企业在生态事件中有效回应社会压力对企业、社会和生态环境的可持续发展具有重要意义.基于企业社会回应的理论与方法,对蓬莱19-3油田溢油事件中康菲公司的企业社会回应进行了深入分析,研究发现企业的社会责任担当、生态环保的立法执法环境、政府处置生态环境事故的效率、社会公众的生态环保意识是企业社会回应有效性的关键影响因素,并从企业内部管理和外部环境建设两方面对提高生态事件中企业社会回应有效性提出建议.%It has important significance for the sustainable development of enterprises, social and ecological environment that Enterprises effectively respond to social pressure in the ecological incident. Based on the theories and methods of corporate social responsiveness, this paper take in-depth analysis of Conoco Phillips China's corporate social responsiveness in Penglai 19-3 field incident in Bohai Bay. The result of our exploration indicates that, corporate social responsibility, legislation and law enforcement environment, the efficiency of government, public awareness of ecological and environmental protection are four decisive factors of corporate social responsiveness in ecological incident. From tow aspects of internal management and external environment construction, this article puts forward suggestions about related policies.

  5. A study of accelerated radiation damage effects in PuO2 and gadolinia-stabilized cubic zirconia, Zr0.79Gd0.14Pu0.07O1.93, doped with 238Pu

    Science.gov (United States)

    Burakov, B. E.; Yagovkina, M. A.

    2015-12-01

    Polycrystalline samples of cubic zirconia, Zr0.79Gd0.14Pu0.07O1.93, doped with approximately 9.9 wt.% 238Pu, and PuO2 containing 11.0 wt. % 238Pu (and main isotope is 239Pu) have been repeatedly studied during many years by X-ray diffraction analysis. At a temperature of 25 °C the unit-cell parameter of PuO2 increases depending on accumulated dose, and is accompanied by decrease of coherent scattering region (CSR). Self-irradiation of Zr0.79Gd0.14Pu0.07O1.93 is accompanied with repeated change of unit-cell parameter and CSR.

  6. FEM for modelling 193 nm excimer laser treatment of SiO{sub 2}/Si/Si{sub (1-x)}Ge{sub x} heterostructures on SOI substrates

    Energy Technology Data Exchange (ETDEWEB)

    Conde, J.C.; Chiussi, S.; Gontad, F.; Gonzalez, P. [Dpto. Fisica Aplicada, E.T.S.I.I. University of Vigo, Campus Universitario, Rua Maxwell s/n, 36310 Vigo (Spain); Martin, E. [Dpto. de Mecanica, Maquinas, Motores Termicos y Fluidos, E.T.S.I.I. University of Vigo, Campus Universitario, Rua Maxwell s/n, 36310 Vigo (Spain)

    2011-03-15

    Research on epitaxial crystalline silicon (c-Si) and silicon-germanium (Si{sub 1-x}Ge{sub x}) alloys growth and annealing for microelectronic purposes, such as Micro- or Nano-Electro-Mechanical Systems (MEMS or NEMS) and Silicon-On-Nothing (SON) devices is continuously in progress. Laser assisted annealing techniques using commercial ArF Excimer Laser sources are based on ultra-rapid heating and cooling cycles induced by the 193 nm pulses of 20 ns, which are absorbed in the near surface region of the heterostructures. During and after the absorption of these laser pulses, complex physical processes appear that strongly depend on sample structure and applied laser pulse energy densities. The control of the experimental parameters is therefore a key task for obtaining high quality alloys. The Finite ElementsMethod (FEM) is a powerful tool for the optimization of such treatments, because it provides the spatial and temporal temperature fields that are produced by the laser pulses. In this work, we have used a FEM commercial software, to predict the temperatures gradients induced by ArF excimer laser over a wide energy densities range, 0.1<{phi}<0.4 J/cm{sup 2}, on different SiO{sub 2}/Si/Si{sub (1-x)}Ge{sub (x)} thin films deposited on SOI substrate. These numerical results allow us to predict the threshold energies needed to reach the melting point (MP) of the Si and SiGe alloy without oxidation of the thin films system. Therefore, it is possible to optimize the conditions to achieve high quality epitaxy films. (copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  7. Process for producing astatine-211 for radiopharmaceutical use

    International Nuclear Information System (INIS)

    A one-step chemical manipulation is described in combination with a distillation and collection process for producing At-211 comprising; a. providing a target of irradiated Bismuth coated to a predetermined thickness of a backing member, b. providing a vapor-producing still operably connected with a condenser that has a water cooled condensate collector formed of a dry silica gel mesh maintained at a temperature above the freezing point of water, and providing an effluent gas filter that is operably connected to receive effluent gas from the condenser, c. heating the target in the still at a temperature in the range of about 6300-6800C for a time period in the range of 50 to 80 minutes, to evole At-211 vapor from the target, c. providing a dry carrier gas having an oxygen concentration that is sufficient to form Bi/sub 2/O/sub 3/ thereby to essentially preclude vaporization of Bi metal, passing the carrier gas through the still to carry the At-211 vapor to the condenser, and to carry effluent from the condenser to the effluent gas filter, e. eluting At-211 from the condensate collector of the condenser with a controlled volume of eluent containing predetermined solvents that are compatible with a given desired radiopharmaceutical procedure, and f. collecting the At-211 in the controlled volume of eluent for use in the given radiopharmaceutical procedure

  8. Information Disclosure in Marine Pollution Emergencies-A Case Study of Penglai 19-3 Oil Spill Incident%海洋污染突发事件中的信息公开问题研究以蓬莱19-3油田漏油事件为例

    Institute of Scientific and Technical Information of China (English)

    李桂东; 彭婧

    2015-01-01

    Information disclosure is the first step of marine pollution emergency treatment. Timely and comprehensive disclo-sure of real environmental information is not only the guarantee for the public to safeguard their interests of health and property against marine pollution incidents and actively participation in accident treatment,but also a necessary condition for the public to supervise the enterprise and relevant government departments handling the incident. The Penglai 19-3 oil spill incident had serious impacts on the marine ecology and fishery production in Bohai Sea. The primary reason is that the relevant responsibility subjects failed to completely perform their information disclosure obligations so as to delay the optimal timing in handling the incident. The Penglai 19-3 oil spill incident has exposed many problems in China’s marine pollution emergencies in information disclosure:buck-passing between publicity subjects,delaying information disclosure,disclosure of unreal information content and negative mainstream media responses. In order to improve China’s environmental information disclosure system,we must promote information disclosure legislation,establish emergency response platform,establish publicity mode of environmental information protocols between enterprises and media,and improve the responsibility mechanism of environmental information disclosure.%信息公开是海洋污染突发事件治理的第一步。及时、全面、真实的环境信息公开不仅是海洋污染突发事件发生后公众维护健康、财产等权益以及积极有效参与事故处理的前提,同时也是公众监督企业和相关部门事故处理力度的必要条件。蓬莱19–3油田漏油事件给渤海海洋生态和渔业生产造成了严重影响,其重要原因在于漏油事件中的相关责任主体未能完全履行信息公开义务,贻误了事件的处理时机。该事件暴露出目前我国海洋污染突发事件信息公开存在

  9. Hydrogen Migration and Vinylidene Pathway for Formation of Methane in the 193 nm Photodissociation of Propene: CH3CH=CH2 and CD3CD=CD2

    Science.gov (United States)

    Zhao, Yi-Lei; Laufer, Allan H.; Halpern, Joshua B.; Fahr, Askar

    2007-01-01

    Photodissociation channels and the final product yields from the 193 nm photolysis of propene-h6 (CH2=CHCH3) and propene-d6 (CD2=CDCD3) have been investigated, employing gas chromatography, mass spectroscopy, and flame ionization (GC/MS/FID) detection methods. The yields of methane as well as butadiene relative to ethane show considerable variations when propene-h6 or propene-d6 are photolyzed. This suggests significant variances in the relative importance of primary photolytic processes and/or secondary radical reactions, occurring subsequent to the photolysis. Theoretical calculations suggest the potential occurrence of an intramolecular dissociation through a mechanism involving vinylidene formation, accompanied by an ethylenic H-migration through the pi-orbitals. This process affects the final yields of methane-h4 versus methane-d4 with respect to other products. The product yields from previous studies of the 193 nm photolysis of methyl vinyl ketone-h6 and -d6 (CH2=CHCOCH3, CD2=CDCOCD3), alternative precursors for generating methyl and vinyl radicals, are compared with the current results for propene.

  10. Comparison of the terminal ballistics of full metal jacket 7.62-mm M80 (NATO) and 5.56-mm M193 military bullets: a study in ordnance gelatin.

    Science.gov (United States)

    Ragsdale, B D; Sohn, S S

    1988-05-01

    Great controversy has surrounded the replacement of the 7.62-mm caliber by the reduced 5.56-mm caliber as the standard U.S. military rifle. Although its relevance to human wounding can be debated, the terminal ballistics of military small arms in ordnance gelatin remains a convenient medium for comparative testing. In the present study, 7- by 10- by 24-in. (18 by 25 by 61 cm) blocks of 20% ordnance gelatin were fired upon from a range of 19 ft (6 m) under high-speed cinemagraphic surveillance. The tendency of the M193 5.56-mm full metal jacket projectile to break up in soft tissue simulant was confirmed as a fundamental difference from the 7.62-mm M80 NATO ball. PMID:3385379

  11. Preliminary characterisation of new glass reference materials (GSA-1G, GSC-1G, GSD-1G and GSE-1G) by laser ablation-inductively coupled plasma-mass spectrometry using 193 nm, 213 nm and 266 nm wavelengths

    Science.gov (United States)

    Guillong, M.; Hametner, K.; Reusser, E.; Wilson, S.A.; Gunther, D.

    2005-01-01

    New glass reference materials GSA-1G, GSC-1G, GSD-1G and GSE-1G have been characterised using a prototype solid state laser ablation system capable of producing wavelengths of 193 nm, 213 nm and 266 nm. This system allowed comparison of the effects of different laser wavelengths under nearly identical ablation and ICP operating conditions. The wavelengths 213 nm and 266 nm were also used at higher energy densities to evaluate the influence of energy density on quantitative analysis. In addition, the glass reference materials were analysed using commercially available 266 nm Nd:YAG and 193 nm ArF excimer lasers. Laser ablation analysis was carried out using both single spot and scanning mode ablation. Using laser ablation ICP-MS, concentrations of fifty-eight elements were determined with external calibration to the NIST SRM 610 glass reference material. Instead of applying the more common internal standardisation procedure, the total concentration of all element oxide concentrations was normalised to 100%. Major element concentrations were compared with those determined by electron microprobe. In addition to NIST SRM 610 for external calibration, USGS BCR-2G was used as a more closely matrix-matched reference material in order to compare the effect of matrix-matched and non matrix-matched calibration on quantitative analysis. The results show that the various laser wavelengths and energy densities applied produced similar results, with the exception of scanning mode ablation at 266 nm without matrix-matched calibration where deviations up to 60% from the average were found. However, results acquired using a scanning mode with a matrix-matched calibration agreed with results obtained by spot analysis. The increased abundance of large particles produced when using a scanning ablation mode with NIST SRM 610, is responsible for elemental fractionation effects caused by incomplete vaporisation of large particles in the ICP.

  12. 18 June 2012 - DST Global Founder Y. Milner signing the guest book with Head of International Relations F. Pauss; visiting the AD facility in building 193 with AEGIS Collaboration Spokesperson M. Doser and Adviser for the Russian Federation T. Kurtyka. Managing Director I. Osborne also present with Mrs J. Milner and DST Global A. Lebedkina.

    CERN Multimedia

    Maximilien Brice

    2012-01-01

    18 June 2012 - DST Global Founder Y. Milner signing the guest book with Head of International Relations F. Pauss; visiting the AD facility in building 193 with AEGIS Collaboration Spokesperson M. Doser and Adviser for the Russian Federation T. Kurtyka. Managing Director I. Osborne also present with Mrs J. Milner and DST Global A. Lebedkina.

  13. Ablation behavior and constraints on the U–Pb and Th–Pb geochronometers in titanite analyzed by quadrupole inductively coupled plasma mass spectrometry coupled to a 193 nm excimer laser

    International Nuclear Information System (INIS)

    U–Th–Pb geochronology of titanite by laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) is a promising technique to constrain the history of igneous and metamorphic rocks. However, the quality of the resulting ages depends strongly on protocol adopted for the analyses and data reduction. There is no general agreement on the laser ablation settings and methodology that should be applied for titanite LA-ICP-MS geochronology. In particular it is essential to define an analytical procedure that could minimize the elemental fractionation for titanite U–Th–Pb geochronology, and to evaluate if non matrix-matched standards and samples (e.g. zircon and titanite) are suitable to obtain precise and accurate ages. In this study, ablation experiments were carried out in spot mode using an ArF 193 nm excimer laser coupled to a quadrupole ICP-MS, with varying fluence, spot size and repetition rate conditions. The ablation behavior of the Khan titanite reference material was described in details and compared to the Plešovice zircon standard. The ratio-of-the-mean intensity method was used for data reduction. Three sources of fractionation and systematic errors between zircon and titanite are considered together: mass bias coefficients, shape of the time-dependent fractionation, and differences of ablated volumes. Even if the laser-induced elemental fractionation and matrix effects can be minimized between the Plešovice zircon standard and the Khan titanite, a matrix-matched standardization with a titanite standard is required for precise U–Th–Pb titanite ages, as well as at low frequency and fluence conditions. - Highlights: • This study presents ablation experiments on Khan titanite compared Plešovice zircon. • Matrix effects related to laser induced elemental fractionation are monitored. • Low frequency and fluence conditions are required for precise U–Th–Pb titanite data. • The Khan titanite can hardly be substituted by a zircon

  14. 49 CFR 572.193 - Neck assembly.

    Science.gov (United States)

    2010-10-01

    ... environment as specified in 49 CFR 572.200(j); (2) Attach the neck-headform assembly, as shown in Figure V2-A or V2-B in appendix A to this subpart, to the 49 CFR Part 572 pendulum test fixture (Figure 22, 49 CFR 572.33) in either the left or right lateral impact orientations, respectively, so that...

  15. 46 CFR 193.50-10 - Location.

    Science.gov (United States)

    2010-10-01

    ... units B-IIB-V B-V 2 required. 3 1 required. 4 Internal combustion or gas turbine propelling machinery...,7 Electric propulsive motors or generators of open type C-II 1 for each propulsion motor or... required. Auxiliary spaces: Internal combustion gas turbine B-II 1 outside the space in vicinity of exit....

  16. 27 CFR 19.3 - Related regulations.

    Science.gov (United States)

    2010-04-01

    ... Administration Act. 27 CFR part 2—Nonindustrial Use of Distilled Spirits and Wine. 27 CFR part 3—Bulk Sales and Bottling of Distilled Spirits. 27 CFR part 4—Wine Labeling and Advertising. 27 CFR part 5—Labeling and.... 27 CFR part 24—Wine. 27 CFR part 26—Liquors and Articles from Puerto Rico and the Virgin Islands....

  17. QTL Information Table: 193 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available Physiological trait Source activity Rubisco protein ... content at 25days after heading RFLP C)Inter ... hsugi, R. (2001). Are contents of Rubisco, soluble protein ... and nitrogen in flag leaves of rice controlled by ...

  18. Optimization on magnetic anisotropy and magnetostriction in Tb{sub x}Ho{sub 0.8−x}Pr{sub 0.2}(Fe{sub 0.8}Co{sub 0.2}){sub 1.93} compounds

    Energy Technology Data Exchange (ETDEWEB)

    Liu, X.Y. [Faculty of Materials Science & Chemical Engineering, Ningbo University, Ningbo 315211 (China); Liu, J.J., E-mail: liujinjun1@nbu.edu.cn [Faculty of Materials Science & Chemical Engineering, Ningbo University, Ningbo 315211 (China); Pan, Z.B.; Song, X.H.; Zhang, Z.R. [Faculty of Materials Science & Chemical Engineering, Ningbo University, Ningbo 315211 (China); Du, J. [Ningbo Institute of Materials Technology & Engineering, Chinese Academy of Sciences, Ningbo 315201 (China); Ren, W.J. [Shenyang National Laboratory for Materials Science, Institute of Metal Research, Chinese Academy of Sciences, Shenyang 110016 (China)

    2015-10-01

    The structure, magnetocrystalline anisotropy compensation, magnetic properties, and magnetostriction of Tb{sub x}Ho{sub 0.8–x}Pr{sub 0.2}(Fe{sub 0.8}Co{sub 0.2}){sub 1.93} (0≤x≤0.30) polycrystalline alloys have been investigated. X-ray diffraction (XRD) analysis shows that all the alloys stabilize in the single Laves phase with a MgCu{sub 2}-type cubic structure. The lattice parameter, Curie temperature and saturation magnetization monotonically increase with increasing Tb content. The easy magnetization direction (EMD) at room temperature is detected rotating from the <100> axis (x≤0.10) to the <111> axis (x≥0.15), accompanied by a rhombohedral distortion with large spontaneous magnetostriction coefficients λ{sub 111}. The analysis of XRD, EMD and magnetostriction shows that Tb{sub x}Ho{sub 0.8–x}Pr{sub 0.2}(Fe{sub 0.8}Co{sub 0.2}){sub 1.93} is an anisotropy compensation system, and the critical compensation point is realized around x=0.15, which shifts to the Tb-poor side compared with the Pr-free counterpart. An optimized effect on magnetostriction especially at a relatively low field (λ{sub S}~445 ppm, λ{sub a}~510 ppm/3 kOe) was obtained in Tb{sub 0.15}Ho{sub 0.65}Pr{sub 0.2}(Fe{sub 0.8}Co{sub 0.2}){sub 1.93} compound, which is much larger than that of the Pr-free counterpart Tb{sub 0.15}Ho{sub 0.85}(Fe{sub 0.8}Co{sub 0.2}){sub 1.93} (λ{sub S}~300 ppm) and the Tb{sub 0.15}Ho{sub 0.85}Fe{sub 2} (λ{sub S}~325 ppm), due to the 20 at% Pr introduction. Low content of heavy rare earth Tb, low anisotropy, high saturation magnetostriction and large low-field magnetostriction are obtained in Tb{sub 0.15}Ho{sub 0.65}Pr{sub 0.2}(Fe{sub 0.8}Co{sub 0.2}){sub 1.93} compound, which may make it a promising magnetostrictive material. - Highlights: • The minimum anisotropy is realized around x=0.15. • EMD at RT is detected rotating from <100> to <111> axis with increasing Tb content. • A large saturation magnetostriction (λ{sub S}~445 ppm) is obtained

  19. Evaluation of a Wet Chemistry Method for Isolation of Cyclotron Produced [211At]Astatine

    Directory of Open Access Journals (Sweden)

    Shigeki Watanabe

    2013-09-01

    Full Text Available A “wet chemistry” approach for isolation of 211At from an irradiated bismuth target is described. The approach involves five steps: (1 dissolution of bismuth target in conc. HNO3; (2 removal of the HNO3 by distillation; (3 dissolution of residue in 8 M HCl; (4 extraction of 211At from 8 M HCl into DIPE; and (5 extraction of 211At from DIPE into NaOH. Results from 55 “optimized” 211At isolation runs gave recovery yields of approximately 78% after decay and attenuation corrections. An attenuation-corrected average of 26 ± 3 mCi in the target provided isolated (actual yields of 16 ± 3 mCi of 211At. A sixth step, used for purification of 211At from trace metals, was evaluated in seven runs. In those runs, isolated 211At was distilled under reductive conditions to provide an average 71 ± 8% recovery. RadioHPLC analyses of the isolated 211At solutions, both initial and after distillation, were obtained to examine the 211At species present. The primary species of 211At present was astatide, but astatate and unidentified species were also observed. Studies to determine the effect of bismuth attenuation on 211At were conducted to estimate an attenuation factor (~1.33 for adjustment of 211At readings in the bismuth target.

  20. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  1. Astatination of nanoparticles containing silver as possible carriers of 211At

    Czech Academy of Sciences Publication Activity Database

    Lebeda, Ondřej; Kučka, Jan; Hrubý, Martin; Koňák, Čestmír; Kozempel, Ján

    2006-01-01

    Roč. 64, - (2006), s. 201-206. ISSN 0969-8043 R&D Projects: GA AV ČR KJB4048302; GA AV ČR KJB4050408 Institutional research plan: CEZ:AV0Z1048901 Keywords : nanoparticles * 211AT * Atalpha particle therapy Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.924, year: 2006

  2. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  3. 37 CFR 2.193 - Trademark correspondence and signature requirements.

    Science.gov (United States)

    2010-07-01

    ... who has an actual written or verbal power of attorney or an implied power of attorney from the owner... advocating) of any document by any person, whether a practitioner or non-practitioner, constitutes a... questions the authority of a person who signs a communication that merely transmits paper documents....

  4. Dicty_cDB: SLF193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TTAAATTATATCAAACCTTTTTTTTTTTTTTTTTTTTTTTAATAANCAAAATAAATAAAT AAAAAAATAAAAAAAAAATAAAAAAAATAAAAAAATGAGTGX...ifi*iisnlfffffffnxqnk*ikk*KKNKKNKKMS--- ---GXXGGXXVXXXXGLGGXAAGXXGGLVGXXXGXGGGFFCXXXXXAXXXHXXXXXVFPP PPPPXXX...Amino Acid sequence (All Frames) Frame A: rtrgfcffffiylkkkdniylnyikpfffffff**xk*inkkikkk*kk*kne--- ---ggxgggxrxxxxgfgxvxxgxxgxvgggx...grxgxglflxxxxrcxxxxfxgxxgfpp ppppxxxfxnfxxfffxxxxxffxxkkkxkkkkkkkkkkkkkkkkkxkkkkkkkkk...kkkg rarf*rdpkltyaxha Frame B: grvgfvffflyi*kkkiifi*iisnlfffffffnxqnk*ikk*KKNKKNKKMS--- ---GXXGGX

  5. 32 CFR 193.4 - Authorities and responsibilities.

    Science.gov (United States)

    2010-07-01

    ... utilization of such highways by military vehicles. (7) Provide highway traffic engineering services to DoD... Army, as the Single Manager for Military Traffic, Land Transportation, and Common-User Ocean Terminals (see DoD Directive 5160.53, Single Manager Assignment for Military Traffic, Land Transportation,...

  6. 34 CFR 668.193 - Loan servicing appeals.

    Science.gov (United States)

    2010-07-01

    ... identifies a sample that is large enough to derive an estimate, acceptable at a 95 percent confidence level... EDUCATION, DEPARTMENT OF EDUCATION STUDENT ASSISTANCE GENERAL PROVISIONS Two Year Cohort Default Rates § 668... that the FFEL Program lender or the Direct Loan Servicer, as defined in 34 CFR 685.102, failed...

  7. 14 CFR 193.11 - What is the notice procedure?

    Science.gov (United States)

    2010-01-01

    ... designation under this section, based either on your application or the FAA's own initiative, the FAA... receipt of that type of information aids in fulfilling the FAA's safety and security responsibilities. (5... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false What is the notice procedure?...

  8. 40 CFR 265.193 - Containment and detection of releases.

    Science.gov (United States)

    2010-07-01

    ... requirements of 40 CFR part 302. (d) Secondary containment for tanks must include one or more of the following... section or an internal inspection or other tank integrity examination by a qualified Professional Engineer... to be assessed. Note: The practices described in the American Petroleum Institute (API)...

  9. 40 CFR 264.193 - Containment and detection of releases.

    Science.gov (United States)

    2010-07-01

    ..., it may be subject to the reporting requirements of 40 CFR part 302.] (d) Secondary containment for... assessment of the overall condition of the tank system by a qualified Professional Engineer. The schedule and... conducted at least annually. [Note: The practices described in the American Petroleum Institute...

  10. Dicty_cDB: CHI193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4237_196( AP004237 |pid:none) Proteus vulgaris plasmid Rts1 DN... 35 2.6 AJ698720_112( AJ698720 |pid:none) Yersinia pestis... ltkfqcirlylllkimnmsngnmh*itrisfsliiy*l*levsiqpmtvlnvrivh*ysh liyqifqnlisliqstmiqvtkldt*ksrvien*vieh*lvhvvvr...vqlmnihqlvlklv iv*ilekmenl Frame B: *fsfti*q***lfkmgnllshtygvpsiisiiiivsssifliilkkdkqkyinnqinnqi nnqivpeisnn...5 11 L36897 |L36897.1 Saccharomyces cerevisiae mitochondrion oxi3 gene, aapI gene, oli2 gene, ORF4, replication of origin (ori...dwytikgsknigrfrrnvqss*styy*y *pssnvfdctcy*k**i*ameicik*qgyhfh**sidcnwkfqsnl*qs*m*esyinihi *ftrysrisflsfnll*sk*qs*ilkslg**kikl*si

  11. Study of stress birefringence for 193-nm immersion photomasks

    Science.gov (United States)

    Cotte, Eric; Selle, Michael; Bubke, Karsten; Teuber, Silvio

    2005-06-01

    The goal of the present study was to investigate and quantify reticle stress birefringence in exposure conditions. Birefringence can arise in fused silica photomask substrates due to their state of stress, and cause optical effects such as phase front distortion, ray bifurcation, and polarization changes. These effects potentially produce image blurring and illumination non-uniformity, leading to lower resolution and CD variations, respectively. The main sources of substrate stress studied were the absorber stack, the mounting of a pellicle, and the impact of initial reticle bow when chucking in an exposure tool. Jones calculus was used to relate birefringence at discrete locations in the reticle, derived from the state of stress, to the net birefringence experienced by light passing through the mask. Experimentally-obtained birefringence data as well as analytical calculations of stress birefringence caused by known states of stress were used to validate the models. These results can then be compared to photomask birefringence specifications or employed in optical simulations to determine the precise impact of this substrate stress birefringence.

  12. 46 CFR 193.10-10 - Fire hydrants and hose.

    Science.gov (United States)

    2010-10-01

    ... shall be limited to any position from the horizontal to the vertical pointing downward, so that the hose... a garden hose nozzle that is bronze or metal with strength and corrosion resistance equivalent...

  13. Dicty_cDB: SFL193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available skt*m*m**sw*kmlcxdsl**sl*frlwxrf*mxn*t*wfrxlcpfrktx xttt*km**xmptrp*mxsxstwkrmlrccpxttxkmlfkmsxkt*m*sqplw*rm...GVKXXP*ixvh*rxphxheckvdpngkemlrqip*ttt trslfikmpskt*m*m**sw*kmlcxdsl**sl*frlwxrf*mxn*t*wfrxlcpfrktx xttt*km*...l *ryi*ylyi*k*ll*kfiq*psc*sik*mlqs*wiy*nynsnrvflf*cqd*rmclir*i m*fpkxllfksnfllpr*inl*rfklw--- ---*rcppnhexrf...ndqxhqxwgkgspmnxcsltxxxxp*m*s*sqw*rnvasdpidhhh qkfvh*dalqnmnvnvmimvknvvxrfivmkfvi*ivvevlnv*ldmmvqxvvsvqkdxt

  14. Dicty_cDB: VSJ193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qfqninlmklqkk lqlmkrikle*vivqfvyvnsqsiqkh*nyhvniifimnv*ipg*kllllvqtvvihyrq lmlnmnqwle*leimn*kmvqlivrqppiitmt...*ilkelnlh*nidqyhqfqninlmklqkk lqlmkrikle*vivqfvyvnsqsiqkh*nyhvniifimnv*ipg*kllllv...liikkkk*ilkelnlh*nidqyhqfqninlmkl qkklqlmkrikle*vivqfvyvnsqsiqkh*nyhvniifimnv*ipg*kllllvqtvvih yrqlmlnmnqwle

  15. Technological characterization and survival of the exopolysaccharide- producing strain Lactobacillus delbrueckii subsp. lactis 193 and its bile-resistant derivative 193+ in simulated gastric and intestinal juices

    OpenAIRE

    Burns, Patricia; Vinderola, Gabriel; Reinheimer, Jorge A.; Cuesta Suárez, Isabel; González de los Reyes-Gavilán, Clara; Ruas-Madiedo, Patricia

    2011-01-01

    The capacity of lactic acid bacteria to produce exopolysaccharides (EPS) conferring microorganisms a ropy phenotype could be an interesting feature from a technological point of view. Progressive adaptation to bile salts might render some lactobacilli able to overcome physiological gut barriers but could also modify functional properties of the strain, including the production of EPS. In this work some technological properties and the survival ability in simulated gastrointestinal conditions ...

  16. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  17. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE,CERN

    OpenAIRE

    Rothe, Sebastian

    2012-01-01

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spec...

  18. Inactivation of human osteosarcoma cells in vitro by {sup 211}At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, R.H. [Univ. of Oslo (Norway)]|[Institute for Cancer Research, Oslo (Norway); Bruland, O.S. [Institute for Cancer Research, Oslo (Norway); Hoff, P.; Alstad, J. [Univ. of Oslo (Norway); Lindmo, T. [Institute for Cancer Research, Oslo (Norway); Rofstad, E.K. [Norwegian Institute of Technology, Trondheim (Norway)

    1994-08-01

    The potential usefulness of {alpha}-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) {sup 211}At-TP-3 of different specific activities, (b) {sup 211}At-labeled bovine serum albumin (BSA), (c) free {sup 211}At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, {sup 211}At-BSA or free {sup 211}At. The D{sub o}`s were lower for free {sup 211}At than for {sup 211}At-BSA. The survival curves for {sup 211}At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to {sup 211}At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to {sup 211}At-TP-3 treatment was the antigen expression. Cell inactivation after {sup 211}At-TP-3 treatment increased substantially with increasing specific activity of the {sup 211}At-TP-3. At high specific activities, the cytotoxic effect of {sup 211}At-TP-3 was significantly higher than that of {sup 211}At-BSA. In conclusion, {sup 211}At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs.

  19. 19 CFR 19.3 - Bonded warehouses; alterations; relocation; suspensions; discontinuance.

    Science.gov (United States)

    2010-04-01

    ..., and dates and places of birth of all persons employed by the proprietor in the carriage, receiving... and places of birth of any new personnel employed by him in the carriage, receiving, storage, or... obey any proper order of a Customs officer or any Customs order, rule, or regulation relative to...

  20. Cycloolefin/cyanoacrylate (COCA) copolymers for 193-nm and 157-nm lithography

    Science.gov (United States)

    Dammel, Ralph R.; Sakamuri, Raj; Lee, Sang-Ho; Rahman, Dalil; Kudo, Takanori; Romano, Andrew R.; Rhodes, Larry F.; Lipian, John-Henry; Hacker, Cheryl; Barnes, Dennis A.

    2002-07-01

    The copolymerization reaction between methyl cyanoacrylate (MCA) and a variety of cycloolefins (CO) was investigated. Cycololefin/cyanoacrylate (COCA) copolymers were obtained in good yields and with lithographically interesting molecular weights for all cycoolefins studied. Anionic MCA homopolymerization could be largely suppressed using acetic acid. Based on NMR data, the copolymerization may tend to a 1:1 CO:MCA incorporation ratio but further work with better suppression of the anionic component is needed to confirm this. Lithographic tests on copolymers of appropriately substituted norbornenes and MCA showed semi-dense and isolated line performance down to 90 nm.

  1. Chemical and structural modifications in a 193-nm photoresist after low-k dry etch

    International Nuclear Information System (INIS)

    Wet processes are gaining renewed interest for the removal of post-etch photoresist on porous dielectrics in semiconductor manufacturing. However, specifications on material loss and k-value integrity considerably reduce formulation space for a purely wet-chemical clean. Hence characterization of photoresist degradation by etch is needed to support the selection of wet cleaning chemistries. In this work, the degradation of a DUV (deep ultra-violet) photoresist by a dielectric etch plasma is characterized by spectroscopic as well as by polymer science characterization techniques. Results show that degradation of the DUV photoresist under study does not follow the mechanisms previously proposed for etched DUV photoresist films, but is rather comparable to the degradation of PMMA under low energy radiation. Degradation is more intense in the photoresist top layer, forming a cross-linked crust that is insoluble in organic solvents. Based on FTIR and 1H NMR analysis of isolated crust samples, a cross-linking mechanism is proposed that is based on the reaction between intra-chain radicals and/or between intra-chain radicals and end-chain propagating radicals. Implications for the wet removal of photoresist layers are discussed

  2. Conformational and aggregation properties of the 1-93 fragment of apolipoprotein A-I

    DEFF Research Database (Denmark)

    Petrlova, Jitka; Bhattacherjee, Arnab; Boomsma, Wouter Krogh;

    2014-01-01

    Several disease-linked mutations of apolipoprotein A-I, the major protein in high-density lipoprotein (HDL), are known to be amyloidogenic, and the fibrils often contain N-terminal fragments of the protein. Here, we present a combined computational and experimental study of the fibril-associated ......Several disease-linked mutations of apolipoprotein A-I, the major protein in high-density lipoprotein (HDL), are known to be amyloidogenic, and the fibrils often contain N-terminal fragments of the protein. Here, we present a combined computational and experimental study of the fibril...... these conformational shifts match well with the effects of these mutations in thioflavin T fluorescence and transmission electron microscopy experiments. Together, our results point to molecular mechanisms that may have a key role in disease-linked aggregation of apolipoprotein A-I....

  3. 1935 15' Quad #193 Aerial Photo Mosaic Index - 2 of 2

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  4. 1935 15' Quad #193 Aerial Photo Mosaic Index - 1 of 2

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  5. [HIV infection in tuberculosis patients in Madagascar. Situation in 1-93].

    Science.gov (United States)

    Morvan, J M; Auregan, G; Rasamindrakotroka, A J; de Ravel, T; Roux, J F

    1994-01-01

    In Madagascar, the estimated incidence of tuberculosis is high (320 per 100,000) when human immunodeficiency virus (VIH) infection progress slowly. The authors have studied HIV seroprevalence in a group of tubercular patients and in two reference groups (general population and outpatients of the Clinical Biology Centre of Institut Pasteur). Circulation of HIV1 virus was observed with a low prevalence rate in all the 3 groups. There was no significant difference between tubercular patients and healthy population. Tubercular people ought to be a watch group for the epidemiological surveillance of HIV infection evolution in Madagascar. PMID:7575038

  6. 31 CFR 103.193 - Special measures against Banco Delta Asia.

    Science.gov (United States)

    2010-07-01

    ... FINANCIAL RECORDKEEPING AND REPORTING OF CURRENCY AND FOREIGN TRANSACTIONS Anti-Money Laundering Programs...-money laundering program requirement; (viii) A broker or dealer in securities registered, or required to... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Special measures against Banco...

  7. The art of photomask materials for low-k1-193nm lithography

    Science.gov (United States)

    Hashimoto, Masahiro; Iwashita, Hiroyuki; Mitsui, Hideaki

    2009-04-01

    The resolution of photomask patterns were improved with a hardmask (HM) system. The system which is thin Sicompounds layer is easily etched by the hyper-thin resist (below 100nm thickness). The HM material has sufficient etching selectivity against the chrome-compounds which is the second layer chrome absorber for the phase-shifter. This hardmask layer has been completely removed during the phase-shifter etching. It means that the conventional phase-shit mask (PSM) has been made with the ultimately high-resolution without configuration changes. Below 50nm resolution of PSM was made with 90nm thickness resist on HM layer in this paper. The CD bias between a resist feature CD and a chrome feature CD was almost zero (below 1nm) in the optimized etching condition. We confirmed that the mask performances were the equal to COMS (Cr-HM on MoSi binary mask) in resolution and CD linearity. The performances of hardmask blanks will be defined by resist performance because of almost zero bias.

  8. Yeast Interacting Proteins Database: YER022W, YBR193C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available n prey (YPD) 15 Literature shared by bait and prey 10 Literature sharing score 50... CuraGen (0 or 1) 0 S. Fields (0 or 1) 0 Association (0 or 1,YPD) 1 Complex (0 or 1,YPD) 1 Synthetic lethali

  9. Microstructure-related properties of magnesium fluoride films at 193nm by oblique-angle deposition.

    Science.gov (United States)

    Guo, Chun; Kong, Mingdong; Lin, Dawei; Liu, Cunding; Li, Bincheng

    2013-01-14

    Magnesium fluoride (MgF2) films deposited by resistive heating evaporation with oblique-angle deposition have been investigated in details. The optical and micro-structural properties of single-layer MgF2 films were characterized by UV-VIS and FTIR spectrophotometers, scanning electron microscope (SEM), atomic force microscope (AFM), and x-ray diffraction (XRD), respectively. The dependences of the optical and micro-structural parameters of the thin films on the deposition angle were analyzed. It was found that the MgF2 film in a columnar microstructure was negatively inhomogeneous of refractive index and polycrystalline. As the deposition angle increased, the optical loss, extinction coefficient, root-mean-square (rms) roughness, dislocation density and columnar angle of the MgF2 films increased, while the refractive index, packing density and grain size decreased. Furthermore, IR absorption of the MgF2 films depended on the columnar structured growth. PMID:23388989

  10. 46 CFR 193.15-5 - Quantity, pipe sizes, and discharge rates.

    Science.gov (United States)

    2010-10-01

    ... shall be taken as exclusive of the normal machinery casing unless the boiler, internal combustion... combustion propulsion machinery shall be as given by paragraphs (d)(1) and (2) of this section or by dividing... amount of carbon dioxide shall be complete within 2 minutes....

  11. SU-E-J-193: Feasibility of MRI-Only Based IMRT Planning for Pancreatic Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Prior, P; Botros, M; Chen, X; Paulson, E; Erickson, B; Li, X [Medical College of Wisconsin, Milwaukee, WI (United States)

    2014-06-01

    Purpose: With the increasing use of MRI simulation and the advent of MRI-guided delivery, it is desirable to use MRI only for treatment planning. In this study, we assess the dosimetric difference between MRI- and CTbased IMRT planning for pancreatic cancer. Methods: Planning CTs and MRIs acquired for a representative pancreatic cancer patient were used. MRI-based planning utilized forced relative electron density (rED) assignment of organ specific values from IRCU report 46, where rED = 1.029 for PTV and a rED = 1.036 for non-specified tissue (NST). Six IMRT plans were generated with clinical dose-volume (DV) constraints using a research Monaco planning system employing Monte Carlo dose calculation with optional perpendicular magnetic field (MF) of 1.5T. The following five plans were generated and compared with the planning CT: 1.) CT plan with MF and dose recalculation without optimization; 2.) MRI (T2) plan with target and OARs redrawn based on MRI, forced rED, no MF, and recalculation without optimization; 3.) Similar as in 2 but with MF; 4.) MRI plan with MF but without optimization; and 5.) Similar as in 4 but with optimization. Results: Generally, noticeable differences in PTV point doses and DV parameters (DVPs) between the CT-and MRI-based plans with and without the MF were observed. These differences between the optimized plans were generally small, mostly within 2%. Larger differences were observed in point doses and mean doses for certain OARs between the CT and MRI plan, mostly due to differences between image acquisition times. Conclusion: MRI only based IMRT planning for pancreatic cancer is feasible. The differences observed between the optimized CT and MRI plans with or without the MF were practically negligible if excluding the differences between MRI and CT defined structures.

  12. Hepatic injury after nonmyeloablative conditioning followed by allogeneic hematopoietic cell transplantation: a study of 193 patients.

    Science.gov (United States)

    Hogan, William J; Maris, Michael; Storer, Barry; Sandmaier, Brenda M; Maloney, David G; Schoch, H Gary; Woolfrey, Ann E; Shulman, Howard M; Storb, Rainer; McDonald, George B

    2004-01-01

    Liver injury is a frequent, serious complication of allogeneic hematopoietic cell transplantation (HCT) following myeloablative preparative regimens. We sought to determine the frequency and severity of hepatic injury after nonmyeloablative conditioning and its relationship to outcomes. One hundred ninety-three consecutive patients who received 2 Gy total body irradiation with or without fludarabine were evaluated for end points related to liver injury. Patients with diseases treatable by HCT who were ineligible for conventional myeloablative allogeneic HCT because of advanced age and/or comorbid conditions were included. Fifty-one patients (26%) developed hyperbilirubinemia of 68.4 microM (4 mg/dL) or greater, most commonly resulting from cholestasis due to graft-versus-host disease (GVHD) or sepsis. Pretransplantation factors associated with liver dysfunction were a diagnosis of aggressive malignancy (hazard ratio [HR] 1.9; P =.04) and the inclusion of fludarabine in the conditioning regimen (HR 1.8; P =.07). Overall survival at 1 year was superior for patients who had maximal serum bilirubin levels in the normal (78%) or minimally elevated (22.23-66.69 microM [1.3-3.9 mg/dL]) ranges (69%) compared with those in the 68.4 to 117.99 microM (4-6.9 mg/dL; 20%), 119.7 to 169.29 microM (7.0-9.9 mg/dL; 17%), and 171.0 microM (10 mg/dL; 19%) or greater groups. In summary, significant jaundice occurred in 26% of patients and was predominantly due to cholestasis resulting from GVHD and/or sepsis. Aggressive malignancies (mainly advanced disease) and later development of jaundice after transplantation predicted inferior survival. PMID:12969980

  13. 15 CFR Appendix B to Subpart R of... - Minor Projects for Purposes of § 922.193(a)(2)(iii)

    Science.gov (United States)

    2010-01-01

    ... OF COMMERCE OCEAN AND COASTAL RESOURCE MANAGEMENT NATIONAL MARINE SANCTUARY PROGRAM REGULATIONS... pollutants, waste metal products, debris, or organic materials; (iii) the structure is not more than 300 feet... complete project, where the fill is of suitable material free from pollutants, waste metal products,...

  14. The interaction of 193-nm excimer laser irradiation with single-crystal zinc oxide: Positive ion emission

    International Nuclear Information System (INIS)

    We examine UV laser-induced ion emission from a wide bandgap semiconductor, single-crystal ZnO, at fluences well below both the damage threshold and plasma formation. At fluences below 200 mJ/cm2, we observe only Zn+, and the Zn+ intensity decreases monotonically during exposure. At higher fluences, after an initial decrease, the emission is sustained; in addition O+ and O2+ are observed. We explain: how Zn ions of several eV in energy can be produced on the surface of a semiconductor, how sustained emission can be maintained, and the origin of an anomalous emission of slow Zn+ ions -- the latter is shown to arise from photoionization of atomic Zn, also emitted by this radiation.

  15. Experimental verification of PSM polarimetry: monitoring polarization at 193nm high-NA with phase shift masks

    Science.gov (United States)

    McIntyre, Gregory; Neureuther, Andrew; Slonaker, Steve; Vellanki, Venu; Reynolds, Patrick

    2006-03-01

    The initial experimental verification of a polarization monitoring technique is presented. A series of phase shifting mask patterns produce polarization dependent signals in photoresist and are capable of monitoring the Stokes parameters of any arbitrary illumination scheme. Experiments on two test reticles have been conducted. The first reticle consisted of a series of radial phase gratings (RPG) and employed special apertures to select particular illumination angles. Measurement sensitivities of about 0.3 percent of the clear field per percent change in polarization state were observed. The second test reticle employed the more sensitive proximity effect polarization analyzers (PEPA), a more robust experimental setup, and a backside pinhole layer for illumination angle selection and to enable characterization of the full illuminator. Despite an initial complication with the backside pinhole alignment, the results correlate with theory. Theory suggests that, once the pinhole alignment is corrected in the near future, the second reticle should achieve a measurement sensitivity of about 1 percent of the clear field per percent change in polarization state. This corresponds to a measurement of the Stokes parameters after test mask calibration, to within about 0.02 to 0.03. Various potential improvements to the design, fabrication of the mask, and experimental setup are discussed. Additionally, to decrease measurement time, a design modification and double exposure technique is proposed to enable electrical detection of the measurement signal.

  16. Cul7/p185/p193 Binding to Simian Virus 40 Large T Antigen Has a Role in Cellular Transformation

    OpenAIRE

    Ali, Syed Hamid; Kasper, Jocelyn S.; Arai, Takehiro; DeCaprio, James A.

    2004-01-01

    Simian virus 40 large T antigen (TAg) is a viral oncoprotein that can promote cellular transformation. TAg's transforming activity results in part by binding and inactivating key tumor suppressors, including p53 and the retinoblastoma protein (pRb). We have identified a TAg-associated 185-kDa protein that has significant homology to the cullin family of E3 ubiquitin ligases. TAg binds to an SCF-like complex that contains p185/Cul7, Rbx1, and the F box protein Fbw6. This SCF-like complex binds...

  17. Cul7/p185/p193 binding to simian virus 40 large T antigen has a role in cellular transformation.

    Science.gov (United States)

    Ali, Syed Hamid; Kasper, Jocelyn S; Arai, Takehiro; DeCaprio, James A

    2004-03-01

    Simian virus 40 large T antigen (TAg) is a viral oncoprotein that can promote cellular transformation. TAg's transforming activity results in part by binding and inactivating key tumor suppressors, including p53 and the retinoblastoma protein (pRb). We have identified a TAg-associated 185-kDa protein that has significant homology to the cullin family of E3 ubiquitin ligases. TAg binds to an SCF-like complex that contains p185/Cul7, Rbx1, and the F box protein Fbw6. This SCF-like complex binds to an N-terminal region of TAg. Several p185/Cul7-binding-deficient mutants of TAg were generated that retained binding to pRb and p53 and were capable of overcoming Rb-mediated repression of E2F transcription. Despite binding to pRb and p53, these p185/Cul7-binding-defective mutants of TAg were unable to transform primary mouse embryo fibroblasts. Cells expressing p185/Cul7-binding-defective mutants of TAg were unable to grow to high density or grow in an anchorage-independent manner as determined by growth in soft agar. Considering the significance of other TAg-interacting proteins in regulation of the cell cycle, p185/Cul7 may also regulate an important growth control pathway. PMID:14990695

  18. SU-E-J-193: Application of Surface Mapping in Detecting Swallowing for Head-&-Neck Cancer

    International Nuclear Information System (INIS)

    Purpose: Recent evidence is emerging that long term swallowing function may be improved after radiotherapy for head-&-neck cancer if doses are limited to certain swallowing structures. Immobilization of patients with head-&-neck cancer is typically done with a mask. This mask, however, doesn’t limit patient swallowing. Patient voluntary or involuntary swallowing may introduce significant tumor motion, which can lead to suboptimal delivery. In this study, we have examined the feasibility of using surface mapping technology to detect patient swallowing during treatment and evaluated its magnitude. Methods: The C-RAD Catalyst system was used to detect the patient surface map. A volunteer lying on the couch was used to simulate the patient under treatment. A virtual marker was placed near the throat and was used to monitor the swallowing action. The target motion calculated by the Catalyst system through deformable registration was also collected. Two treatment isocenters, one placed close to the throat and the other placed posterior to the base-of-tongue, were used to check the sensitivity of surface mapping technique. Results: When the patient’s throat is not in the shadow of the patient’s chest, the Catalyst system can clearly identify the swallowing motion. In our tests, the vertical motion of the skin can reach to about 5mm. The calculated target motion can reach up to 1 cm. The magnitude of this calculated target motion is more dramatic when the plan isocenter is closer to the skin surface, which suggests that the Catalyst motion tracking technique is more sensitive to the swallowing motion with a shallower isocenter. Conclusion: Surface mapping can clearly identify patient swallowing during radiation treatment. This information can be used to evaluate the dosimetric impact of the involuntary swallowing. It may also be used to potentially gate head-&-neck radiation treatments. A prospective IRB approved study is currently enrolling patients in our institution. Research was funded through an Elekta grant

  19. SU-E-J-193: Application of Surface Mapping in Detecting Swallowing for Head-&-Neck Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Cao, D; Xie, X; Mehta, V; Shepard, D [Swedish Cancer Institute, Seattle, WA (United States)

    2015-06-15

    Purpose: Recent evidence is emerging that long term swallowing function may be improved after radiotherapy for head-&-neck cancer if doses are limited to certain swallowing structures. Immobilization of patients with head-&-neck cancer is typically done with a mask. This mask, however, doesn’t limit patient swallowing. Patient voluntary or involuntary swallowing may introduce significant tumor motion, which can lead to suboptimal delivery. In this study, we have examined the feasibility of using surface mapping technology to detect patient swallowing during treatment and evaluated its magnitude. Methods: The C-RAD Catalyst system was used to detect the patient surface map. A volunteer lying on the couch was used to simulate the patient under treatment. A virtual marker was placed near the throat and was used to monitor the swallowing action. The target motion calculated by the Catalyst system through deformable registration was also collected. Two treatment isocenters, one placed close to the throat and the other placed posterior to the base-of-tongue, were used to check the sensitivity of surface mapping technique. Results: When the patient’s throat is not in the shadow of the patient’s chest, the Catalyst system can clearly identify the swallowing motion. In our tests, the vertical motion of the skin can reach to about 5mm. The calculated target motion can reach up to 1 cm. The magnitude of this calculated target motion is more dramatic when the plan isocenter is closer to the skin surface, which suggests that the Catalyst motion tracking technique is more sensitive to the swallowing motion with a shallower isocenter. Conclusion: Surface mapping can clearly identify patient swallowing during radiation treatment. This information can be used to evaluate the dosimetric impact of the involuntary swallowing. It may also be used to potentially gate head-&-neck radiation treatments. A prospective IRB approved study is currently enrolling patients in our institution. Research was funded through an Elekta grant.

  20. Why and when citizens call for emergency help: an observational study of 211,193 medical emergency calls

    OpenAIRE

    Møller, Thea Palsgaard; Ersbøll, Annette Kjær; Tolstrup, Janne Schurmann; Østergaard, Doris; Viereck, Søren; Overton, Jerry; Folke, Fredrik; Lippert, Freddy

    2015-01-01

    Background A medical emergency call is citizens’ access to pre-hospital emergency care and ambulance services. Emergency medical dispatchers are gatekeepers to provision of pre-hospital resources and possibly hospital admissions. We explored causes for access, emergency priority levels, and temporal variation within seasons, weekdays, and time of day for emergency calls to the emergency medical dispatch center in Copenhagen in a two-year study period (December 1st, 2011 to November 30th, 2013...

  1. Shelf-Life of ɛ-Lysyl-3-(Trimethylstannyl)Benzamide Immunoconjugates, Precursors for 211At Labeling of Antibodies

    OpenAIRE

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per; Jensen, Holger; Holgersson, Stellan; Lindegren, Sture

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity and the complex radiochemistry of 211At are major obstacles for research and prospective clinical applications. In the present study, astatination of immunoconjugates, already prepared well in advance...

  2. The CARMA Paired Antenna Calibration System: Atmospheric Phase Correction for Millimeter Wave Interferometry and its Application to Mapping the Ultraluminous Galaxy Arp 193

    CERN Document Server

    Zauderer, B Ashley; Vogel, Stuart N; Carpenter, John M; Peréz, Laura M; Lamb, James W; Woody, David P; Bock, Douglas C -J; Carlstrom, John E; Culverhouse, Thomas L; Curley, Roger; Leitch, Erik M; Plambeck, Richard L; Pound, Marc W; Marrone, Daniel P; Muchovej, Stephen J; Mundy, Lee G; Teng, Stacy H; Teuben, Peter J; Volgenau, Nikolaus H; Wright, Melvyn C H; Wu, Dalton

    2014-01-01

    Phase fluctuations introduced by the atmosphere are the main limiting factor in attaining diffraction limited performance in extended interferometric arrays at millimeter and submillimeter wavelengths. We report the results of C-PACS, the Combined Array for Research in Millimeter-Wave Astronomy Paired Antenna Calibration System. We present a systematic study of several hundred test observations taken during the 2009-2010 winter observing season where we utilize CARMA's eight 3.5-m antennas to monitor an atmospheric calibrator while simultaneously acquiring science observations with 6.1-m and 10.4-m antennas on baselines ranging from a few hundred meters to ~2 km. We find that C-PACS is systematically successful at improving coherence on long baselines under a variety of atmospheric conditions. We find that the angular separation between the atmospheric calibrator and target source is the most important consideration, with consistently successful phase correction at CARMA requiring a suitable calibrator locate...

  3. The guinea-pig ileum preparation as a model for 5-HT1A receptors: anomalous effects with RS-30199-193.

    OpenAIRE

    Small, C.; Brown, C. M.; Redfern, W. S.; Spedding, M.

    1991-01-01

    1. Agents that have high and selective affinity for the 5-HT1A site such as 8-hydroxy-2-(di-n-propylamino)tetralin (8-OH-DPAT) and N,N-dipropyl-5-carboxamidotryptamine (DP5CT) inhibited the responses to field stimulation in guinea-pig ileum preparations; the inhibitory effects were antagonized by methiothepin and spiperone, consistent with effects at the 5-HT1A site. 2. The inhibitory effects of DP5CT were pronounced in Tyrode solution containing low Ca2+ (0.9 mM), but were much less apparent...

  4. American Recovery and Reinvestment Act (ARRA) FEMP Technical Assistance US General Serices Administration - Project 193, John W. Bricker Federal Building, Columbus, OH

    Energy Technology Data Exchange (ETDEWEB)

    Arends, J.; Sandusky, William F.

    2010-05-31

    This report documents the findings from an onsite audit of the John W. Bricker Federal building located in Columbus, Ohio. The Federal landlord for this building is the General Services Administration (GSA). The focus of the audit was to identify various no-cost or low-cost energy efficiency opportunities that, once implemented, would either reduce electrical and gas consumption or increase the operational efficiency of the building. This audit also provided an opportunity to identify potential capital cost projects that should be considered in the future to acquire additional energy (electric and gas) and water savings to further increase the operational efficiency of the building.

  5. HIGH-RESOLUTION LABORATORY SPECTRA OF THE λ193 CHANNEL OF THE ATMOSPHERIC IMAGING ASSEMBLY INSTRUMENT ON BOARD SOLAR DYNAMICS OBSERVATORY

    International Nuclear Information System (INIS)

    Extreme ultraviolet spectra of C, O, F, Ne, S, Ar, Fe, and Ni have been excited in an electron beam ion trap and studied with much higher resolution than available on the Solar Dynamics Observatory (SDO) in order to ascertain the spectral composition of the SDO/Atmospheric Imaging Assembly (AIA) observations. We present our findings in the wavelength range 182-200 Å, which, overall, corroborate the working models of how to interpret the SDO/AIA data. We find, however, that the inclusion of a number of additional lines might improve the data interpretation

  6. Estrogen biosynthesis: Metabolism of [16, 16, 19-2H3] [19-3H]19-Oxoandrost-4-ene-3, 17-Dione (1) by placental microsomal aromatase

    International Nuclear Information System (INIS)

    Publication of our results showing that 2β-hydroxy-19-oxoandrost-4-ene-3, 17-dione is not an obligatory estrogen precursor, rekindled interest in the late stages of estrogen biosynthesis from (1) and particularly in the utilization of the required third mole of oxygen and of NADPH. To understand the scope of transformations of the 19-oxo (1), and eventually isolate and identify the [oxygenated-(1)] estrogen precursor, we investigated the metabolism of (1) by placental microsomal aromatase. The following new types of metabolites of (1) were discovered: a: [(1)+0]; b: 4,6-dien-3-one analogs of (1) and of 19-norandrogens; c: 19-norandrogens and d: [(19-norandrost-4-ene-3, 17-dione)+0]. Biosynthesis of estrogens will be discussed in the context of the new results

  7. Selection of body-tip configuration in U+U collisions at √SNN = 193 GeV using spectator neutrons

    International Nuclear Information System (INIS)

    In central heavy-ion collisions with spherical nuclei such as Au or Pb, the initial overlap region is always circular. Due to the deformed shape, the initial overlap region in U+U collisions can have unique orientations in which the magnetic field is very high in central collisions and the azimuthal anisotropy υ2 is very low. Therefore, U+U collisions may provide a unique opportunity to study these exotic effects in relativistic heavy-ion collisions. However, it has not been experimentally possible so far to unambiguously select specific configurations in U+U collisions. In this work, we propose a methodology to select a body-tip configuration from unbiased events in U+U collisions. The body-tip configuration is pictorially shown in, where the impact parameter b is along x axis and the beam direction is along z axis. In this configuration, the right-going uranium nuclei whose major axis is perpendicular to the beam is called the body and other one (left-going) whose major axis is along the beam is called the tip. As seen in, the overlap region in such a body-tip collision is circular (shown by mesh). The nucleons which lie in the overlap region are called participants and those which lie outside the overlap region and do not take part in the collisions are called spectators. It is visible from that one uranium nucleus gets completely concluded into the other, leaving almost no spectators, whereas the other one will always have some spectators from the non-overlapping regions. This gives rise to asymmetry in the spectator counts in the two opposite directions. We use this particular feature of this body-tip event configuration to separate it out from the rest of the random configurations possible

  8. 33 CFR 207.170d - Taylor Creek, navigation lock (S-193) across the entrance to Taylor Creek at Lake Okeechobee...

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Taylor Creek, navigation lock (S..., DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE NAVIGATION REGULATIONS § 207.170d Taylor Creek, navigation lock..., and navigation. (a) The owner of or agency controlling the lock shall not be required to operate...

  9. John Peradotto. Man in the Middle Voice. Name and Narration in the Odyssey : Princeton-New Jersey, Princeton University Press, 1990, xi + 193 pp.

    OpenAIRE

    Zecchin de Fasano, Graciela Cristina

    1994-01-01

    El acercamiento crítico a los textos homéricos, ya sea desde la perspectiva narratológica o desde los enfoques semióticos, constituye una novedad asentada en los últimos años. El libro de J. Peradotto, Professor of Classics en la Universidad del Estado de Nueva York, con sede en Buffalo, y editor de la revista Arethusa, cumple con la novedad interpretativa de acercarnos una visión de Odisea apoyada en la evaluación del estado actual de los estudios filológicos en el ámbito americana y enrique...

  10. Shelf-life of ɛ-lysyl-3-(trimethylstannyl)benzamide immunoconjugates, precursors for 211At labeling of antibodies

    DEFF Research Database (Denmark)

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per;

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity ...

  11. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  12. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    International Nuclear Information System (INIS)

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons

  13. Separation of 211At from irradiated bismuth target and labelling of a model protein

    International Nuclear Information System (INIS)

    Astatine-211 is a promising radionuclide for therapeutic use in nuclear medicine. An efficient method (70%) for radiochemical separation from the irradiated Bi-target has been described. The level of Bi contamination in the purified 2'11At-solution was estimated. Finally labelling of a model protein has been tried. (author). 14 refs

  14. Geologic and seismic investigation for relocation of Route 138, Brockton-Avon town line, prospective cut, stations 193+00 in Brockton to 8+00 in Avon, Mass.

    Science.gov (United States)

    May, James E.; Miller, Raymond

    1954-01-01

    This work was done to obtain information that would aid in establishing a grade for this segment of Route 138, and would also be of value in determining the kinds and quantities of materials to be excavated from the prospective cut at this site. The work was performed in August 1952 as part of a cooperative program of the Massachusetts Department of Public Works and the United States Geological Survey.

  15. « The effect of the Arab Muslim conquest on the administrative division of Sasanian Persis/Fars ». Iran, XLI, (2003), pp. 193-204.

    OpenAIRE

    Gyselen, Rika (Hrsg.)

    2005-01-01

    Spéculations sur l’évolution de l’administration dans la région du Fars à la suite de la conquête arabo-musulmane. Cette prosopographie est truffée de coquilles (WHYC au lieu de WYHC, Holelesheom pour Hildesheim, etc.), d’erreurs (e.a. xwarwārān (north-east) à corriger en (west)), de renvois fautifs (p. ex. n. 77 : Anthologie de Zādspram, pp. 114-115 où on ne trouve rien qui soit en rapport avec la phrase de l’A.) et d’oublis bibliographiques (p. ex. la monographie de H. Gaube sur Arrajan) et...

  16. Test accuracy at different cut-offs when plasma concentrations of metabolic indicators are used to detect decreased fertility in dairy cows (Poster topic 01, Poster 27, p. 193)

    DEFF Research Database (Denmark)

    Lomander, H; Gustafsson, H; Svensson, C;

    and BHBA were calculated and compared to each cow’s fertility status, measured as anestrous (ANEST) and delayed first AI (DFAI). Positive and negative predictive values (PV+; PV-) were calculated considering different levels of decreased fertility. Strata-specific Se and Sp and associations between...... test results and fertility parameters were investigated using logistic regressio n. For this analysis, cut-offs with Sp ~80% was used because a high Sp was considered of interest. This corresponded to a NEFA-cutoff at 400 µeqv./mL (Se≤0.44) and a BHBA-cut-off at 1.8 mM (Se ≤0.32). Sp was generally...... higher when the test was used in heifers compared to older cows. With a prevalence of ANEST of 28% PV+ were 0.25 and PV- nearly 0.90. With a DFAI prevalence of 35%, PV+ were <0.38 and PV- nearly 0.90. The results indicate that overall test performance is low when metabolic indicators measured 0-21 days...

  17. JAR 2013, 193, (rolnr. C/09/433443/HA ZA/12-1463, ECLI:NL:RBDHA:2013:7749: overgang van ene payrollbedrijf naar andere geen overgang van onderneming, inlenende werkge)

    NARCIS (Netherlands)

    J.P.H. Zwemmer

    2013-01-01

    Tot mei 2010 verzorgde BDG de detachering en payrolling van ongeveer 600 werknemers bij AgentschapNL, een overheidsinstantie. In 2010 is de opdracht tot het verrichten van payrolldienstverlening door de Staat uitbesteed aan CapitalP in plaats van aan BDG. Tussen partijen is een geschil ontstaan over

  18. Multibeam collection for KN193-06: Multibeam data collected aboard Knorr from 2008-06-29 to 2008-07-12, departing from St. George's, Bermuda and returning to Norfolk, VA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  19. Hurdles for a Broader Use of 211At and for the Synthesis of 211At-Labelled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    One of the key impediments to the use of 211At is the very well known deleterious effect of high radiation fields caused by its alpha particles on the synthesis of 211At-labelled radiopharmaceuticals. This is problematic because radiolysis-mediated effects can produce diminishing efficiency of electrophilic astatination reactions due to increasing deposition of radiation dose with increasing activities and with the passage of the time. Astatine-211 has chemical properties that permit complex labelling strategies and a longer half-life than 213Bi that makes it more suitable when the targeting molecule does not gain immediate access to the tumour cells. The first clinical evaluation was published in 2001 [2] in patients with brain tumour. Although this study circumvents many of the challenges to entering clinical studies with 211At and many obstacles had to be surmounted before clinical studies could be initiated, several problems were encountered in maintaining efficient labelling with escalating radiation dose of α-particle even with fresh 211At elution [3]. Astatine-211 also has an additional hurdle to overcome before to its clinical application in labelled radiopharmaceuticals related with its production and distribution. Among the potential group of promising α- emitter it is the only one produced by cyclotrons, but due to the scarcity of cyclotrons equipped with 25−30 MeV α-particle beams, it will of necessity be utilized in distant locations from the site of production. It presents a major chemical challenge because the diminishing efficiency of electrophilic astatination reactions with the passage of the time is well known, a problem likely related to the radiolysis produced by the high LET (linear energy transfer) meaning that large amounts of energy are deposited in a highly localized manner. This problem has been most comprehensively investigated to understand and evaluate the role of the radiolysis effects of astatine alpha particles in the synthesis

  20. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  1. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  2. Radiopharmaceutical Chemistry of Targeted Radiopharmaceutics. Synthesis of 211At-Labeled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    Targeted α-particle radiotherapy is an appealing approach to cancer treatment because of the potential for delivering curative doses of radiation to tumor with minimal damage to normal tissue due to a range equivalent to only a few cell diameters. Compared with β-emitters they have significant advantages from a radiobiological perspective. The LET of 211At α-particles is more than 400 times higher than the β-particles emitted by 90Y, in addition the distance between ionizing events is almost the same as that between the two strands of DNA, yielding a high probability of creating non-repairable DNA damage. It gives the ability to kill cancer cells not compromised by hypoxia, dose rate effects or cell cycle position, enhancing their attractiveness for targeted radiotherapy. However, translation of the concept to the clinic has been slow, many obstacles had to be surmounted before clinical studies could be initiated, the first clinical evaluation of a 211At- labeled mAb was made in 2001. This study circumvents many of the challenges to entering clinical studies with 211At. But several problems were encountered in maintaining efficient labeling with escalating radiation dose of alpha-particle likely related to radiolysis. The impact of the radiolysis produced by the α-particle over the labeling chemistry is much higher in comparison with typical β-emitters due to a deposition of energy in the solvent in a highly localized manner two orders of magnitude per unit volume higher than 90Y or 131I. Due to these difficulties a comprehensive basic science study about the radiolytic effects of astatine alpha-particles over the synthesis of 211At-labeled radiopharmaceuticals was carried out. Its main goal was overcoming the problem of the synthesis of 211At-labeled radiopharmaceuticals at the high activities necessaries for therapy and also to extend the shelf life of astatine elutions. Briefly this study held several steps, the first one was to study the role of solvent

  3. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    International Nuclear Information System (INIS)

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211At and 124I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[211At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[211At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [124I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[124I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of macromolecules

  4. 211At production and recovery: first results of a new start

    International Nuclear Information System (INIS)

    Full text: 211At is the only alpha-emitting isotope which can be introduced into organic molecular structures by covalent chemical binding and possesses superior decay characteristics for therapeutic applications when compared with other alpha emitters. However, its production requires a minimum of 27,5 MeV alpha-particles, which are relatively rarely available. In view of the revival of alpha-therapy approaches a production of 211At has been set up at the MHH cyclotron (MC-35). The first aim of this project was to establish a target- and work-up-system for the reliable production of several ten MBq-quantities of 211At for animal- and cell-research. An aluminum-target-system holds a 1.3 cm diameter Bi-disc of 0.25 mm thickness. The disk is pressed onto a the aluminum backing with 2 tons/cm2. The front is covered with a 125 μm Al foil, cooled by a He jet which is separated from the vacuum by a 250 μm Ti foil. Starting with 27.5 MeV alpha-particles the resulting target-energy is 25 MeV. This relatively low energy is chosen to avoid any contamination with 210At and 210Po in the first experimental period. A beam current of 10 μA for 15 min (9 mCoulomb) yields 16.4 MBq 211At theoretically. Astatine is recovered from the target by a dry distillation technique, using various gases as a transport support-medium. The small all-quartz distillation-apparatus is heated up to 900 oC. Astatine is recovered in a small cool able vessel containing various trapping media. Distillation and trapping can be monitored with small radioactivity monitors. The whole system fits in a cubical 0.5 m glove box. Continuous monitoring of the distillation process allowed to optimize the heating rate, the transport support-medium and its flow-rate. Various trapping solutions were tested for their efficiency. Different beam dispersion in the target seems to influence the release and distillation of astatine from the molten bismuth-target. Two different release patterns were observed. The first

  5. Dicty_cDB: Contig-U13016-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tntgntg 72 Query: 73 atttngatccnaaaccnttcntttgtaaaactgcngctgntgtttcngttggngttgctg 132 ||||||||||||||||||||||...|||||||||||||||||||||||||||||||||||||| Sbjct: 73 atttngatccnaaaccnttcntttgtaaaactgcngctgntgtttcngttggngttgct...gtntttatttttgnnggnaanaaag 192 Query: 193 gttatgacttntggaaancnagtcaaggngntncnatggccccntcnaatgccnatcccc 252 ||...|||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 193 gttatgacttntggaaancnagtcaaggngntncnatggccccntcnaatgccna...e-30 Identities = 165/186 (88%) Strand = Plus / Plus Query: 71 tgatttngatccnaaaccnttcntttgtaaaactgcngctgntgt

  6. Protein (Viridiplantae): 15233302 [

    Lifescience Database Archive (English)

    Full Text Available NP_191115.1 33090:10299 35493:193 131221:193 3193:193 58023:114 78536:2677 58024:2677 3398:2677 ... 083:3094 3701:3094 3702:2636 AT-hook protein of GA feedback ... 2 Arabidopsis thaliana MANPWWVGNVAIGGVESPVTSSAPSLH ...

  7. Protein (Viridiplantae): 30690333 [

    Lifescience Database Archive (English)

    Full Text Available NP_195265.2 33090:10299 35493:193 131221:193 3193:193 58023:114 78536:2677 58024:2677 3398:2677 ... 083:3094 3701:3094 3702:2636 AT-hook protein of GA feedback ... 1 Arabidopsis thaliana MSSYMHPLLGQELHLQRPEDSRTPPDQ ...

  8. Research on Unintentional Injuries and Its Affecting Factors in Preschool Children at Urban Area of Guiyang City%贵阳市城区2 193例学龄前儿童意外伤害及影响因素的研究

    Institute of Scientific and Technical Information of China (English)

    刘玲; 刘筱娴; 文秋生; 王鸿娟; 李建芬; 鲁永辉

    2001-01-01

    【 Objective】 To find out the situation and influencing factors of unintentional injuries among preschool children at urban area in Guiyang city. 【Methods】 The descriptive epidemiology and case- control study was conducted among these chil drenin15kindergartens in Guiyang during1,April,98-31,Mar,99. 【Results】 The rate of injury was 24.76% with the boys ' higher than that of girls' (P < 0.05)and it rose very significanty with the chidren' s age went up.(P < 0.05) .The first threetypes of injuries were fall,collision and animal injuries.96.32% of injuries were mild and 3.68% were moderate. There was no disability and death. The analysis of single and multiple factors showed that the chileren' s unintentional injury were affected by following factors:fa ther' s age, the background of partent' s education, mother' s occupation, family pets, children' s nationality, persons taking care of chil dren, living floors and family average income. 【Conclusions】 The rate of children' s unintentional injury in Guiyang was high. The unintentionall injury was assoiated with many factors. It was a serious problem for Guiyang children.%【目的】了解贵阳市城区学龄前儿童意外伤害现况和影响因素。【方法】采用描述性流行病学和病例一对照研究的方法,对贵阳性市城区15所幼儿园的学龄前儿童在1998年4月1日~1999年3月31日期间发生的意外伤害情况和影响因素进行了研究。【结果】贵阳市城区学龄前儿童意外伤害发生率为24.76%,男童高于女童(P<0.05),意外伤害发生率随年龄增长而上升(P<0.05)。伤害类型前三位为:跌伤、撞伤、动物伤;96.32%的伤害为轻度,3.68%为中度,无1例伤残和死亡。单因素和多因素回归分析表明儿童意外伤害的发生受下列因素的影响:父亲年龄、父母文化程度、母亲职业、家庭宠物、儿童民族、儿童看护人、居住楼层、家庭人均收入等。【结论】贵阳市学龄前儿童意外伤害发生率高,意外伤害的发生受多种因素的影响,意外伤害是贵阳市儿童健康不可忽视的问题。

  9. Inclusive measurement of (p,πsup(-)xn) double charge exchange reactions on bismuth from threshold to 800 MeV

    International Nuclear Information System (INIS)

    The energy dependence of the total angle-integrated cross section for the production of astatine isotopes from (p,πsup(-)xn) double charge exchange reactions on bismuth (sup(209)Bi) was measured from 120 to 800 MeV using activation and radiochemical techniques. Chemical yields were estimated by direct radioassaying of sup(211)At activity in thin (approximately 1 mg/cmsup(2)), irradiated bismuth targets. Calculations of the contributions of secondary (2-step) reactions to these measured astatine yields were performed, based partially upon the observed sup(211)At activity although even at the highest energies, the contribution to products lighter than sup(207)At was negligible. These data for products with as many as 7 neutrons removed from the doubly coherent product (sup(210)At) display nearby gaussian shapes for the mass distributions of the astatine residues with the maximum occurring for about sup(204)At. The most probable momentum transfer deduced from these distributions for the initial πsup(-) production step was 335 MeV/c. The observed excitation functions display a behaviour similar to that observed for the yield of sup(210)Po from a (p,πsup(O)) reaction on sup(209)Bi, but radically different from that observed for inclusive πsup(-) reactions on a heavy nucleus. These data are discussed in terms of recent theoretical approaches to negative pion production from bismuth. In addition, a simple, schematic model is developed to treat the rapidly decreasing percentage of the total inclusive πsup(-) emission which is observed for this double charge exchange reaction. This model reflects the capacity of a nucleus to a source of internal energetic protons

  10. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC193 (Link to dictyBase) - - - Contig-U16382-1 VFC193P (Link... to Original site) VFC193F 338 VFC193Z 430 VFC193P 768 - - Show VFC193 Library VF (Link to library) Clone ID VFC193 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...producing significant alignments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 ...map 1685067-2090751 strain AX4, complete sequence. 654 0.0 7 X03281 |X03281.1 Dict

  11. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    OpenAIRE

    BAYRAM, Ali

    1998-01-01

    In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 1...

  12. Human radiation studies: Remembering the early years: Oral history of Dr. Patricia Wallace Durbin, Ph.D., conducted November 11, 1994

    International Nuclear Information System (INIS)

    This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches

  13. New supersymmetric quartet of nuclei in the A∼190 mass region

    International Nuclear Information System (INIS)

    We present evidence for a new supersymmetric quartet in the A∼190 region of the nuclear mass table. New experimental information on transfer and neutron capture reactions to the odd-odd nucleus 194Ir strongly suggests the existence of a new supersymmetric quartet, consisting of the 192,193Os and 193,194Ir nuclei. We make explicit predictions for the odd-neutron nucleus 193Os and suggest that its spectroscopic properties be measured in dedicated experiments

  14. AcEST: BP915306 [AcEST

    Lifescience Database Archive (English)

    Full Text Available %) Frame = +2 Query: 149 WLGRETCDYPSHINEFWDGEKARMYQDFWNPDVHWEAPVICNN 277 W + D+ S...ame = +2 Query: 68 FIDQLQLICGSESFCHDFLAVWR--------ESAQWLGRETC------DYPSHINEFWDG 205 ++D+ ++ SE F H + WR + W ...GSESFCHDFLAVWRESAQWLGRETCDYPSHINE 193 CP C K I + Y ++L+ + + C L+ W+E WL R T +P E Sbjct: 78 CPNCGKCG--YIKYYYL...KPRKEMISFQYTSFIDQLQLICGSESFCHDFLAVWRESAQWLGRETCDYPSHINE 193 C C K +I++ Y ++++ E+ ...2 Query: 14 CPQCRKPRKEMISFQYTSFIDQLQLICGSESFCHDFLAVWRESAQWLGRETCDYPSHINE 193 C C K +I++ Y ++++ E+ C+ L+ W E

  15. Developing an integrated imaging system for the 70-nm node using high numerical aperture ArF lithography

    Science.gov (United States)

    Petersen, John S.; Beach, James V.; Gerold, David J.; Maslow, Mark J.

    2002-07-01

    At its conception, 193 nm lithography was thought to be the best way to take optical lithography to the 180 nm node. It was expected that 193 nm could support the now-defunct 160 nm node before optical lithography would have to yield to an undetermined non-optical solution. Today, 193 nm must compete with 248 nm for the 130 nm node and is expected to support lithography until it is replaced by 157 nm at the 70 nm node. Given the challenges facing 157 nm, it is likely that lithographers will attempt to extend the utility of 193 nm to its theoretical limits.

  16. Local Purchasing of Journals is Required in Addition to a Nationally Purchased Collection to Meet the Information Needs of NHS Staff. A review of: Glover, Steven William, John Addison, Colette Gleghorn, and John Bramwell. “Journal Usage in NHS Hospitals: A Comparison Report of Total Usage at an Acute NHS Trust and a Specialist NHS Trust in the North West of England.” Health Information and Libraries Journal 24.3 (2007): 193‐9.

    OpenAIRE

    Jennie Kelson

    2008-01-01

    Objective ‐ To compare journal usage between an acute National Health Service (NHS) Trust and a specialist NHS Trust located in North West England to provide some evidence as to how well the National Core Content Collection (provided by ProQuest) meets the needs of staff in these settings.Design ‐ Comparative studySetting ‐ An acute NHS Trust, comprising four hospital sites, and a cancer specialist NHS Trust based on a single site. Both Trusts are located in North West England. The cancer spe...

  17. Dicty_cDB: Contig-U12668-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s / Plus Query: 13 aaaaagggacttgngagtntgntgatttngatccnaaaccnnnnnnnngnaaaantgntg 72 |||||||||||||||||||||||||...|||||||||||||||| || |||||||||||| Sbjct: 13 aaaaagggacttgngagtntgntgatttngatccnaaaccnttnntttgnaaaantgntg 72 Q...aaaggntntgnntnctggaaancnagncaaggngnttcaa 192 Query: 193 nggccccntnaaangccnatcccctt 218 |||||||||||||||||||||...||||| Sbjct: 193 nggccccntnaaangccnatcccctt 218 >Contig-U11508-1 (Contig-U11508-1Q) /CSM_Contig/Contig-U1150...us Query: 13 aaaaagggacttgngagtntgntgatttngatccnaaaccnnnnnnnngnaaaantgntg 72 ||||

  18. Dicty_cDB: Contig-U13159-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ntities = 254/254 (100%) Strand = Plus / Plus Query: 13 aaaaagggacttgngagtttgntgatttngatccnaaaccnttnntttgnaa...aactgntg 72 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 13 aaaaagggacttgngagtttgntgatttngatccna...ttttggtggnaaaaaaggttntgnctactggaaancaagtcaaggngntncna 192 Query: 193 nggccncntnaaangccna...||||| Sbjct: 193 nggccncntnaaangccnatcccctttangaaancnatccntcaggnggngaaaanncna 252 Query: 253 tttntnctagcccc .../235 (97%) Strand = Plus / Plus Query: 13 aaaaagggacttgngagtttgntgatttngatccnaaaccnttnntttgnaaaactgntg 72 ||

  19. Dicty_cDB: Contig-U12979-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available = Plus / Plus Query: 125 caccaccaccaccacaacnanntncancnnntnctgcancnnctactgctgctactnctn...gctactnctn 184 Query: 185 ctactacta 193 ||||||||| Sbjct: 185 ctactacta 193 >Contig-U1...(2) = 8e-07 Identities = 36/36 (100%) Strand = Plus / Plus Query: 167 ctactgctgctactnctnctactact...antantaata 202 |||||||||||||||||||||||||||||||||||| Sbjct: 167 ctactgctgctactnctnctactact... 184 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 125 caccaccaccaccacaacnanntncancnnntnctgcancnnctactgct

  20. Ametniku mõiste avaliku teenistuse seaduse eelnõus / Ebe Sarapuu

    Index Scriptorium Estoniae

    Sarapuu, Ebe

    2012-01-01

    Ametniku mõistest 1924. aastal vastu võetud riigiteenistuse seaduses, 1995. aastal vastu võetud avaliku teenistuse seaduses ja 2002. (964 SE), 2009. (484 SE ja 538 SE) ja 2012. aasta avaliku teenistuse seaduse (193 SE) eelnõus. Muudatustest uues seaduseelnõus (193 SE)

  1. Gclust Server: 164265 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 164265 HSA_62240997 Cluster Sequences - 193 NP_000790.2 erythropoietin precursor ; ...opoietin precursor ; no annotation Number of Sequences 1...k to cluster sequences Cluster Sequences Link to related sequences - Sequence length 193 Representative annotation NP_000790.2 erythr

  2. AcEST: DK963483 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0016_K14 399 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0016_K14. 5' end seq ... uery: 193 PTEEARARILQIHSRKMNVRSDVNFEELARSTDDFNGAQLRAVC VEAGMLALRRDANEVT 372 PTEEARARILQIHSRKMNV DVNFEELARS ... TDDFNGAQL+AVC VEAGMLALRRDA EVT Sbjct: 341 PTEEARARILQIHSRKMNVNPDV ... NFEELARSTDDFNGAQLKAVC VEAGMLALRRDATEVT 400 Query: 373 HEDFDEGII 399 HEDF+ ... uery: 193 PTEEARARILQIHSRKMNVRSDVNFEELARSTDDFNGAQLRAVC VEAGMLALRRDANEVT 372 PTEEAR RILQIHSRKMNV +DVNFEELAR ...

  3. 8 CFR 103.12 - Definition of the term “lawfully present” aliens for purposes of applying for Title II Social...

    Science.gov (United States)

    2010-01-01

    ... States for prosecution pursuant to 8 CFR 212.5(b)(3); (4) An alien who belongs to one of the following... aliens for purposes of applying for Title II Social Security benefits under Public Law 104-193. 103.12... applying for Title II Social Security benefits under Public Law 104-193. (a) Definition of the term...

  4. Intense predation on ascidians by a trunk fish, Ostracion immaculatus (Temminck et Schlege) (Pisces:Ostracidae)

    Digital Repository Service at National Institute of Oceanography (India)

    Raveendran, T.V.; Harada, E.

    stream_size 9 stream_content_type text/plain stream_name Publ_Seto_Mar_Biol_Lab_37_193.pdf.txt stream_source_info Publ_Seto_Mar_Biol_Lab_37_193.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  5. A text in Romani from 1622

    DEFF Research Database (Denmark)

    Bakker, Peter

    this is a reprint of a 2012 article: A new old text in Romani: Lord's Prayer, 1622. International Journal of Romani Language and Culture 2 (2011): 193-212.......this is a reprint of a 2012 article: A new old text in Romani: Lord's Prayer, 1622. International Journal of Romani Language and Culture 2 (2011): 193-212....

  6. Glacier-related landforms and glacial lakes in Huascarán National Park, Peru

    Czech Academy of Sciences Publication Activity Database

    Vilímek, V.; Klimeš, Jan; Červená, L.

    2016-01-01

    Roč. 12, č. 1 (2016), s. 193-202. ISSN 1744-5647 R&D Projects: GA ČR(CZ) GAP209/11/1000 Institutional support: RVO:67985891 Keywords : moraines * rock glaciers * glacial lakes * Cordillera Blanca * Huascarán National Park * Peru Impact factor: 1.193, year: 2014

  7. Multilayer organized TiO2 photoanode for dye-sensitized solar cell

    Czech Academy of Sciences Publication Activity Database

    Zukalová, Markéta; Kavan, Ladislav; Zukal, Arnošt; Procházka, Jan; Graetzel, M.

    Istanbul: Turkish Chemical Society, 2013. s. 193-193. [IUPAC 2013. World Chemistry Congress /44./.. 11.08.2013-16.08.2013, Istanbul] R&D Projects: GA ČR(CZ) GAP108/12/0814 Institutional support: RVO:61388955 Keywords : TiO2 * photoanode * dye-sensitized solar cell Subject RIV: CG - Electrochemistry

  8. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  9. A route for polonium 210 production from alpha-particle irradiated bismuth-209 target

    International Nuclear Information System (INIS)

    A method is proposed for production of polonium-210 via the 209Bi(α,3n)210 At nuclear reaction. Bombardment of a bismuth-209 target was performed with a 37 MeV alpha-particle beam that leads to the production of astatine-210 (T1/2 = 8.1 h), which decays to polonium-210. It is purified from the bismuth target matrix by employing liquid-liquid extraction using tributyl phosphate (TBP) in para-xylene from 7 M hydrochloric acid. Back extraction of polonium-210 was performed by 9 M nitric acid. This method allows to purify a tracer amount of Po-210 (2.6 x 10-13 mol) from macroscopic amount of Bi (2.8 x 10-2 mol).

  10. Effective bond orders from two-step spin–orbit coupling approaches: The I{sub 2}, At{sub 2}, IO{sup +}, and AtO{sup +} case studies

    Energy Technology Data Exchange (ETDEWEB)

    Maurice, Rémi, E-mail: remi.maurice@subatech.in2p3.fr; Montavon, Gilles [SUBATECH, CNRS UMR 6457, IN2P3/EMN Nantes/Université de Nantes, 4 rue Alfred Kastler, BP 20722, 44307 Nantes Cedex 3 (France); Réal, Florent; Gomes, André Severo Pereira; Vallet, Valérie [Laboratoire PhLAM, CNRS UMR 8523, Université de Lille, 59655 Villeneuve d’Ascq Cedex (France); Galland, Nicolas [CEISAM, UMR CNRS 6230, Université de Nantes, 2 rue de la Houssinière, BP 92208, 44322 Nantes Cedex 3 (France)

    2015-03-07

    The nature of chemical bonds in heavy main-group diatomics is discussed from the viewpoint of effective bond orders, which are computed from spin–orbit wave functions resulting from spin–orbit configuration interaction calculations. The reliability of the relativistic correlated wave functions obtained in such two-step spin–orbit coupling frameworks is assessed by benchmark studies of the spectroscopic constants with respect to either experimental data, or state-of-the-art fully relativistic correlated calculations. The I{sub 2}, At{sub 2}, IO{sup +}, and AtO{sup +} species are considered, and differences and similarities between the astatine and iodine elements are highlighted. In particular, we demonstrate that spin–orbit coupling weakens the covalent character of the bond in At{sub 2} even more than electron correlation, making the consideration of spin–orbit coupling compulsory for discussing chemical bonding in heavy (6p) main group element systems.

  11. Effective bond orders from two-step spin–orbit coupling approaches: The I2, At2, IO+, and AtO+ case studies

    International Nuclear Information System (INIS)

    The nature of chemical bonds in heavy main-group diatomics is discussed from the viewpoint of effective bond orders, which are computed from spin–orbit wave functions resulting from spin–orbit configuration interaction calculations. The reliability of the relativistic correlated wave functions obtained in such two-step spin–orbit coupling frameworks is assessed by benchmark studies of the spectroscopic constants with respect to either experimental data, or state-of-the-art fully relativistic correlated calculations. The I2, At2, IO+, and AtO+ species are considered, and differences and similarities between the astatine and iodine elements are highlighted. In particular, we demonstrate that spin–orbit coupling weakens the covalent character of the bond in At2 even more than electron correlation, making the consideration of spin–orbit coupling compulsory for discussing chemical bonding in heavy (6p) main group element systems

  12. Different ways to improve the clinical effectiveness of radioimmunotherapy in solid tumors

    Directory of Open Access Journals (Sweden)

    Chatal Jean-Francois

    2009-09-01

    Full Text Available Radioimmunotherapy (RIT has been proven effective in the treatment of radiosensitive non-Hodgkin lymphoma but, for radioresistant solid tumors, new approaches are necessary to improve the clinical effectiveness. A real improvement has been the introduction of the pretargeting technology which appeared to be able to significantly increase tumor-to-normal organ uptake ratios.Another very promising approach consists in associating RIT with other treatment modalities. Finally the use of alpha particle-emitting radionuclides such as astatin-211 or bismuth-213 (alpha-RIT should allow to efficiently eradicate disseminated microscopic clusters of tumor cells or isolated tumor cells which fit well with the short path length of alpha particles.

  13. Sequential radioimmunotherapy with 177Lu- and 211At-labeled monoclonal antibody BR96 in a syngeneic rat colon carcinoma model

    DEFF Research Database (Denmark)

    Eriksson, Sophie E; Elgström, Erika; Bäck, Tom;

    2014-01-01

    UNLABELLED: Alpha-particle emitters, such as astatine-211 (211At), are generally considered suitable for the treatment of small cell clusters due to their short path length, while beta-particle emitters, for example, Lutetium-177 (177Lu), have a longer path length and are considered better for...... small, established tumors. A combination of such radionuclides may be successful in regimens of radioimmunotherapy. In this study, rats were treated by sequential administration of first a 177Lu-labeled antibody, followed by a 211At-labeled antibody 25 days later. METHODS: Rats bearing solid colon...... carcinoma tumors were treated with 400 MBq/kg body weight 177Lu-BR96. After 25 days, three groups of animals were given either 5 or 10 MBq/kg body weight of 211At-BR96 simultaneously with or without a blocking agent reducing halogen uptake in normal tissues. Control animals were not given any 211At-BR96...

  14. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  15. Development of 211At Chemistry for Labelling Biomolecules

    International Nuclear Information System (INIS)

    Our studies have demonstrated that high recovery of 211At can be obtained using a “wet chemistry” approach to isolation from the bismuth target. We have also demonstrated that direct labelling of antibody-B10 conjugates with 211At can be performed in high yields, and that the astatinated antibodies are stable to in vivo deastatination. While these results will allow us to enter clinical studies with 211At-labelled antibodies, the chemistry associated with 211At is not fully understood. Therefore, it is important that many more basic studies to be conducted with 211At, so the optimal labelling reagent for each type of disease-targeting agent becomes apparent

  16. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena;

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... levels of γH2AX decreased during the first 24h in both cycling and stationary cultures and complete repair was seen in all cultures but cycling cells exposed to (211)At. Compared to stationary cells alpha particles were more harmful for cycling cultures, an effect also seen at the pChk2 levels...... cultures at a modest level of damage, clearly demonstrating that cell cycle status influences the relative effectiveness of alpha particles....

  17. An improved synthesis of an 125I and 211At labelled benzamide for melanoma imaging

    International Nuclear Information System (INIS)

    Recent studies have indicated that benzamides can exhibit affinity for malignant melanoma and may be exploited diagnostically in the treatment of this cancer. Radioiodinated N-(2-diethylaminoethyl)-3-[123I/131I]iodo-4-methoxybenzamide (*I-IMBA) is a benzamide with promising diagnostic properties. A new synthesis procedure was developed to obtain 125I-IMBA suitable for use in vivo. The assets of the procedure include the use of less toxic reagents and better reproducible results when radiolabelling the precursor. The procedure also facilitates the synthesis of the astatinated N-(2-diethylaminoethyl)-3-[211At]astatine-4-methoxybenzamide (211At-AMBA), a new benzamide with a therapeutic potential. The regiospecific no-carrier-added 125I- and 211At-labeling of the benzamide is performed by demetalation of an organotin precursor. Using tributylstannyl as a leaving group, the radiochemical yield obtained after 15 minutes of reaction was 70 %-90 % for both 125I-IMBA and 211At-AMBA. The labelling was performed in a solution of MeOH:AcOH with NCS as the oxidising agent. The organotin precursor N-(2-diethylaminoethyl)-3-(tri-n-butylstannyl)-4-methoxy-benzamide was synthesized from 3-bromo-4-methoxybenzoic acid, with n-BuLi (2 eq) and Bu3SnCl (1 eq) in THF, giving 3-(tri-n-butylstannyl)-4-methoxybenzoic acid. The amide function was introduced by converting the acid group into an active N-succinimidyl-ester, a good leaving group in the reaction with 2-(diethylamino)ethylamine. The overall yield of the organotin precursor was 65 %

  18. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Energy Technology Data Exchange (ETDEWEB)

    Marsh, B.A., E-mail: bruce.marsh@cern.ch [CERN, CH-1211 Geneva (Switzerland); Andel, B. [Comenius University, Bratislava (Slovakia); Andreyev, A.N. [University of York, Department of Physics, York YO10 5DD (United Kingdom); Antalic, S. [Comenius University, Bratislava (Slovakia); Atanasov, D. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Barzakh, A.E. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, 188300 Gatchina (Russian Federation); Bastin, B. [Grand Accérateur National d’Ions Lourds (GANIL), Bd Henri Becquerel, F-14076 Caen (France); Borgmann, Ch. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Capponi, L. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Cocolios, T.E.; Day Goodacre, T. [CERN, CH-1211 Geneva (Switzerland); University of Manchester, Manchester (United Kingdom); Dehairs, M. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Derkx, X. [University of the West of Scotland, School of Engineering, Paisley PA1 2BE (United Kingdom); De Witte, H. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fedorov, D.V. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, 188300 Gatchina (Russian Federation); Fedosseev, V.N.; Focker, G.J. [CERN, CH-1211 Geneva (Switzerland); Fink, D.A. [Ruprecht-Karls Universität, Seminarstr. 2, 69117 Heidelberg (Germany); CERN, CH-1211 Geneva (Switzerland); Flanagan, K.T. [University of Manchester, Manchester (United Kingdom); Franchoo, S. [CSNSM-IN2P3-CNRS, Université Paris-Sud, 91406 Orsay (France); and others

    2013-12-15

    Highlights: • Upgrade of the lasers, detectors and data acquisition for in-source resonance ionization spectroscopy at ISOLDE. • First use of the ISOLTRAP MR-ToF MS in combination with laser spectroscopy at ISOLDE. • Resonance ionization of astatine for the study of its nuclear structure. -- Abstract: At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  19. Cloud Point Extraction of Parabens Using Non-Ionic Surfactant with Cylodextrin Functionalized Ionic Liquid as a Modifier

    Directory of Open Access Journals (Sweden)

    Md Saleh Noorashikin

    2013-12-01

    Full Text Available A cloud point extraction (CPE process using non-ionic surfactant (DC193C to extract selected paraben compounds from water samples was investigated using reversed phase high performance liquid chromatography (RP-HPLC. The CPE process with the presence of β-cyclodextrin (βCD functionalized ionic liquid as a modifier (CPE-DC193C-βCD-IL is a new extraction technique that has been applied on the optimization of parameters, i.e., pH, βCD-IL concentration and phase volume ratio. This CPE-DC193C-βCD-IL method is facilitated at 30 °C, showing great losses of water content in the surfactant-rich phase, resulting in a high pre-concentration factor and high distribution coefficient. The developed method CPE-DC193C-βCD-IL did show enhanced properties compared to the CPE method without the modifier (CPE-DC193C. The developed method of CPE-DC193C-βCD-IL gives an excellent performance on the detection of parabens from water samples with the limit of detection falling in the range of 0.013–0.038 µg mL−1. Finally, the inclusion complex formation, hydrogen bonding, and π–π interaction between the βCD-IL, benzyl paraben (ArP, and DC 193C were proven using 1H NMR and 2D NOESY spectroscopy.

  20. Improving the thermostability and enhancing the Ca(2+) binding of the maltohexaose-forming α-amylase from Bacillus stearothermophilus.

    Science.gov (United States)

    Li, Zhu; Duan, Xuguo; Wu, Jing

    2016-03-20

    The thermostability of the maltohexaose-forming α-amylase from Bacillus stearothermophilus (AmyMH) without added Ca(2+) was improved through structure-based rational design in this study. Through comparison of a homologous model structure of AmyMH with the crystal structure of the thermostable α-amylase from Bacillus licheniformis, Ser242, which located at the beginning of fourth α-helix of the central (β/α)8 barrel was selected for mutation to improve thermostability. In addition, an amide-containing side chain (Asn193) and a loop in domain B (ΔIG mutation), which have been proven to be important for thermostability in corresponding position of other α-amylases, were also investigated. Five mutants carrying the mutations ΔIG, N193F, S242A, ΔIG/N193F, and ΔIG/N193F/S242A were generated and their proteins characterized. The most thermostable mutant protein, ΔIG/N193F/S242A, exhibited a 26-fold improvement in half-life at 95°C compared to the wild-type enzyme without added Ca(2+). Mutant ΔIG/N193F/S242A also exhibited substantially better activity and stability in the presence of the chelator EDTA, demonstrating enhanced Ca(2+) binding. These results suggest that mutant ΔIG/N193F/S242A has potential for use in the industrial liquefaction of starch. PMID:26869314

  1. Heterologous expression of viral suppressors of RNA silencing complements virulence of the HC-Pro mutant of clover yellow vein virus in pea.

    Science.gov (United States)

    Atsumi, Go; Nakahara, Kenji S; Wada, Tomoko Sugikawa; Choi, Sun Hee; Masuta, Chikara; Uyeda, Ichiro

    2012-06-01

    Many plant viruses encode suppressors of RNA silencing, including the helper component-proteinase (HC-Pro) of potyviruses. Our previous studies showed that a D-to-Y mutation at amino acid position 193 in HC-Pro (HC-Pro-D193Y) drastically attenuated the virulence of clover yellow vein virus (ClYVV) in legume plants. Furthermore, RNA-silencing suppression (RSS) activity of HC-Pro-D193Y was significantly reduced in Nicotiana benthamiana. Here, we examine the effect of expression of heterologous suppressors of RNA silencing, i.e., tomato bushy stunt virus p19, cucumber mosaic virus 2b, and their mutants, on the virulence of the ClYVV point mutant with D193Y (Cl-D193Y) in pea. P19 and 2b fully and partially complemented Cl-D193Y multiplication and virulence, including lethal systemic HR in pea, respectively, but the P19 and 2b mutants with defects in their RSS activity did not. Our findings strongly suggest that the D193Y mutation exclusively affects RSS activity of HC-Pro and that RSS activity is necessary for ClYVV multiplication and virulence in pea. PMID:22398917

  2. Theoretical analysis of an Uqp(u2) model for the congruent superdeformed rotational bands

    International Nuclear Information System (INIS)

    Superdeformed rotational bands in 191-192-193-194Hg are analyzed by means of the Uqp(u2) model. An overall and excellent agreement between the calculated and observed spectra Eγ, kinematic moment of inertia J(1) and dynamic moment of inertia J(2), the aligned angular momentum (i = ω (J(1)(191-193-194Hg)-J(1)(192Hg))) is obtained. Further more, the nuclear softness in 191-192-193-194Hg are calculated by means of the Uqp(u2) model and drawn into the nuclear configuration analysis

  3. Value of ultrasonic measurement of spinal canal diameter in general practice.

    OpenAIRE

    Drinkall, J N; Porter, R. W.; Hibbert, C S; Evans, C.

    1984-01-01

    The diameter of the spinal canal was measured by ultrasonic scanning in 193 patients with back pain and 193 matched controls. The spinal canal was found to be significantly narrower in the patients compared with all 193 controls (p less than 0.01) and compared with 132 of the controls with no history of back pain (p less than 0.001), but measurement of canal size was found not to have any value in the prognosis or management of back pain in general practice.

  4. Druhý život Kralické bible v 18. a na začátku 19. století - edice hallská a prešpurská

    Czech Academy of Sciences Publication Activity Database

    Pišna, Jan

    2014-01-01

    Roč. 5, č. 2 (2014), s. 175-193. ISSN 1804-1132 Institutional support: RVO:68378068 Keywords : old printed Bible s * Bible Czech * Pietism * editing Subject RIV: AJ - Letters, Mass-media, Audiovision

  5. Communication and Social Regulation in Termites

    Czech Academy of Sciences Publication Activity Database

    Bagneres, A. G.; Hanus, Robert

    Cham: Springer, 2015 - (Aquiloni, L.; Tricarico, E.), s. 193-248 ISBN 978-3-319-17598-0 Institutional support: RVO:61388963 Keywords : termites * communication * chemical communication * pheromones * mechanical communication * social regulation Subject RIV: CC - Organic Chemistry

  6. UBV photometry and MK spectral classification of northern early-type stars at intermediate galactic latitudes

    International Nuclear Information System (INIS)

    UBV photometry and MK spectral types are reported for 193 northern early-type stars at intermediate galactic latitudes. Spectral types determined from UBV colours and visual classification are compared for the main sequence stars. (author)

  7. Idea národa československého na stránkách týdeníku Přítomnost (1924-1938)

    Czech Academy of Sciences Publication Activity Database

    Harna, Josef

    2009-01-01

    Roč. 17, č. 1 (2009), s. 169-193. ISSN 1210-6860 Institutional research plan: CEZ:AV0Z80150510 Keywords : 20th Century * Czechoslovak history * Czecho-Slovak relations * czechoslovakianism * journalism Subject RIV: AB - History

  8. Dicty_cDB: Contig-U10492-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d = Plus / Plus Query: 14 aaaacncttggtttnaacatgcttcaaangccnttcatcatttatccnttcannnnnnna 7...gccnttcatcatttatccnttcattttntta 73 Query: 74 cgtcaattaagnggnganacaaatntactcgttgangntggngccctttggnttaana...at 133 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 74 cgtcaattaagnggnganacaaatntactcgttgan...ggccgatccntattatattttaccnttagnatnttcaattttccaanatggn 193 Query: 194 tccgttngtttntcaangnctgatganactagnccaatgatgaaaacna...gnctgatganactagnccaatgatgaaaacnattangncttcn 253 Query: 254 ttttgntttttacccttagnttttac

  9. Goethovo cítící srdce a božská povaha vášní. Pojetí žádostivosti v románu Utrpení mladého Werthera

    Czech Academy of Sciences Publication Activity Database

    Pokorný, Martin Z.

    Praha: Togga, 2014 - (Vrabec, M.), s. 193-190. (Scholia. 20). ISBN 978-80-7476-059-4 Institutional support: RVO:67985955 Keywords : longing * desire * feeling * nature of man * Goethe * Kant Subject RIV: AA - Philosophy ; Religion

  10. Moose Survey-Inventory Progress Report : Unit 15A Kenai

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report summarizes the 1972 moose surveys on Kenai National Wildlife Refuge, Game Management Unit 15A. Harvest report returns indicate a hunter harvest of 193...

  11. Retention of carotenoids in egg yolks of laying hens supplemented with heterotrophic Chlorella

    Czech Academy of Sciences Publication Activity Database

    Kotrbáček, V.; Skřivan, M.; Kopecký, Jiří; Pěnkava, O.; Hudečková, P.; Uhríková, I.; Doubek, J.

    2013-01-01

    Roč. 58, č. 5 (2013), s. 193-200. ISSN 1212-1819 Institutional support: RVO:61388971 Keywords : lutein * zeaxanthin * enriched egg s Subject RIV: EE - Microbiology, Virology Impact factor: 0.871, year: 2013

  12. Experiment list: SRX150405 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available mesoderm|Description=lymphoblastoid, International HapMap Project, Yoruba in Ibadan, Nigera, treatment: Epst...193 || cell organism=human || cell description=lymphoblastoid, International HapMap Project, Yoruba in Ibada

  13. Response of fluvial, aeolian, and lacustrine systems to late Pleistocene to Holocene climate change, Lower Moravian Basin, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Kadlec, Jaroslav; Kocurek, G.; Mohrig, D.; Shinde, D. P.; Murari, M. K.; Varma, V.; Stehlík, F.; Beneš, V.; Singhvi, A. K.

    2015-01-01

    Roč. 232, 1 March (2015), s. 193-208. ISSN 0169-555X Institutional support: RVO:67985530 Keywords : Quaternary * Czech Republic * Fluvio-aeolian Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.577, year: 2013

  14. EnviroAtlas - Durham, NC - BenMAP Results by Block Group

    Data.gov (United States)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset demonstrates the effect of changes in pollution concentration on local populations in 193 block groups in Durham, North Carolina. The US...

  15. Cyclodextrin glucanotransferase production by cell biocatalysts of alkaliphilic bacilli

    Czech Academy of Sciences Publication Activity Database

    Atanasova, N.; Kitayska, T.; Yankov, D.; Šafaříková, Miroslava; Tonkova, A.

    2009-01-01

    Roč. 46, - (2009), s. 278-285. ISSN 1369-703X Institutional research plan: CEZ:AV0Z60870520 Keywords : alkaliphilic bacilli * immobilization Subject RIV: CE - Biochemistry Impact factor: 2.193, year: 2009

  16. EST Table: FS748350 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available PREDICTED: similar to fetal alzheimer antigen, falz [Nasonia vitripennis] 10/09/08 37 %/193 aa FBpp0290563|E...811424.1| PREDICTED: similar to fetal alzheimer antigen, falz [Tribolium castaneum] FS748350 caL- ...

  17. Literature - a Way of Strengthening Dalit Identity

    Czech Academy of Sciences Publication Activity Database

    Hons, Pavel

    vol. 1. Warszawa: Dom Wydawniczy Elipsa, 2013 - (Stasik, D.), 193-201 ISBN 978-83-7151-977-2 Institutional research plan: CEZ:AV0Z9021901 Keywords : Dalit literature * India * Dalit movement Subject RIV: AI - Linguistics

  18. Four New Derivatives of Trihomononactic Acids from Streptomyces globisporus

    Czech Academy of Sciences Publication Activity Database

    Řezanka, Tomáš; Spížek, Jaroslav; Přikrylová, Věra; Dembitski, V. M.

    -, - (2004), s. 4239-4244. ISSN 1434-193X Institutional research plan: CEZ:AV0Z5020903 Keywords : streptomyces globisporus * nonactic * trihomononactic Subject RIV: EE - Microbiology, Virology Impact factor: 2.426, year: 2004

  19. Logic Reduced To Bare (Proof-Theoretical) Bones

    Czech Academy of Sciences Publication Activity Database

    Peregrin, Jaroslav

    2015-01-01

    Roč. 24, č. 2 (2015), s. 193-209. ISSN 0925-8531 Institutional support: RVO:67985955 Keywords : inference * incompatibility * proof theory * intuitionistic logic Subject RIV: AA - Philosophy ; Religion

  20. Digital data sets that describe aquifer characteristics of the Elk City aquifer in western Oklahoma

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This data set consists of digitized aquifer boundaries for the Elk City aquifer in western Oklahoma. The aquifer covers an area of approximately 193,000 acres and...

  1. Alaska Federal Oil and Gas Historical Leases

    Data.gov (United States)

    Bureau of Ocean Energy Management, Department of the Interior — This data set contains the outlines for historic (i.e., relinquished or inactive) federal oil and gas leases in the Alaska OCS Region through sale 193. They...

  2. Digital data sets that describe aquifer characteristics of the Elk City aquifer in western Oklahoma

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This data set consists of digitized water-level elevation contours for the Elk City aquifer in western Oklahoma. The aquifer covers an area of approximately 193,000...

  3. 2. The Data Librarian: introducing the Data Librarian

    OpenAIRE

    Liscouski, Joe

    1997-01-01

    This paper provides some initial considerations into the design and function of the Data Librarian. The first part (Liscouski, J., 1997, Journal of Automatic Chemistry, 19, 193-197) described the need for the Librarian.

  4. Zooplankton biodiversity and community structure vary along spatiotemporal environmental gradients in restored peridunal ponds.

    Czech Academy of Sciences Publication Activity Database

    Antón-Pardo, Maria; Armengol, X.; Ortells, R.

    2016-01-01

    Roč. 75, č. 1 (2016), s. 193-203. ISSN 1129-5767 Institutional support: RVO:60077344 Keywords : Crustaceans * dispersal * diversity * metacommunity dynamics * rotifers * similarity * singularity Subject RIV: DA - Hydrology ; Limnology Impact factor: 1.178, year: 2014

  5. 78 FR 61826 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Closure of the 2013 South...

    Science.gov (United States)

    2013-10-04

    ... implement Amendment 28 to the FMP (78 FR 44461, July 24, 2013). Under 50 CFR 622.193(y)(1), NMFS is required... for South Atlantic snapper-grouper having red snapper onboard must have landed and bartered,...

  6. A new invasive hawkweed, Hieracium glomeratum (Lactuceae, Asteraceae), in the Pacific Northwest

    Czech Academy of Sciences Publication Activity Database

    Wilson, L. M.; Fehrer, Judith; Bräutigam, S.; Grosskopf, G.

    2006-01-01

    Roč. 84, - (2006), s. 133-142. ISSN 0008-4026 Institutional research plan: CEZ:AV0Z60050516 Keywords : Hieracium * invasives * DNA fingerprinting Subject RIV: EF - Botanics Impact factor: 1.193, year: 2006

  7. An enantioselective formal synthesis of (-)-thujopsene

    Institute of Scientific and Technical Information of China (English)

    Chen Xi Zhang; Li Jing Fang; Fu Qiang Bi; Yu Lin Li

    2008-01-01

    Dihydromayurone (3), a key intermediate to synthesize (-)-thujopsene (1), was efficient enantiocontrolled synthesized from (+)-dihydrocarvone through 9 steps in an overall yield of 19.3%. The key step was the Simmons-Smith reaction.

  8. 78 FR 2950 - Proposed Posting and Posting of Stockyards

    Science.gov (United States)

    2013-01-15

    ... posted the stockyards. On January 26, 2010, we published a notice in the Federal Register (75 FR 4039... posting AZ-117 Robertson Horse Sales, Benson, April 28, 2010. Arizona. CA-193 Westside Auction...

  9. 75 FR 4039 - Proposed Posting, Posting, and Deposting of Stockyards

    Science.gov (United States)

    2010-01-26

    ... the Federal Register (74 FR 17945-17947) of our proposal to post these 20 stockyards. Since we... location CA-193 Westside Auction Yard, Newman, California. AZ-117 Robertson Horse Sales, Benson,...

  10. Low Noise Millimeter Wave LNA Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The Phase I effort will result in a low noise MMIC G-Band amplifier the covers the entire 165 to 193GHz frequency range. The amplifier will be designed using a 50nm...

  11. AK_Lease

    Data.gov (United States)

    Bureau of Ocean Energy Management, Department of the Interior — This data set contains the outlines for active federal oil and gas leases in the Alaska OCS Region through sale 193. They represent a close approximation, but might...

  12. Higher Resolution Neutron Velocity Spectrometer Measurements of Enriched Uranium

    Science.gov (United States)

    Rainwater, L. J.; Havens, W. W. Jr.

    1950-08-09

    The slow neutron transmission of a sample of enriched U containing 3.193 gm/cm2 was investigated with a resolution width of 1 microsec/m. Results of transmission measurements are shown graphically. (B.J.H.)

  13. Cancer in Children and Adolescents

    Science.gov (United States)

    ... Children's Cancer and Leukaemia Group. Pediatric and Developmental Pathology 2011; 14(3):189-193. [PubMed Abstract] Smith ... factors for acute leukemia in children: A review. Environmental Health Perspectives 2007; 115(1):138-145. [PubMed ...

  14. Eight-Membered Cyclic 1,2,3-Trithiocane Derivatives from Perophora viridis, an Atlantic Tunicate

    Czech Academy of Sciences Publication Activity Database

    Řezanka, Tomáš; Dembitsky, V. M.

    - (2002), s. 2400-2404. ISSN 1434-193X Institutional research plan: CEZ:AV0Z5020903 Keywords : natural * products * sulfur heterocycles Subject RIV: EE - Microbiology, Virology Impact factor: 2.195, year: 2002

  15. 78 FR 47205 - National Oil and Hazardous Substances Pollution Contingency Plan; National Priorities List...

    Science.gov (United States)

    2013-08-05

    ..., or other organics, at the MW-11 location, and total petroleum hydrocarbons at the MW-20 location..., 56 FR 54757, 3 CFR, 1991 Comp., p. 351; E.O. 12580, 52 FR 2923; 3 CFR, 1987 Comp., p. 193. Appendix...

  16. 10 CFR 205.192A - Burden of proof.

    Science.gov (United States)

    2010-01-01

    ... Remedial Order proceeding the ERA has the burden of establishing a prima facie case as to the validity of... supplemental information that may be made available under § 205.193A. (b) Once a prima facie case has...

  17. Černá vlajka pirátů znovu nahání strach? Opatření proti pirátství a ozbrojenému lupičství na moři na začátku 21. století

    Czech Academy of Sciences Publication Activity Database

    Šturma, Pavel

    2009-01-01

    Roč. 8, č. 7 (2009), s. 193-197. ISSN 1213-5313 Institutional research plan: CEZ:AV0Z70680506 Keywords : maritime law * public international law * fight against piracy Subject RIV: AG - Legal Sciences

  18. 78 FR 46934 - Combined Notice of Filings #1

    Science.gov (United States)

    2013-08-02

    ... Applicants: Duke Energy Florida, Inc. Description: Cancellation of DEF Rate Schedule No. 193 to be effective... Docket Numbers: ER13-2018-000 Applicants: Duke Energy Florida, Inc. Description: Cancellation of DEF...

  19. Lokál singuláru tvrdých neživotných maskulin (ve vlaku vs. v potoce): úzus a gramatičnost

    Czech Academy of Sciences Publication Activity Database

    Štícha, František

    2009-01-01

    Roč. 70, č. 3 (2009), s. 193-220. ISSN 0037-7031 Institutional research plan: CEZ:AV0Z90610518 Keywords : morphology * inanimate hard masculine noun * frequency * ending * criteria of grammaticality Subject RIV: AI - Linguistics

  20. Constitutive equation of concrete: Mesomechanical isotropic model

    Czech Academy of Sciences Publication Activity Database

    Kafka, Vratislav; Vokoun, David

    2005-01-01

    Roč. 1, č. 2 (2005), s. 183-193. ISSN 1573-6105 Institutional research plan: CEZ:AV0Z20710524 Keywords : plasticity * constitutive modeling * concrete * mesomechanics Subject RIV: JI - Composite Materials

  1. Development of eight polymorphic microsatellite markers in the Black and Rufous sengi, Rhynchocyon petersi

    Czech Academy of Sciences Publication Activity Database

    Sabuni, C. A.; Van Houtte, N.; Maganga, S. L. S.; Makundi, R. H.; Leirs, H.; Goüy de Bellocq, Joëlle

    2015-01-01

    Roč. 7, č. 1 (2015), s. 193-195. ISSN 1877-7252 Institutional support: RVO:68081766 Keywords : Rhynchocyon petersi * Vulnerable afrotherian * Microsatellites * 454 Sequencing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.172, year: 2014

  2. 1984 walrus harvest, health, and welfare study at Gambell, Alaska: Progress report

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The recorded harvest between 25 April and 8 June in Gambell was 1499 walruses. There were 373 adult males, 528 adult females, 405 calves, and 193 of unknown sex....

  3. Kamenná indrustrie z objektu 36 v Horkách nad Jizerou, okr. Mladá Boleslav

    Czech Academy of Sciences Publication Activity Database

    Davidová, T.; Šída, P.; Šreinová, B.; Šrein, Vladimír

    8/1, - (2004), s. 193-208. ISSN 1214-3553 Institutional research plan: CEZ:AV0Z3046908 Keywords : stone industry * manufacture of polished industry amfibole hornstone * Horky Subject RIV: DB - Geology ; Mineralogy

  4. ISO/TC33 Meeting Held in Salvador,Brasil,October 2009

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    @@ ISO/TC33 Meeting was held in Salvador Brasil on 12-13 October 2009.Delegates from UK,USA,Germany,Australia,Japan and China attended the meeting.Two Chinese delegates,the new chairman of ISO/TC33 Li Hongxia fthe committee chaiman of SAC/TC193 and the president of Sinosteel Luoyang Institute of Refractories Research Co.,Ltd.)and Zhang Yongfhng(vice general secretary of SAC/TC193),were present.

  5. AcEST: DK958120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available (2%) Frame = +1 Query: 46 AGQLQAVPDAFIRPPHDRPP-SLVQEQ--QLPVIDISGLHDPHLRPLVLQHIAHACAHWG 216 A + VP ++RP DRP S...0/213 (46%), Gaps = 6/213 (2%) Frame = +1 Query: 4 VMGLQEMIETSAERAGQLQAVPDAFIRPPHDRPP---SLVQEQQLPVIDISGLHDPH...ps = 7/197 (3%) Frame = +1 Query: 55 LQAVPDAFIRPPHDRPP----SLVQEQQLPVIDISGLHDPHLRP...HLRPLVLQHIAH 198 E ++ A + +P FIRP ++P S P I L DP ++ +++ IA Sbjct: 4 ERVQAIASLSHSNGTIPAEFIRPEKEQPASTTYHGPAPEIPTIDLDDP-...(34%), Positives = 97/193 (50%), Gaps = 7/193 (3%) Frame = +1 Query: 64 VPDAFIRPPHDRPP---SL

  6. Drug: D02206 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available pocytokine signaling pathway map07051 Antidiabetics Therapeutic category of drugs in Japan [BR:br08301] 3 Ag...ents affecting metabolism 39 Other agents affecting metabolism 396 Antidiabetic agents 3962 Biguanides D0220...D02206 Drug Buformin hydrochloride (JP16); Dibetos-B (TN) C6H15N5. HCl 193.1094 193.6777 D02206.gif Antidiab...etic [DS:H00409] Therapeutic category: 3962 ATC code: A10BA03 biguanides AMPK activ

  7. Explosive behaviour in workers of the snapping termite Neocapritermes taracua: Is there anything ordinary?

    Czech Academy of Sciences Publication Activity Database

    Šobotník, Jan; Hanus, Robert; Pytelková, Jana; Mareš, Michael; Cvačka, Josef; Krasulová, Jana; Roisin, Y.; Bourguignon, T.

    Copenhagen : IUSSI, 2010 - (Nash, D.; den Boer, S.; De Fine Licht, H.; Boomsma, J.). s. 193-193 ISBN 978-87-92100-00-9. [IUSSI 2010. Congress of the International Union for the Study of Social Insects /16./. 08.08.2010-13.08.2010, Copenhagen] Institutional research plan: CEZ:AV0Z40550506 Keywords : Neocapritermes * termite * defence Subject RIV: CC - Organic Chemistry

  8. AcEST: DK944513 [AcEST

    Lifescience Database Archive (English)

    Full Text Available (65%), Positives = 63/86 (73%) Frame = +2 Query: 14 MVLSNDIDXXXXXXXXXXXXXXXXXXXQSPNSYFMDV...KCQGCFSITTVFSHSQTVVLCGN 193 MVL NDID QSPNS+FMDVKCQGCF+ITTVFSHSQTVV+CGN Sbjct: 1 MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDV...ies = 56/86 (65%), Positives = 61/86 (70%) Frame = +2 Query: 14 MVLSNDIDXXXXXXXXXXXXXXXXXXXQSPNSYFMDVKCQGCFS...ITTVFSHSQTVVLCGN 193 MVL NDID QSPNS+FMDVKCQGCF+ITTVFSHSQTVV+C Sbjct: 1 MVLQNDIDLLNPPAELEKLKHKKKRLVQSPNSFFMDV...84 (66%), Positives = 60/84 (71%) Frame = +2 Query: 14 MVLSNDIDXXXXXXXXXXXXXXXXXXXQSPNSYFMDV

  9. Generation of anti-idiotype antibodies for application in clinical immunotherapy laboratory analyses.

    Science.gov (United States)

    Liu, Zhanqi; Panousis, Con; Smyth, Fiona E; Murphy, Roger; Wirth, Veronika; Cartwright, Glenn; Johns, Terrance G; Scott, Andrew M

    2003-08-01

    The chimeric monoclonal antibody ch806 specifically targets the tumor-associated mutant epidermal growth factor receptor (de 2-7EGFR or EGFRVIII) and is currently under investigation for its potential use in cancer therapy. The humanised monoclonal antibody hu3S193 specifically targets the Lewis Y epithelial antigen and is currently in Phase I clinical trials in patients with advanced breast, colon, and ovarian carcinomas. To assist the clinical evaluation of ch806 and hu3S193, laboratory assays are required to monitor their serum pharmacokinetics and quantitate any immune responses to the antibodies. Mice immunized with ch806 or hu3S193 were used to generate hybridomas producing antibodies with specific binding to ch806 or hu3S193 and competitive for antigen binding. These anti-idiotype antibodies (designated Ludwig Melbourne Hybridomas, LMH) were investigated as reagents suitable for use as positive controls for HAHA or HACA analyses and for measuring hu3S193 or ch806 in human serum. Anti-idiotypes with the ability to concurrently bind two target antibody molecules were identified, which enabled the development of highly reproducible, sensitive, specific ELISA assays for determining serum concentrations of hu3S193 and ch806 with a 3 ng/mL limit of quantitation using LMH-3 and LMH-12, respectively. BIAcore analyses determined high apparent binding affinity for both idiotypes: LMH-3 binding immobilized hu3S193, Ka = 4.76 x 10(8) M(-1); LMH-12 binding immobilised ch806, Ka = 1.74 x 10(9) M(-1). Establishment of HAHA or HACA analysis of sera samples using BIAcore was possible using LMH-3 and LMH-12 as positive controls for quantitation of immune responses to hu3S193 or ch806 in patient sera. These anti-idiotypes could also be used to study the penetrance and binding of ch806 or hu3S193 to tumor cells through immunohistochemical analysis of tumor biopsies. The generation of anti-idiotype antibodies capable of concurrently binding a target antibody on each variable

  10. X-Ray Crystal Structure and Properties of Phanta, a Weakly Fluorescent Photochromic GFP-Like Protein

    Science.gov (United States)

    Don Paul, Craig; Traore, Daouda A. K.; Olsen, Seth; Devenish, Rodney J.; Close, Devin W.; Bell, Toby D. M.; Bradbury, Andrew; Wilce, Matthew C. J.; Prescott, Mark

    2015-01-01

    Phanta is a reversibly photoswitching chromoprotein (ΦF, 0.003), useful for pcFRET, that was isolated from a mutagenesis screen of the bright green fluorescent eCGP123 (ΦF, 0.8). We have investigated the contribution of substitutions at positions His193, Thr69 and Gln62, individually and in combination, to the optical properties of Phanta. Single amino acid substitutions at position 193 resulted in proteins with very low ΦF, indicating the importance of this position in controlling the fluorescence efficiency of the variant proteins. The substitution Thr69Val in Phanta was important for supressing the formation of a protonated chromophore species observed in some His193 substituted variants, whereas the substitution Gln62Met did not significantly contribute to the useful optical properties of Phanta. X-ray crystal structures for Phanta (2.3 Å), eCGP123T69V (2.0 Å) and eCGP123H193Q (2.2 Å) in their non-photoswitched state were determined, revealing the presence of a cis-coplanar chromophore. We conclude that changes in the hydrogen-bonding network supporting the cis-chromophore, and its contacts with the surrounding protein matrix, are responsible for the low fluorescence emission of eCGP123 variants containing a His193 substitution. PMID:25923520

  11. Improving low-temperature activity of Sulfolobus acidocaldarius 2-keto-3-deoxygluconate aldolase

    Directory of Open Access Journals (Sweden)

    Suzanne Wolterink-van Loo

    2009-01-01

    Full Text Available Sulfolobus acidocaldarius 2-keto-3-deoxygluconate aldolase (SacKdgA displays optimal activity at 95°C and is studied as a model enzyme for aldol condensation reactions. For application of SacKdgA at lower temperatures, a library of randomly generated mutants was screened for improved synthesis of 2-keto-3-deoxygluconate from pyruvate and glyceraldehyde at the suboptimal temperature of 50 °C. The single mutant SacKdgA-V193A displayed a threefold increase in activity compared with wild type SacKdgA. The increased specific activity at 40–60 °C of this mutant was observed, not only for the condensation of pyruvate with glyceraldehyde, but also for several unnatural acceptor aldehydes. The optimal temperature for activity of SacKdgA-V193A was lower than for the wild type enzyme, but enzymatic stability of the mutant was similar to that of the wild type, indicating that activity and stability were uncoupled. Valine193 has Van der Waals interactions with Lysine153, which covalently binds the substrate during catalysis. The mutation V193A introduced space close to this essential residue, and the increased activity of the mutant presumably resulted from increased flexibility of Lysine153. The increased activity of SacKdgA-V193A with unaffected stability demonstrates the potential for optimizing extremely thermostable aldolases for synthesis reactions at moderate temperatures.

  12. The biokinetics of alpha-particle emitting radiopharmaceuticals

    International Nuclear Information System (INIS)

    The past two decades have seen wide interest in the application of alpha-particle emitting radionuclides for targeted endoradiotherapy and a large number of compounds labeled with 211At (T1/2 7.21 h), 212Bi (T1/2 1 h) or 213Bi (T1/2 0.78 h) have been studied. Knowledge of the biokinetic behaviour of such agents is important both for their optimal clinical exploitation and for general radiological protection purposes. Animal studies of the distribution and retention of 211At compounds, including ionic astatide, substituted aromatic compounds and labelled monoclonal antibodies, have provided new information on the biochemistry of astatine. With respect the thyroid gland the uptake of the astatide ion has been shown to be very much lower than that of the iodide ion. Less information is available for 212Bi-labelled radiopharmaceuticals. The available data for both 211At and 212Bi radiopharmaceuticals are reviewed. Cautious generic biokinetic models for inorganic and simple organic compounds of 211At and 212Bi; for [211At]-, and [212Bi]-biphosphonates and for [211At]-, and [212Bi]-monoclonal antibodies, are proposed for use in general radiological protection when compound-specific data are not available. (orig.)

  13. The radiolabeled monoclonal antibodies in immunoscintigraphy and radioimmunotherapy: current state and perspectives

    International Nuclear Information System (INIS)

    The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)

  14. Biological toxicity of intracellular radionuclide decay. Part of a coordinated programme on radiation biology of Auger emitters and their therapeutic applications

    International Nuclear Information System (INIS)

    Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125I-labelled Synkavit would be desirable for clinical application

  15. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  16. The biokinetics of alpha-particle emitting radiopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, D.M. [School of Chemistry, Cardiff Univ., Cardiff (United Kingdom); Duffield, J.R. [Faculty of Applied Sciences, Univ. of the West of England, Bristol (United Kingdom)

    2005-07-01

    The past two decades have seen wide interest in the application of alpha-particle emitting radionuclides for targeted endoradiotherapy and a large number of compounds labeled with {sup 211}At (T{sup 1}/{sub 2} 7.21 h), {sup 212}Bi (T{sup 1}/{sub 2} 1 h) or {sup 213}Bi (T{sup 1}/{sub 2} 0.78 h) have been studied. Knowledge of the biokinetic behaviour of such agents is important both for their optimal clinical exploitation and for general radiological protection purposes. Animal studies of the distribution and retention of {sup 211}At compounds, including ionic astatide, substituted aromatic compounds and labelled monoclonal antibodies, have provided new information on the biochemistry of astatine. With respect the thyroid gland the uptake of the astatide ion has been shown to be very much lower than that of the iodide ion. Less information is available for {sup 212}Bi-labelled radiopharmaceuticals. The available data for both {sup 211}At and {sup 212}Bi radiopharmaceuticals are reviewed. Cautious generic biokinetic models for inorganic and simple organic compounds of {sup 211}At and {sup 212}Bi; for [{sup 211}At]-, and [{sup 212}Bi]-biphosphonates and for [{sup 211}At]-, and [{sup 212}Bi]-monoclonal antibodies, are proposed for use in general radiological protection when compound-specific data are not available. (orig.)

  17. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    International Nuclear Information System (INIS)

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 (211At-cMAb U36). Effects on 211At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  18. Tumor immunotargeting using innovative radionuclides.

    Science.gov (United States)

    Kraeber-Bodéré, Françoise; Rousseau, Caroline; Bodet-Milin, Caroline; Mathieu, Cédric; Guérard, François; Frampas, Eric; Carlier, Thomas; Chouin, Nicolas; Haddad, Ferid; Chatal, Jean-François; Faivre-Chauvet, Alain; Chérel, Michel; Barbet, Jacques

    2015-01-01

    This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality. PMID:25679452

  19. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  20. Proceedings of transuranium elements

    International Nuclear Information System (INIS)

    The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium

  1. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  2. Development and radiotherapeutic application of 211At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    International Nuclear Information System (INIS)

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated

  3. Nuclear and chemical data for life sciences

    International Nuclear Information System (INIS)

    Use of reactor produced radionuclides is popular in life sciences. However, cyclotron production of proton rich radionuclides are being more focused in recent times. These radionuclides have already gained attention in various fields, including life sciences, provided they are obtained in pure form. This article is a representative brief of our contributions in generating nuclear data for the production of proton rich radionuclides of terbium, astatine, technetium, ruthenium, cadmium, niobium, zirconium, rhenium, etc., which may have application in clinical, biological, agriculture studies or in basic research. The chemical data required to separate the product isotopes from the corresponding target matrix have been presented along with a few propositions of radiopharmaceuticals. It also emphasizes on the development of simple empirical technique, based on the nuclear reaction model analysis, to generate reliable nuclear data for the estimation of yield and angular distribution of emitted neutrons and light charged particles from light as well as heavy ion induced reactions on thick stopping targets. These data bear utmost important in radiation dosimetry. (author)

  4. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  5. Effect of cetuximab in combination with alpha-radioimmunotherapy in cultured squamous cell carcinomas

    Energy Technology Data Exchange (ETDEWEB)

    Nestor, Marika, E-mail: marika.nestor@bms.uu.s [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden); Sundstroem, Magnus [Unit of Molecular Pathology, Department of Genetics and Pathology, Uppsala University (Sweden); Anniko, Matti [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden)

    2011-01-15

    Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ({sup 211}At-cMAb U36). Effects on {sup 211}At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with {sup 211}At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced {sup 211}At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.

  6. Alpha particle emitters in medicine

    International Nuclear Information System (INIS)

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 (211At) and natural bismuth-212 (212Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 (223Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs

  7. Preparation of 211At-labeled humanized anti-Tac using 211At produced in disposable internal and external bismuth targets

    International Nuclear Information System (INIS)

    These studies describe the production and purification of 211At as well as the procedure for labeling humanized anti-Tac, the antibody to the α-chain of the IL-2 receptor (IL-2Rα), which has been shown to be a useful target for immunotherapy. The optimized protocol combines the advantages of the two-stage dry distillation procedure with the astatination of trialkylstannyl substances as labeling compounds for proteins. The 211At was produced by bombarding either an external or a recently developed disposable internal bismuth target with α-particles from a Cyclotron Corporation CS-30 cyclotron. The 211At was found to contain less than 0.01% 210At. The production rate for the external target was 0.15 mCi ± 0.056 μA-1 h-1 (n = 9) (5.55 MBq μA-1 h-1). The production rate for the internal target was 0.44 ± 0.14 mCi μA-1 h-1 (n = 16) (16.28 MBq μA-1 h-1)

  8. Onset of a Solar Filament Eruption Without a Slow-Rise Phase

    Science.gov (United States)

    Knox, J. M.; Sterling, A.; Falconer, D. A.; Moore, R. L.

    2013-01-01

    We observe a filament eruption of 23 Jan 2012 using Atmospheric Imaging Array (AIA) data from the Solar Dynamics Observatory (SDO) satellite. Relatively cool emissions (193 Ang. channel) show a filament with a rise-toward-eruption trajectory that is relatively smooth, without a distinct, linearly-increasing "slow rise" followed by an abrupt "fast rise," as is often seen in other events. Detailed investigations of some of those two-phase events suggested that they were triggered by magnetic flux cancellation. Here however, observations of hotter emissions (335 Ang. channel) show an adjacent eruption, invisible in 193 Ang., occurred just prior to the filament's eruption start. We surmise that the hotter eruption destabilized the 193 Ang. filament, triggering its eruption onset. In this way, the filament's smooth eruption trajectory is indicative of a non-tether-cutting eruption-onset mechanism for the filament.

  9. New data on cross-sections of deuteron induced nuclear reactions on gold up to 50 MeV and comparison of production routes of medically relevant Au and Hg radioisotopes

    CERN Document Server

    Tárkányi, F; Ditrói, F; Takács, S; Adam-Rebeles, R

    2016-01-01

    Investigations of cross-sections of deuteron induced nuclear reactions on gold were extended up to 50 MeV by using the standard stacked foil irradiation technique and high resolution gamma-ray spectrometry. New cross-sections are reported for the $^{197}$Au(d,xn)$^{197m,197g,195m,195g,193m,193g}$Hg and $^{197}$Au(d,x)$^{198m,198g,196m,196g,195,194}$Au nuclear reactions. The application for production of the medically relevant isotopes $^{198}$Au and $^{195m,195g,197m,197g}$Hg is discussed, including the comparison with other charged particle induced production routes. The possible use of the $^{197}$Au(d,x)$^{197m,197g,195m,193m}$Hg and $^{196m,196g}$Au reactions for monitoring deuteron beam parameters is also investigated.

  10. Methicillin-resistant staphylococcal colonization in dogs entering a veterinary teaching hospital.

    Science.gov (United States)

    Hanselman, Beth A; Kruth, Stephen; Weese, J Scott

    2008-01-01

    Nasal, axillary and rectal swabs were collected from 193 dogs admitted to the Ontario Veterinary College Veterinary Teaching Hospital. Enrichment culture was performed and coagulase positive staphylococci were identified via standard methods. Methicillin-resistant Staphylococcus pseudintermedius was isolated from 4/193 (2.1%) dogs, and methicillin-resistant Staphylococcus aureus and methicillin-resistant Staphylococcus schleiferi subsp. coagulans were each isolated from 1/193 (0.5%) dogs. Methicillin-resistant Staphylococcus intermedius was not identified. All S. pseudintermedius isolates were unrelated on pulsed-field gel electrophoresis. Evaluation of the epidemiology of methicillin-resistant staphylococcal colonization is necessary to understand the apparent emergence of these strains and to develop appropriate control strategies. PMID:17643874

  11. Solar Wind Associated with Near Equatorial Coronal Hole

    Indian Academy of Sciences (India)

    M. Hegde; K. M. Hiremath; Vijayakumar H. Doddamani; Shashanka R. Gurumath

    2015-09-01

    Present study probes temporal changes in the area and radiative flux of near equatorial coronal hole associated with solar wind parameters such as wind speed, density, magnetic field and temperature. Using high temporal resolution data from SDO/AIA for the two wave-lengths 193 Å and 211 Å, area and radiative flux of coronal holes are extracted and are examined for the association with high speed solar wind parameters. We find a strong association between different parameters of coronal hole and solar wind. For both the wavelength bands, we also compute coronal hole radiative energy near the earth and it is found to be of similar order as that of solar wind energy. However, for the wavelength 193 Å, owing to almost similar magnitudes of energy emitted by coronal hole and energy due to solar wind, it is conjectured that solar wind might have originated around the same height where 193 Å line is formed in the corona.

  12. Dicty_cDB: SLB140 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB140 (Link to dictyBase) - - - Contig-U16455-1 SLB140Z (Link... to Original site) - - SLB140Z 723 - - - - Show SLB140 Library SL (Link to library) Clone ID SLB140 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLB1-B/SLB140Q.Seq.d/ Representative seq. ID SLB14...0Z (Link to Original site) Representative DNA sequence >SLB140 (SLB140Q) /CSM/SL/SLB1-B/SLB140Q.Seq.d/ XXXXX...3 0.0 SLE193 (SLE193Q) /CSM/SL/SLE1-D/SLE193Q.Seq.d/ 1403 0.0 SLB795 (SLB795Q) /CSM/SL/SLB7-D/SLB795Q.Seq.d/ 1403 0.0 SLB249 (SLB

  13. Dicty_cDB: SLB158 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB158 (Link to dictyBase) - - - Contig-U16455-1 SLB158Z (Link... to Original site) - - SLB158Z 721 - - - - Show SLB158 Library SL (Link to library) Clone ID SLB158 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLB1-C/SLB158Q.Seq.d/ Representative seq. ID SLB15...8Z (Link to Original site) Representative DNA sequence >SLB158 (SLB158Q) /CSM/SL/SLB1-C/SLB158Q.Seq.d/ XXXXX... SLE193 (SLE193Q) /CSM/SL/SLE1-D/SLE193Q.Seq.d/ 1407 0.0 SLB795 (SLB795Q) /CSM/SL/SLB7-D/SLB795Q.Seq.d/ 1407 0.0 SLB249 (SLB

  14. Process requirement of self-aligned multiple patterning

    Science.gov (United States)

    Natori, Sakurako; Yamauchi, Shohei; Hara, Arisa; Yamato, Masatoshi; Oyama, Kenichi; Yaegashi, Hidetami

    2013-03-01

    EUV lithography is one of the most promising techniques for the advanced patterning, however it is well known that EUVL solutions still face significant challenges. Therefore we have focused on 193 based self-aligned multiple patterning, because SAMP(SADP to SAQP) easily enables fine periodical patterning. As you know, current EUVL cannot satisfy enough resolution for sub 10nm hp critical patterning. We have already introduced innovative 193 based SADP/SAQP techniques and have demonstrated results in past SPIE sessions.[1][2][3][4] we will recommend the dry cleaning technique for the pattern collapse issue of 2nd core formation. On the other hand, we have to assume the possibility of EUV+SADP in order to interpolate the EUV resolution limit. In this paper, we will discuss about the requirement process factors of 193+SAQP and EUV+SADP.

  15. Solar Wind Associated with Near Equatorial Coronal Hole

    Science.gov (United States)

    Hegde, M.; Hiremath, K. M.; Doddamani, Vijayakumar H.; Gurumath, Shashanka R.

    2015-09-01

    Present study probes temporal changes in the area and radiative flux of near equatorial coronal hole associated with solar wind parameters such as wind speed, density, magnetic field and temperature. Using high temporal resolution data from SDO/AIA for the two wavelengths 193 Å and 211 Å, area and radiative flux of coronal holes are extracted and are examined for the association with high speed solar wind parameters. We find a strong association between different parameters of coronal hole and solar wind. For both the wavelength bands, we also compute coronal hole radiative energy near the earth and it is found to be of similar order as that of solar wind energy. However, for the wavelength 193 Å, owing to almost similar magnitudes of energy emitted by coronal hole and energy due to solar wind, it is conjectured that solar wind might have originated around the same height where 193 Å line is formed in the corona.

  16. A clone of irradiated banana cultivar 'Williams' with high yield potential

    International Nuclear Information System (INIS)

    Efforts to improve banana in the Sudan started effectively with three IAEA mutation breeding projects. The most common banana cultivar is 'Dwarf Cavendish', which covers almost 95% of the area under banana production. This cultivar is considered as the most adapted banana cultivar to different climatic conditions, but it is prone to 'choke throat' and has low yield potential. Banana cv. 'Williams' was irradiated at the IAEA/FAO laboratories, Seibersdorf, Austria. Based on preliminary evaluation of the material, 5 mutants (i.e. W193-3, W188-3, W205-4, W206-1 and W224-4) were selected as single plants and propagated by tissue culture. Multi-location testing was carried out for these mutants with cvs. 'Dwarf Cavendish' and 'Williams as standard cultivars in a randomized complete block design with 4 replications and 25 plants per replication. Spacing was 2 x 2 m (2500 plant per ha) and one sucker was retained. The bunch weight and cumulative yield of clone 193-3 were significantly higher than all banana genotypes. The high yield of clone W193-3 in the plant crop was due to the significantly higher number of hands per bunch and larger fingers. The plant height at shooting and pseudostem girth were significantly higher in clone W193-3. The stability parameters for bunch weight of the different clones showed that clone W193-3 was stable with high yield in all environments. Clone W193-3 was released as a new banana cultivar for farmers under the names 'Albeely'. (author)

  17. First results from the UNISOR collinear laser facility

    International Nuclear Information System (INIS)

    The hyperfine structure and isotope shifts of /sup 189m, 191m, 193m, 193g/Tl have been measured by means of collinear fast-beam/laser spectroscopy. Deformations for the 9/2- isomers are determined to be larger than for the 1/2+ ground state and increase with decreasing neutron number. Despite different deformations, rotational properties are nearly identical in /sup 185 to 199/Tl. Microscopic theory ascribes this to a systematic balance between changing deformation and neutron pairing. 8 refs., 4 figs

  18. Superdeformed bands of odd nuclei in A=190 region in the quasiparticle picture

    International Nuclear Information System (INIS)

    Properties of the superdeformed (SD) bands of 195Pb and 193Hg have been studied by the cranked Hartree-Fock-Bogoliubov method. The calculations reproduce the flat behavior of the dynamical moment of inertia of two of the SD bands of 195Pb measured recently. Possible configuration assignments for the observed bands 3 and 4 of 195Pb are discussed. The two interacting SD bands of 193Hg have also been calculated. The analysis confirms the superiority of a density-dependent pairing force over a seniority pairing interaction. (author)

  19. Dipole bands in the oblate-shaped {sup 195}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Kaci, M. [Paris-11 Univ., 91 - Orsay (France). Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse; Porquet, M.G. [Paris-11 Univ., 91 - Orsay (France). Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse; Hannachi, F. [Paris-11 Univ., 91 - Orsay (France). Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse; Aiche, M. [Paris-11 Univ., 91 - Orsay (France). Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse; Bastin, G. [Paris-11 Univ., 91 - Orsay (France). Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse; Deloncle, I. [Paris-11 Univ., 91 - Orsay (France). Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse; Gall, B.J.P. [Paris-11 Univ., 91 - Orsay (France). Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse; Schueck, C. [Paris-11 Univ., 91 - Orsay (France). Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse; Azaiez, F. [Institut de Physique Nucleaire (IPN), 91 - Orsay (France); Beausang, C.W. [Liverpool Univ. (United Kingdom). Oliver Lodge Lab.; Bourgeois, C. [Institut de Physique Nucleaire (IPN), 91 - Orsay (France); Clark, R.M. [York Univ. (United Kingdom). Dept. of Physics; Duffait, R. [Lyon-1 Univ., 69 - Villeurbanne (France). Inst. de Physique Nucleaire; Duprat, J. [Institut de Physique Nucleaire (IPN), 91 - Orsay (France); Hauschild, K. [York Univ. (United Kingdom). Dept. of Physics; Joyce, M.J. [Liverpool Univ. (United Kingdom). Oliver Lodge Lab.; Korichi, A. [Institut de Physique Nucleaire (IPN), 91 - Orsay (France); Le Coz, Y. [Lyon-1 Univ., 69 - Villeurbanne (France). Inst. de Physique Nucleaire; Meyer, M. [Lyon-1 Univ., 69 - Villeurbanne (France). Inst. de Physique Nucleaire; Paul, E.S. [Liverpool Univ. (United Kingdom). Oliver Lodge Lab.; Perrin, N. [Institut de Physique Nucleaire (IPN), 91 - Orsay (France); Poffe, N. [Institut de Physique Nucleaire (IPN), 91 - Orsay (France)]|[Oxford Univ. (United Kingdom). Dept. of Physics

    1996-04-01

    The nucleus {sup 195}Pb has been populated with the {sup 184}W+{sup 16}O reaction at 113 MeV. Two dipole {gamma}-ray cascades have been observed using the EUROGAM spectrometer. A comprehensive level scheme related to these structures has been established. Multiparticle configurations are attributed to these high-spin structures from detailed comparison with the neighbouring nuclei, {sup 193}Hg, {sup 194}Pb and {sup 195}Tl. Band crossings due to i13/2 neutron pair breaking are observed in {sup 195}Pb at about the same frequencies as in the isotone {sup 193}Hg. (orig.)

  20. Dipole bands in the oblate-shaped 195Pb

    International Nuclear Information System (INIS)

    The nucleus 195Pb has been populated with the 184W+16O reaction at 113 MeV. Two dipole γ-ray cascades have been observed using the EUROGAM spectrometer. A comprehensive level scheme related to these structures has been established. Multiparticle configurations are attributed to these high-spin structures from detailed comparison with the neighbouring nuclei, 193Hg, 194Pb and 195Tl. Band crossings due to i13/2 neutron pair breaking are observed in 195Pb at about the same frequencies as in the isotone 193Hg. (orig.)

  1. Improvement of Soil Carbon Determination using laser-induced breakdown spectroscopy

    Science.gov (United States)

    Moon, S. J.

    2014-12-01

    The increase of atmospheric greenhouse gases such as CO2 has caused noticeable climate change. Since increased CO2 may contribute to carbon storage in terrestrial ecosystems through the CO2 cycle between the atmosphere and vegetation, it is necessary to improve methods for measuring C in soil. In this study, we determined the total carbon concentrations of soils using a laser-induced breakdown spectroscopy (LIBS). The LIBS is a minimally destructive measurement technique that uses an ultra-short laser pulse to create plasma on the sample surface via the process of laser ablation. Compared with the traditional C measurements methods techniques such as wet oxidation and dry combustion, LIBS is known as a potentially elegant and promising solution for measuring C in soils. Although previous studies suggested the advantages of LIBS for measuring the C in soils, there are still challenging obstacles to be solved in measuring C. Previous studies have shown that the C in soil can be detected at wavelengths of 193.03 and 247.86 nm. The C line at 247.86 nm shows strong interference with Fe lines at 247.86 nm and 247.95 nm due to overlapping or self-absorption. To dismiss the problem of measuring the C line at 247.86 nm, the C line at 193.03 nm has been used to observe C emission. The C line at 193.03 nm can be quantified without interference from other elements, however, the ratio of Al line (198.90 nm) and Si line (212.40 nm) were used as standardizing factors to develop a significant calibration curve for soils. Although the wavelengths of both 193.03 and 247.86 nm presented the potential to measure C in soils, there has still been a lack of studies comparing the accuracy and effectiveness between the 193.03- and 247.8-nm C lines to analyze soil samples with different chemical and textural characteristics. In this study, we conducted extensive measurements of the C lines at 193.03 and 247.86 nm using LIBS to evaluate the C concentrations of Korean soils with different

  2. Dicty_cDB: Contig-U16055-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9822 Start point 2742478 End point 2740389 Strand (PLUS/MINUS) MINUS Number of clones 9 Number of EST 15 Lin...055-1Q) /CSM_Contig/Contig-U16055-1Q.Seq.d Length = 2100 Score = 551 bits (278), Expect = e-156 Identities = 278/278 (100%) Strand...actccaatcactaccactaccacc 278 Score = 507 bits (256), Expect = e-143 Identities = 256/256 (100%) Strand...2 bits (228), Expect = e-126 Identities = 228/228 (100%) Strand = Plus / Plus Query: 1373 ttagctgaaattgagaag...371 bits (187), Expect = e-102 Identities = 193/193 (100%) Strand = Plus / Plus Q

  3. The Effects of Anti-Dementia and Nootropic Treatments on the Mortality of Patients with Dementia: A Population-Based Cohort Study in Taiwan

    OpenAIRE

    Chen-Yi Wu; Hsiao-Yun Hu; Lok-Hi Chow; Yiing-Jenq Chou; Nicole Huang; Pei-Ning Wang; Chung-Pin Li

    2015-01-01

    Background Few studies have examined the contribution of treatment on the mortality of dementia based on a population-based study. Objective To investigate the effects of anti-dementia and nootropic treatments on the mortality of dementia using a population-based cohort study. Methods 12,193 incident dementia patients were found from 2000 to 2010. Their data were compared with 12,193 age- and sex-matched non-dementia controls that were randomly selected from the same database. Dementia was cl...

  4. Heat capacity measurement of organic thermal energy storage materials

    Energy Technology Data Exchange (ETDEWEB)

    Divi, Suresh [Chemical and Metallurgical Engineering Department (MS388), College of Engineering, University of Nevada, Reno, NV 89557 (United States); Chellappa, Raja [Chemical and Metallurgical Engineering Department (MS388), College of Engineering, University of Nevada, Reno, NV 89557 (United States); Chandra, Dhanesh [Chemical and Metallurgical Engineering Department (MS388), College of Engineering, University of Nevada, Reno, NV 89557 (United States)]. E-mail: dchandra@unr.edu

    2006-11-15

    The heat capacities of tris(hydroxymethyl)aminomethane (TRIS), 2-amino-2-methyl-1,3-propanediol (AMPL), and neopentylglycol (NPG) are measured from (193.15 to 473.15) K by modulated differential scanning calorimetry (MDSC). The heat capacities of the low temperature layered or chain ordered phases, high temperature orientationally disordered phases, and the liquid phases are reported for these compounds. The low temperature heat capacities (193.15 to 280) K of AMPL are reported for the first time. The heat capacities obtained from our MDSC experiments are in good agreement with adiabatic calorimetry measurements.

  5. Heat capacity measurement of organic thermal energy storage materials

    International Nuclear Information System (INIS)

    The heat capacities of tris(hydroxymethyl)aminomethane (TRIS), 2-amino-2-methyl-1,3-propanediol (AMPL), and neopentylglycol (NPG) are measured from (193.15 to 473.15) K by modulated differential scanning calorimetry (MDSC). The heat capacities of the low temperature layered or chain ordered phases, high temperature orientationally disordered phases, and the liquid phases are reported for these compounds. The low temperature heat capacities (193.15 to 280) K of AMPL are reported for the first time. The heat capacities obtained from our MDSC experiments are in good agreement with adiabatic calorimetry measurements

  6. AcEST: BP912540 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_B03 501 Adiantum capillus-veneris mRNA. clone: YMU001_000020_B03. BP912540 - Show ... 2 EELTVHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAV 181 EE VH TAS+GDVE LKA LA G +KDE+DSEGRTAL ... ry: 14 VHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAVDAVD 193 +H A V ++ LL GAD KD G LH AC YG AE ... uery: 26 ASVGDVEALKALLAEGADKDEKDSEGR--TALHFACGYGEVMCAE VLLEAGVAVDAVDKN 199 + GD+E +K L + + + +D EGR T LHFA ... ry: 14 VHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAVDAVD 193 +H A ++E + LL GAD + +D G LH A YG ...

  7. The SOPHIE search for northern extrasolar planets II. A multiple planet system around HD 9446

    OpenAIRE

    Hebrard, G.; Bonfils, X.; Segransan, D.; Moutou, C.; Delfosse, X.; Bouchy, F.; Boisse, I.; Arnold, L; Desort, M.; Diaz, R. F.; Eggenberger, A.; Ehrenreich, D.; Forveille, T.; Lagrange, A.-M.; Lovis, C.

    2010-01-01

    We report the discovery of a planetary system around HD9446, performed from radial velocity measurements secured with the spectrograph SOPHIE at the 193-cm telescope of the Haute-Provence Observatory during more than two years. At least two planets orbit this G5V, active star: HD9446b has a minimum mass of 0.7 M_Jup and a slightly eccentric orbit with a period of 30 days, whereas HD9446c has a minimum mass of 1.8 M_Jup and a circular orbit with a period of 193 days. As for most of the known m...

  8. EST Table: CK524993 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available CK524993 rswfa0_000692.y1 10/09/29 65 %/193 aa ref|XP_001600958.1| PREDICTED: simil...9/10 65 %/203 aa gnl|Amel|GB30214-PA 10/09/10 67 %/193 aa gi|189237999|ref|XP_001812951.1| PREDICTED...0/08/28 low homology 10/09/10 61 %/202 aa AGAP005604-PA Protein|2L:17803628:17804284:1|gene:MED20_ANOGA 10/0

  9. STAR's latest results on quarkonium production

    CERN Document Server

    Trzeciak, Barbara

    2015-01-01

    In this proceedings, we report the latest results of J/psi and Upsilon production from the STAR experiment at RHIC, in different colliding systems and colliding energies. J/psi nuclear modification factors (R_{AA}) in Au+Au collisions at 200, 62.4 and 39 GeV and in U+U collisions at 193 GeV, Upsilon R_{AA} in d+Au and Au+Au collisions at 200 and in U+U collisions at 193 GeV are shown and compared to different theoretical models. We also present prospects of quarkonium measurements at STAR.

  10. Characterization of two mutant metJ proteins with reduced, temperature-dependent capacity to regulate Escherichia coli K-12 met regulon elements.

    OpenAIRE

    Bala, G A; Collier, C D; Emmett, M R; Johnson, J R

    1989-01-01

    At 28 degrees C, but not at 34 or 42 degrees C, strains with the metJ193 allele repressed chromosomal met genes but not a plasmid-borne met promoter. Increasing the metJ193 gene dosage to two copies resulted in overrepression of chromosomal and plasmid-borne met promoters at 28 degrees C. Suppressing the metJ185 amber mutation with supF (tRNATyr) produced the MetJ185F protein. Strains producing MetJ185F repressed chromosomal met promoters but not a plasmid-borne met promoter at 42 degrees C. ...

  11. High power, diffraction limited picosecond oscillator based on Nd:GdVO4 bulk crystal with σ polarized in-band pumping.

    Science.gov (United States)

    Lin, Hua; Guo, Jie; Gao, Peng; Yu, Hai; Liang, Xiaoyan

    2016-06-27

    We report on a high power passively mode-locked picosecond oscillator based on Nd:GdVO4 crystal with σ polarized in-band pumping. Thermal gradient and thermal aberration was greatly decreased with proposed configuration. Maximum output power of 37 W at 81 MHz repetition rate with 19.3 ps pulse duration was achieved directly from Nd:GdVO4 oscillator, corresponding to 51% optical efficiency. The oscillator maintained diffraction limited beam quality of M2 pulse duration between 11.2 ps to 19.3 ps. PMID:27410558

  12. AcEST: BP914032 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ome assembly protein 10 OS=Pichia a... 57 6e-08 sp|O88846|RNF4_RAT RING finger protein 4 OS=Rattus norvegicu...s GN... 54 5e-07 sp|Q9QZS2|RNF4_MOUSE RING finger protein 4 OS=Mus musculus GN=Rn...+++++CP CR ++ SQ+ Sbjct: 239 PEASR----TCMLCLSPMKDPSCGECGHVFCWKCVLDWVKERQECPLCRAKMRESQL 291 >sp|O88846|RNF4_R... ++++ CPTCRK++ + + H Y Sbjct: 134 VSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIY 193 >sp|Q9QZS2|RNF4...C +C+ ++++ CPTCRK++ + + H Y Sbjct: 134 VSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIY 193 >sp|P78317|RNF4

  13. Towards Kurdish studies in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Kubálek, Petr

    Wien : Wiener Verlag für Sozialforschung, 2014, s. 193-234 ISBN 978-3-944690-32-2. - (Wiener Jahrbuch für Kurdische Studien. Österreichische Gesellschaft zur Förderung der Kurdologie, Europäisches Zentrum für Kurdische Studien) Institutional support: RVO:68378009 Keywords : Czech Republic * Czecoslovakia * Kurds Subject RIV: AB - History

  14. AcEST: BP916042 [AcEST

    Lifescience Database Archive (English)

    Full Text Available SVIPVAEGS-WGLEPLRRSSYLVKGMRRMSFSLNLFFAIAGLVLALWANYLQSSAS 258 Query: 210 ----LLQHVIGQFAAASVICLA...FVR 402 Query: 213 WLLQHVIGQFAAASVICLAQMYFLVLWLIFYMSARS--LHDQPSHFSYRTLEDFLDRFR 43 W L G+ AA + ++YF+V WLIFY +AR...GRDIVREGVYLLSTMLNQAIQIKCLEAIFCGSFVR 412 Query: 213 WLLQHVIGQFAAASVICLAQMYFLVLWLIFYMSARS--LHDQPSHFSYRTLEDFLDR... = -2 Query: 369 CIYMIACWVTILERNY-WGLGAVTRSGNLVKGMKWQALVIRLIEAAVCGRTARWLLQHVI 193...SLMACSVITMMCVTILGTRWQLLYSCIAVVLACGACAFWALPFLIAKVS---- 435 Query: 168 ICLAQMYFLVLWL-----IFYMSARSLHDQPSHFSY 76

  15. Experimental investigation and thermodynamic description of the In-Sb-Sn ternary system

    Czech Academy of Sciences Publication Activity Database

    Manasijevič, D.; Vřešťál, J.; Minic, D.; Kroupa, Aleš; Zivkovic, D.; Zivkovic, Z.

    2008-01-01

    Roč. 450, 1-2 (2008), s. 193-199. ISSN 0925-8388 R&D Projects: GA MŠk(CZ) OC08053 Institutional research plan: CEZ:AV0Z20410507 Keywords : In-Sb-Sn system * phase diagram * CALPHAD Subject RIV: BJ - Thermodynamics Impact factor: 1.510, year: 2008

  16. Dicty_cDB: Contig-U10506-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available = 9e-54 Identities = 194/194 (100%) Strand = Plus / Plus Query: 14 tccaaanaaaatccnanaaccatatttnttaatattnccaa...aatcgganatcatcnttnc 73 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 14 tccaaanaaaatccna...ct: 74 caatttnganaaaaccnttggnaaaacttggnttattgattttgaaaaanaaacaactaa 133 Query: 134 aatccnanatggnagnttcnttncn...||||||||||||||||||| Sbjct: 134 aatccnanatggnagnttcnttncnaatattnaaaanacnttnattcnttggaanagaca 193 Query: 194 n... Score = 206 bits (104), Expect(2) = 2e-60 Identities = 194/194 (100%) Strand = Plus / Minus Query: 14 tccaaanaaaatccna

  17. Dicty_cDB: Contig-U12752-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s (55), Expect = 1e-24 Identities = 182/193 (94%) Strand = Plus / Plus Query: 11 gagtttgttgatttngatccnaaaccn...nnnnnnngnaaaantgntgctgttgtttcantt 70 ||||||||||||||||||||||||||| || |||||||||||||||||||||||||| Sbjct: 11 gagtttgttgatttngatccna...Sbjct: 131 ggtaaaaaangttntnactnctggaaancnagtcaaggngntncaanggccncntcaaan 190 Query: 191 gccna...tccccttt 203 ||||||||||||| Sbjct: 191 gccnatccccttt 203 >Contig-U11508-1 (Contig-U11508-1Q) /CSM_...) Strand = Plus / Plus Query: 11 gagtttgttgatttngatccnaaaccnnnnnnnngnaaaantgntgctgttgtttcantt 70 ||||||| |||

  18. New Versatile Strategy towards Zinc(II)-, Copper(II)- and Cobalt(II)-Metallated Thiophene/Porphyrin-Hybrids

    Czech Academy of Sciences Publication Activity Database

    Zöllner, M. J.; Becker, E.; Jahn, Ullrich; Kowalsky, W.; Johannes, H. H.

    -, č. 23 (2010), s. 4426-4435. ISSN 1434-193X Grant ostatní: DLR(DE) FKZ 01BI565 Institutional research plan: CEZ:AV0Z40550506 Keywords : porphyrin oids * ligand design * hybrid monomers * UV/Vis spectroscopy * cyclic voltammetry Subject RIV: CC - Organic Chemistry Impact factor: 3.206, year: 2010

  19. Systematic study of muonic atoms in the A = 100 to A = 140 nuclear mass regions (isotope and isotone shifts) and model-independent precision measurements of ground-state quadrupole moments of odd-A nuclei. Progress report No. 8, October 16, 1982-October 15, 1983

    International Nuclear Information System (INIS)

    Topics covered include: precision measurements of nuclear ground-state quadrupole moments in the mass region A = 150 to A = 193; monopole and quadrupole charge parameters of deformed nuclei; quadrupole and hexadecapole moments of U and Pu nuclei; systematics of nuclear charge radii (isotope and isotone shifts) in the A = 100 to A = 140 mass region; and pionic-atom measurements

  20. Biodegradace polychlorovaných bifenylů pomocí ligninolytických hub v kontaminované půdě

    Czech Academy of Sciences Publication Activity Database

    Křesinová, Zdena; Filipová, Alena; Kožená, Lenka; Cajthaml, Tomáš

    Chrudim: Vodní zdroje Ekomonitor spol. s.r.o, 2010. s. 192-193. ISBN 978-80-86832-51-7 R&D Projects: GA MŠk LC06066; GA MŠk 2B06156 Institutional research plan: CEZ:AV0Z50200510 Keywords : white rot fungi Subject RIV: EE - Microbiology, Virology

  1. Feeding habits of reintroduced Eurasian beaver: spatial and seasonal variation in the use of food resources

    Czech Academy of Sciences Publication Activity Database

    Krojerová-Prokešová, Jarmila; Barančeková, Miroslava; Hamšíková, L.; Vorel, A.

    2010-01-01

    Roč. 281, č. 3 (2010), s. 183-193. ISSN 0952-8369 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60930519 Keywords : Castor fiber * diet composition * faecal analysis * PCA Subject RIV: EH - Ecology, Behaviour Impact factor: 1.787, year: 2010

  2. Comparison of Reading Performance between Visually Impaired and Normally Sighted Students in Malaysia

    Science.gov (United States)

    Mohammed, Zainora; Omar, Rokiah

    2011-01-01

    The aim of this study is to compare reading performance between visually impaired and normally sighted school children. Participants (n = 299) were divided into three groups: normal vision (NV, n = 193), visually impaired print reader (PR, n = 52), and Braille reader (BR, n = 54). Reading performance was determined by measuring reading rate and…

  3. Omsk Hemorrhagic Fever Virus

    Czech Academy of Sciences Publication Activity Database

    Růžek, Daniel; Holbrook, M.R.; Yakimenko, V. V.; Karan, L. S.; Tkachev, S. E.

    New York: CRC Press, 2014 - (Liu, D.), s. 193-200 ISBN 978-1-4665-5396-5 R&D Projects: GA ČR GPP302/10/P438; GA ČR GAP502/11/2116 Institutional support: RVO:60077344 Keywords : OHF * Russia * epidemiology Subject RIV: EE - Microbiology, Virology

  4. 76 FR 56330 - Standards of Ethical Conduct for Employees of the Executive Branch; Proposed Amendments Limiting...

    Science.gov (United States)

    2011-09-13

    ... promulgated by the Office of Government Ethics in 1992 and are codified at 5 CFR part 2635. See 57 FR 35005... to sign an ``Ethics Pledge.'' Exec. Order 13490, section 1, 74 FR 4673, 3 CFR, 2009 Comp., p. 193... employee might use his or her official position for private gain. See 56 FR 33777, 33780 (July 23,...

  5. In Vitro Approaches to Evaluation of Sun Protectin Factor

    Czech Academy of Sciences Publication Activity Database

    Bendová, H.; Akrman, J.; Krejčí, A.; Kubáč, L.; Jírová, D.; Kejlová, K.; Kolářová, H.; Brabec, Marek; Malý, M.

    2007-01-01

    Roč. 21, č. 7 (2007), s. 1268-1275. ISSN 0887-2333 Source of funding: V - iné verejné zdroje Keywords : sunscreens * in vitro * SPF * nonparametric model Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 2.193, year: 2007

  6. Pohřby jedinců s postižením pohybového aparátu na pohřebišti kultury zvoncovitých pohárů v Kolíně, střední Čechy

    Czech Academy of Sciences Publication Activity Database

    Brzobohatá, Hana; Šumberová, Radka; Likovský, Jakub

    2015-01-01

    Roč. 67, č. 2 (2015), s. 193-212. ISSN 0323-1267 R&D Projects: GA MK(CZ) DF12P01OVV032 Keywords : Eneolithic * trochanteritis * Bell Beaker culture * paleopathology * congenital hip dislocation * ulnar fracture * spatial structure of cemetery Subject RIV: AC - Archeology, Anthropology, Ethnology

  7. Prolonged sedentary time and physical activity in workplace and non-work contexts: a cross-sectional study of office, customer service and call centre employees

    OpenAIRE

    Thorp Alicia A; Healy Genevieve N; Winkler Elisabeth; Clark Bronwyn K; Gardiner Paul A; Owen Neville; Dunstan David W

    2012-01-01

    Abstract Background To examine sedentary time, prolonged sedentary bouts and physical activity in Australian employees from different workplace settings, within work and non-work contexts. Methods A convenience sample of 193 employees working in offices (131), call centres (36) and customer service (26) was recruited. Actigraph GT1M accelerometers were used to derive percentages of time spent sedentary (

  8. Synthesis of Lupane-Type Saponins Containing an Unusual alpha-D-Idopyranoside Fragment as Potent Cytotoxic Agents

    Czech Academy of Sciences Publication Activity Database

    Cmoch, P.; Korda, A.; Rárová, Lucie; Oklešťková, Jana; Strnad, Miroslav; Gwardiak, K.; Karczewski, R.; Pakulski, Z.

    JUL 2014, č. 19 (2014), s. 4089-4098. ISSN 1434-193X R&D Projects: GA MŠk(CZ) LO1204; GA ČR GA14-19590S Institutional support: RVO:61389030 Keywords : Carbohydrates * Glycoconjugates * Glycosylation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.065, year: 2014

  9. Hopanoids in Bacteria and Cyanobacteria – Their Role in Cellular Biochemistry and Physiology, Analysis and Occurrence

    Czech Academy of Sciences Publication Activity Database

    Řezanka, Tomáš; Siřišťová, L.; Melzoch, K.; Sigler, Karel

    2010-01-01

    Roč. 7, č. 4 (2010), s. 300-313. ISSN 1570-193X Institutional research plan: CEZ:AV0Z50200510 Keywords : bacteriohopanol * apci * hplc Subject RIV: EE - Microbiology, Virology Impact factor: 2.284, year: 2010

  10. Touchstones and mercury at Hedeby

    Czech Academy of Sciences Publication Activity Database

    Ježek, Martin; Holub, M.

    2014-01-01

    Roč. 89, č. 1 (2014), s. 193-204. ISSN 0079-4848 Institutional support: RVO:67985912 Keywords : Hedeby * Viking Age * grave goods * touchstone * precious metal * mercury * chemical microanalysis * archaeometallurgy Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 0.278, year: 2014

  11. Altered vitamin D status in liver tissue and blood plasma from Greenland sledge dogs (Canis familiaris) dietary exposed to organohalogen contaminated minke whale (Balaenoptera acuterostrata) blubber

    DEFF Research Database (Denmark)

    Sonne, Christian; Kirkegaard, Maja; Jakobsen, Jette;

    2014-01-01

    exposed and six control sister bitches (maternal generation) and their three exposed and four control pups, respectively, were daily fed 112g whale blubber (193µg ∑PCB/day) or porcine fat (0.17µg ∑PCB/day). Mean level of ∑PCB in adipose tissue of exposed bitches and their pups was 3106 and 2670ng/g lw...

  12. Moulting and wintering grounds of Marsh Warblers Acrocephalus palustris: evidence from stable isotopes and ring recoveries

    Czech Academy of Sciences Publication Activity Database

    Procházka, Petr; Kralj, J.; Pearson, D. J.; Yohannes, E.

    2014-01-01

    Roč. 49, č. 2 (2014), s. 193-200. ISSN 0001-6454 R&D Projects: GA ČR GA13-06451S Institutional support: RVO:68081766 Keywords : bird migration * feather stable isotopes * ring recoveries * stopover * migratory connectivity * δ13C * δ15N Subject RIV: EG - Zoology Impact factor: 0.745, year: 2014

  13. Kepler´s conversation with Galilei

    Czech Academy of Sciences Publication Activity Database

    Hadravová, Alena; Hadrava, Petr

    Praha : Národní technické muzeum v Praze, 2010 - (Hadravová, A.; Mahoney, T.; Hadrava, P.), s. 143-151 ISBN 978-80-7037-193-0. - (Acta historiae rerum naturalium necnon technicarum. 10) Institutional research plan: CEZ:AV0Z80630520; CEZ:AV0Z10030501 Keywords : history of astronomy * Galileo Galilei Subject RIV: AB - History

  14. Emil Kolben. Od elektrotechnika přes inovátora k podnikateli

    Czech Academy of Sciences Publication Activity Database

    Šimůnek, Michal V.

    Praha : Ústav pro soudobé dějiny AV ČR, 2015 - (Grygarová, D.; Hermann, T.; Šimůnek, M.), s. 9-25 ISBN 978-80-7285-193-5 Institutional support: RVO:68378114 Keywords : Emil Kolben * history of technology * history of science Subject RIV: AB - History

  15. Characterisation of the chemical profiles of Brazilian and Andean morphotypes belonging to the Anastrepha fraterculus complex (Diptera, Tephritidae)

    Czech Academy of Sciences Publication Activity Database

    Vaníčková, Lucie; Břízová, Radka; Pompeiano, A.; Ferreira, L. L.; De Aquino, N. C.; Tavares, R. F.; Rodriguez, L. D.; Mendonca, A. L.; Canal, N. A.; do Nascimento, R. R.

    -, č. 540 (2015), s. 193-209. ISSN 1313-2989 Institutional support: RVO:61388963 Keywords : cryptic species * chemotaxonomy * GCxGC/MS * PCA Subject RIV: EG - Zoology Impact factor: 0.933, year: 2014 http://zookeys.pensoft.net/articles.php?id=6224

  16. Psychosociální souvislosti antisociálního chování dospívajících: hlavní výsledky projektu SAHA

    Czech Academy of Sciences Publication Activity Database

    Sobotková, Veronika; Blatný, Marek; Jelínek, Martin; Hrdlička, M.

    Praha: Univerzita Karlova v Praze, 2009, s. 176-193. ISBN 978-80-7308-263-5. [Škola jako místo setkávání II. Praha (CZ), 20.04.2009-20.04.2009] Institutional research plan: CEZ:AV0Z70250504 Keywords : antisocial behaviour * typology * early adolescence Subject RIV: AN - Psychology

  17. Combined in vivo and in silico investigations of activation of glycolysis in contracting skeletal muscle

    NARCIS (Netherlands)

    Schmitz, J. P. J.; Groenendaal, W.; Wessels, B.; Wiseman, R. W.; Hilbers, P. A. J.; Nicolay, K.; Prompers, J. J.; Jeneson, J. A. L.; van Riel, N. A. W.

    2013-01-01

    Schmitz JP, Groenendaal W, Wessels B, Wiseman RW, Hilbers PA, Nicolay K, Prompers JJ, Jeneson JA, van Riel NA. Combined in vivo and in silico investigations of activation of glycolysis in contracting skeletal muscle. Am J Physiol Cell Physiol 304: C180-C193, 2013. First published October 31, 2012; d

  18. Purification of silane via laser-induced chemistry

    Science.gov (United States)

    Clark, John H.; Anderson, Robert G.

    1979-01-01

    Impurities such as PH.sub.3, AsH.sub.3, and B.sub.2 H.sub.6 may be removed from SiH.sub.4 by means of selective photolysis with ultraviolet radiation of the appropriate wavelength. An ArF laser operating at 193 nm provides an efficient and effective radiation source for the photolysis.

  19. Svatováclavský cyklus a další obrazy pro klášter na Zderaze. [Úvodní studie a katalogová hesla

    Czech Academy of Sciences Publication Activity Database

    Dobalová, Sylva

    Praha : Národní galerie, 2010 - (Stolárová, L.; Vlnas, V.), s. 156-159, 160-177, 183-193, 196-197 ISBN 978-80-7035-458-2 Institutional research plan: CEZ:AV0Z80330511 Keywords : baroque painting * St Wenceslas * Antonio Tempesta * Discalced Augustinians Subject RIV: AL - Art, Architecture, Cultural Heritage

  20. Fuel cells. 1977-1978 (citations from the NTIS data base). Report for 1977-78

    Energy Technology Data Exchange (ETDEWEB)

    Cavagnaro, D.M.

    1980-08-01

    This bibliography covers fuel cell applications, components, fabrication, design, catalysts, and chemistry. The citations discuss different types of fuel cells such as hydrogen-oxygen cells, hydrocarbon-air cells, and biochemical cells. (This updated bibliography contains 193 citations, none of which are new entries to the previous edition.)

  1. Retsensioon : Riigikogu VII, VIII ja IX koosseis. Statistikat ja kommentaare. Peatoimetaja Aaro Mõttus. Tallinn : Riigikogu Kantselei, Eesti Rahvusraamatukogu, 2004. 326 lk. / Mart Nutt

    Index Scriptorium Estoniae

    Nutt, Mart, 1962-

    2004-01-01

    Arvustus: Riigikogu VII, VIII ja IX koosseis. Statistikat ja kommentaare / peatoim. Aaro Mõttus. Tallinn : Riigikogu Kantselei, Eesti Rahvusraamatukogu, 2004. - Lisatud: Ott Heinapuu tutvustav sõnum retsenseeritud väljaande kohta lk. 193. - Vt. ka: http://www.riigikogu.ee/rito/index.php?id=11357

  2. Salpingitis isthmica nodosa in female infertility and tubal diseases

    DEFF Research Database (Denmark)

    Skibsted, L; Sperling, Lene; Hansen, U;

    1991-01-01

    infertility, pregnancies, outcome of pregnancies, births, pelvic inflammatory disease and salpingitis. Sections from the isthmus were present in the specimens from 223 tubes from 193 patients and were analysed by the same pathologist. Originally, SIN was found in 12 patients but on re-examination, it was...

  3. 27 CFR 26.194 - Detention of articles.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Detention of articles. 26..., DEPARTMENT OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Shipment of... Detention of articles. (a) Upon receiving a notification in accordance with § 26.193(b), the appropriate...

  4. Content and Timing of Feedback in a Web-based Learning Environment: Effects on Learning as a function of prior knowledge.

    OpenAIRE

    Smits, Marieke; Boon, Jo; Sluijsmans, Dominique; van Gog, Tamara

    2008-01-01

    Smits, M. H. S. B., Boon, J., Sluijsmans, D. M. A., & Van Gog, T. (2008). Content and timing of feedback in a web-based learning environment: Effects on learning as a function of prior knowledge. Interactive Learning Environments, 16, 183-193.

  5. Multi-wavelength observations of Asteroid 2100 Ra-Shalom

    Czech Academy of Sciences Publication Activity Database

    Shepard, M.K.; Clark, B. E.; Nolan, M. C.; Benner, L. A. M.; Ostro, S. J.; Giorgini, J. D.; Vilas, F.; Jarvis, K.; Lederer, S.; Lim, L.F.; McConnochie, T.; Bell, J.; Margot, J. L.; Rivkin, A. S.; Magrik, C.; Scheeres, D.J.; Pravec, Petr

    2008-01-01

    Roč. 193, č. 1 (2008), s. 20-38. ISSN 0019-1035 Institutional research plan: CEZ:AV0Z10030501 Keywords : asteroids composition * radar observations Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.268, year: 2008

  6. Neolithic Occupation of Svratka Alluvial Plain; Case Study from Brno-Přízřenice, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Parma, D.; Vejrostová, L.; Lisá, Lenka; Bajer, A.; Pacina, J.; Gottwald, Z.

    2015-01-01

    Roč. 6, č. 2 (2015), s. 181-193. ISSN 1804-848X Institutional support: RVO:67985831 Keywords : alluvial zone * buried soils * prehistoric occupation * dark earth * geoarchaeology * micromorphology * grain size analysis * magnetic proxies Subject RIV: AC - Archeology, Anthropology, Ethnology http://www.iansa.eu/papers/IANSA-2015-02-parma.pdf

  7. Transnational Strategies for the Promotion of Physical Activity and Active Aging: The World Health Organization Model of Consensus Building in International Public Health

    Science.gov (United States)

    Chodzko-Zajko, Wojtek; Schwingel, Andiara

    2009-01-01

    In this paper we focus our attention on an examination of the four-step process adopted by the World Health Organization (WHO) in its systematic campaign to promote physically active lifestyles by older adults across the 193 WHO member states. The four steps adopted by the WHO include (1) Building Consensus Among Professionals; (2) Educating the…

  8. Synthesis of 6-Substituted 2(1H)-Pyridon-3-yl C-2'-Deoxyribonucleosides

    Czech Academy of Sciences Publication Activity Database

    Chapuis, Hubert Jean; Kubelka, Tomáš; Joubert, Nicolas; Pohl, Radek; Hocek, Michal

    -, č. 9 (2012), s. 1759-1767. ISSN 1434-193X R&D Projects: GA AV ČR IAA400550902 Institutional research plan: CEZ:AV0Z40550506 Keywords : nucleosides * pyridones * cross-coupling * Heck reaction Subject RIV: CC - Organic Chemistry Impact factor: 3.344, year: 2012

  9. Dicty_cDB: VSG688 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSG688 (Link to dictyBase) - - - Contig-U07288-1 VSG688F (Link to Original ... 1573_1( AY921573 |pid:none) Apis mellifera D2-like dopamine ... re... 36 0.52 CP000937_193( CP000937 |pid:none) Fr ...

  10. Kamptonema (Microcoleaceae, Cyanobacteria), a new genus derived from the polyphyletic Phormidium on the basis of combined molecular and cytomorphological markers

    Czech Academy of Sciences Publication Activity Database

    Strunecký, Otakar; Komárek, Jiří; Šmarda, J.

    2014-01-01

    Roč. 86, č. 2 (2014), 193-207. ISSN 0032-7786 R&D Projects: GA ČR GAP506/12/1818 Institutional support: RVO:67985939 Keywords : cyanobacteria * taxonomic revision * polyphasic approach Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.104, year: 2014

  11. School Counselors and Child Abuse Reporting: A National Survey

    Science.gov (United States)

    Bryant, Jill K.

    2009-01-01

    A study was done to investigate school counselors' child abuse reporting behaviors and perceptions regarding the child abuse reporting process. Participants were randomly selected from the American School Counselor Association membership database with 193 school counselors returning questionnaires. Overall, school counselors indicated that they…

  12. 22 CFR 19.11-5 - Commencement, termination and adjustment of annuities.

    Science.gov (United States)

    2010-04-01

    ... day of the month before the survivor's (1) marriage before age 60, or (2) death. If a survivor annuity... 1, 1976, unless elected following a marriage after retirement under circumstances described in § 19...-3 or § 19.10-4. (c) A child's annuity begins on the day after the participant dies, or if a child...

  13. Psychiatric comorbidity reduces quality of life in chronic methadone maintained patients

    NARCIS (Netherlands)

    Carpentier, Pieter J; Krabbe, Paul F M; van Gogh, Mijke T; Knapen, Lieke J M; Buitelaar, Jan K; de Jong, Cor A J

    2009-01-01

    Despite the efficacy of methadone maintenance treatment (MMT), opioid dependence still involves severe impairment of functioning and low quality of life. This study examines the influence of the psychiatric comorbidity of MMT patients on their quality of life. A total of 193 middle-aged patients in

  14. Improved method for specifying solar wind speed near the Sun

    Czech Academy of Sciences Publication Activity Database

    Arge, Ch. N.; Odstrčil, Dušan; Pizzo, V. J.; Mayer, L. R.

    Melville : American Institute of Physics, 2003 - (Velli, M.; Bruno, R.; Malara, F.), s. 190-193 [International solar wind conference /10./. Pisa (IT), 17.06.2002-21.06.2002] Institutional research plan: CEZ:AV0Z1003909 Keywords : solar wind * magnetic field Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  15. Few parasites, and no evidence for Wolbachia infections, in a freshwater ostracod inhabiting temporary ponds

    Czech Academy of Sciences Publication Activity Database

    Bruvo, Ružica; Adolfsson, S.; Symonová, R.; Lamatsch, D. K.; Schön, I.; Jokela, J.; Butlin, R. K.; Müller, S.

    2011-01-01

    Roč. 102, č. 1 (2011), s. 208-216. ISSN 0024-4066 Grant ostatní: Marie Curie Research Training Network(XE) MRTN-CT-2004-512492 Institutional research plan: CEZ:AV0Z60930519 Keywords : alphaproteobacteria * Cyprididae * maintenance of sex * microcrustaceans * parthenogenesis * Red Queen * temporary pools Subject RIV: EG - Zoology Impact factor: 2.193, year: 2011

  16. Domain Modeling: NP_000881.3 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_000881.3 chr11 Crystal structure of a Kir3.1-prokaryotic Kir channel chimera p2qksb_ chr11/NP_000881.3.../NP_000881.3_apo_50-370.pdb blast 192Q,193P,194K,196R,210M,211R,212D,213E,228H,229I,23

  17. Domain Modeling: NP_078991.3 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_078991.3 chr5 The solution structure of the second thioredoxin domain of mouse P...rotein disulfide-isomerase A4 p2dj2a_ chr5/NP_078991.3/NP_078991.3_apo_193-317.pdb blast 0 ...

  18. Midway Atoll Site P19 12/5/2002 2-3M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Midway Atoll, site P19 28.193 N, 177.401 W, between 2 and 3 meters along a permanent transect.

  19. O triangulacích bez tupých úhlů

    Czech Academy of Sciences Publication Activity Database

    Brandts, J.; Korotov, S.; Křížek, Michal

    2005-01-01

    Roč. 50, č. 3 (2005), s. 193-208. ISSN 0032-2423 R&D Projects: GA ČR(CZ) GA201/04/1503 Institutional research plan: CEZ:AV0Z10190503 Keywords : acute simplex * orthogonal simplex * Delaunay triangulation Subject RIV: BA - General Mathematics

  20. Crystal chemistry, Mössbauer spectroscopy, and thermodynamic properties of botryogen

    Czech Academy of Sciences Publication Activity Database

    Majzlan, J.; Plášil, Jakub; Dachs, E.; Benisek, A.; Bender Koch, CH.

    2016-01-01

    Roč. 193, č. 2 (2016), 147-159. ISSN 0077-7757 Grant ostatní: EU(XE) CZ.2.16/3.1.00/24510 Institutional support: RVO:68378271 Keywords : botryogen * crystal-structure refinement * H atoms * Mössbauer spectroscopy * thermodynamics * acid-mine drainage Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.378, year: 2014