WorldWideScience

Sample records for astatine 193

  1. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  2. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-09-15

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Discovery of the astatine, radon, francium, and radium isotopes

    Science.gov (United States)

    Fry, C.; Thoennessen, M.

    2013-09-01

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration

    2011-11-30

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  6. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Science.gov (United States)

    Uusitalo, J.; Jakobsson, U.

    2011-11-01

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  7. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy.

    Science.gov (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  9. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others

    2015-10-15

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  10. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Science.gov (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.

    2015-10-01

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  11. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  12. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  13. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  14. Comment: 193 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available Japanese Bush Warbler Cettia diphone Cettia_diphone_L.png 193.png Takeru Nakazato (Database Center for Life...: Takeru Nakazato (Database Center for Life Science) ウグイス Cettia diphone cantans nakazato 2008/12/22 10:09:51 2010/01/14 20:05:22 ...

  15. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  16. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  17. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  18. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  19. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study

    Science.gov (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi

    2018-01-01

    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).

  20. 193

    African Journals Online (AJOL)

    2002-04-01

    Apr 1, 2002 ... to be considered concerning the quality of data in this study is incompleteness of the demographic data. The .... odd ratio varying from 0.5 to 4 in case control studies (28). However, in Africa the role of H.pylori in the aetiology .... Tumours of the alimentary сапа). In: Tumours in a tropical, country; a survey of ...

  1. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  2. 46 CFR 193.50-5 - Classification.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Classification. 193.50-5 Section 193.50-5 Shipping COAST... Details § 193.50-5 Classification. (a) Hand portable fire extinguishers and semiportable fire...) Classification Type Size Soda-acid and water, gals. Foam, gals. Carbon dioxide, lbs. Dry chemical, lbs. A II 21/2...

  3. 49 CFR 193.2911 - Security lighting.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Security lighting. 193.2911 Section 193.2911...: FEDERAL SAFETY STANDARDS Security § 193.2911 Security lighting. Where security warning systems are not...) and each protective enclosure must be illuminated with a minimum in service lighting intensity of not...

  4. 49 CFR 193.2517 - Purging.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Purging. 193.2517 Section 193.2517 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES: FEDERAL SAFETY STANDARDS Operations § 193.251...

  5. 49 CFR 193.2067 - Wind forces.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Wind forces. 193.2067 Section 193.2067...: FEDERAL SAFETY STANDARDS Siting Requirements § 193.2067 Wind forces. (a) LNG facilities must be designed to withstand without loss of structural or functional integrity: (1) The direct effect of wind forces...

  6. 49 CFR 193.2625 - Corrosion protection.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Corrosion protection. 193.2625 Section 193.2625...: FEDERAL SAFETY STANDARDS Maintenance § 193.2625 Corrosion protection. (a) Each operator shall determine which metallic components could, unless corrosion is controlled, have their integrity or reliability...

  7. 49 CFR 193.2167 - Covered systems.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Covered systems. 193.2167 Section 193.2167...: FEDERAL SAFETY STANDARDS Design Impoundment Design and Capacity § 193.2167 Covered systems. A covered impounding system is prohibited except for concrete wall designed tanks where the concrete wall is an outer...

  8. 49 CFR 193.2619 - Control systems.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Control systems. 193.2619 Section 193.2619...: FEDERAL SAFETY STANDARDS Maintenance § 193.2619 Control systems. (a) Each control system must be properly adjusted to operate within design limits. (b) If a control system is out of service for 30 days or more, it...

  9. 49 CFR 193.2609 - Support systems.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Support systems. 193.2609 Section 193.2609 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY...: FEDERAL SAFETY STANDARDS Maintenance § 193.2609 Support systems. Each support system or foundation of each...

  10. 49 CFR 193.2519 - Communication systems.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Communication systems. 193.2519 Section 193.2519...: FEDERAL SAFETY STANDARDS Operations § 193.2519 Communication systems. (a) Each LNG plant must have a primary communication system that provides for verbal communications between all operating personnel at...

  11. 49 CFR 193.2917 - Warning signs.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Warning signs. 193.2917 Section 193.2917...: FEDERAL SAFETY STANDARDS Security § 193.2917 Warning signs. (a) Warning signs must be conspicuously placed along each protective enclosure at intervals so that at least one sign is recognizable at night from a...

  12. 49 CFR 193.2715 - Training: security.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Training: security. 193.2715 Section 193.2715...: FEDERAL SAFETY STANDARDS Personnel Qualifications and Training § 193.2715 Training: security. (a) Personnel responsible for security at an LNG plant must be trained in accordance with a written plan of...

  13. 49 CFR 193.2709 - Security.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Security. 193.2709 Section 193.2709 Transportation...: FEDERAL SAFETY STANDARDS Personnel Qualifications and Training § 193.2709 Security. Personnel having security duties must be qualified to perform their assigned duties by successful completion of the training...

  14. 49 CFR 193.2905 - Protective enclosures.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Protective enclosures. 193.2905 Section 193.2905...: FEDERAL SAFETY STANDARDS Security § 193.2905 Protective enclosures. (a) The following facilities must be surrounded by a protective enclosure: (1) Storage tanks; (2) Impounding systems; (3) Vapor barriers; (4...

  15. 49 CFR 572.193 - Neck assembly.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 7 2010-10-01 2010-10-01 false Neck assembly. 572.193 Section 572.193... Dummy, Small Adult Female § 572.193 Neck assembly. (a) The neck assembly consists of parts shown in drawing 180-2000. For purposes of this test, the neck assembly is mounted within the headform assembly...

  16. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  17. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  18. 193 nm photodissociation of acetylene

    Science.gov (United States)

    Balko, B. A.; Zhang, J.; Lee, Y. T.

    1991-06-01

    The product translational energy distribution P(ET) for acetylene photodissociation at 193 nm was obtained from the time-of-flight spectrum of the H atom fragments. The P(ET) shows resolved structure from the vibrational and electronic excitation of the C2H fragment; comparison of the translational energy release for given excited states of C2H with the known energy levels of these states gives D0(HCC-H) = 131.4 + or - 0.5 kcal/mol. This value is in agreement with that determined previously in this group from analogous studies of the C2H fragment and with the latest experimental and theoretical work. The high resolution of the experiment also reveals the nature of C2H internal excitation. A significant fraction of the H atoms detected at moderate laser power were from the secondary dissociation of C2H. The P(ET) derived for this channel indicates that most of the C2 is produced in excited electronic states.

  19. 193 nm photodissociation of acetylene

    Energy Technology Data Exchange (ETDEWEB)

    Balko, B.A.; Zhang, J.; Lee, Y.T. (Department of Chemistry, University of California at Berkeley and Chemical Sciences Division, Lawrence Berkeley Laboratory Berkeley, California 94720 (USA))

    1991-06-15

    The product translational energy distribution {ital P}({ital E}{sub {ital T}}) for acetylene photodissociation at 193 nm was obtained from the time-of-flight spectrum of the H atom fragments. The {ital P}({ital E}{sub {ital T}}) shows resolved structure from the vibrational and electronic excitation of the C{sub 2}H fragment; comparison of the translational energy release for given excited states of C{sub 2}H with the known energy levels of these states gives {ital D}{sub 0}(HCC--H)=131.4{plus minus}0.5 kcal/mol. This value is in agreement with that determined previously in this group from analogous studies of the C{sub 2}H fragment and with the latest experimental and theoretical work. The high resolution of the experiment also reveals the nature of C{sub 2}H internal excitation. A significant fraction of the H atoms detected at moderate laser power were from the secondary dissociation of C{sub 2}H. The {ital P}({ital E}{sub {ital T}}) derived for this channel indicates that most of the C{sub 2} is produced in excited electronic states.

  20. Dicty_cDB: SLB193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB193 (Link to dictyBase) - - - Contig-U15766-1 SLB193E (Link to Original site) SLB...193F 617 SLB193Z 633 SLB193P 1250 SLB193E 982 Show SLB193 Library SL (Link to library) Clone ID SLB...inal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLB1-D/SLB193Q.Seq.d/ Representative seq. ID SLB...193E (Link to Original site) Representative DNA sequence >SLB193 (SLB193Q) /CSM/SL/SLB1-D/SLB...ences producing significant alignments: (bits) Value SLB193 (SLB193Q) /CSM/SL/SLB1-D/SLB

  1. Dicty_cDB: SLF193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLF193 (Link to dictyBase) - - - Contig-U15976-1 | Contig-U16272-1 SLF...193P (Link to Original site) SLF193F 161 SLF193Z 400 SLF193P 560 - - Show SLF193 Library SL (Link to library) Clone ID SLF...76-1 | Contig-U16272-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLF1-D/SLF...193Q.Seq.d/ Representative seq. ID SLF193P (Link to Original site) Representative DNA sequence >SLF193 (SLF...193Q) /CSM/SL/SLF1-D/SLF193Q.Seq.d/ CGGACGCGTGGGTTTTGTTTTTTTTTTTTTATATATTTAAAAAAAAAAGATAATATTTAT

  2. Dicty_cDB: VSF193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSF193 (Link to dictyBase) - - - Contig-U15128-1 VSF193P (Link to Original site) VSF1...93F 376 VSF193Z 343 VSF193P 719 - - Show VSF193 Library VS (Link to library) Clone ID VSF1... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSF1-D/VSF193Q.Seq.d/ Representative seq. ID VSF1...93P (Link to Original site) Representative DNA sequence >VSF193 (VSF193Q) /CSM/VS/VSF1-D/VSF1... (rps17) gene, complete cds. 311 e-144 4 BG259081 |BG259081.1 602379133F1 NIH_MGC_92 Homo sapiens cDNA clone

  3. 46 CFR 193.50-10 - Location.

    Science.gov (United States)

    2010-10-01

    ... Space Classification (see § 193.50-5) Quantity and location Safety Areas 1 Wheelhouse or fire control room None required. Stairway and elevator enclosures Do. Communicating corridors A-II 1 in each main... spaces, public spaces, offices, lockers, isolated storerooms, and pantries open decks, etc None required...

  4. 27 CFR 41.193 - Corporate documents.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Corporate documents. 41..., AND PROCESSED TOBACCO Tobacco Products Importers § 41.193 Corporate documents. Every corporation... directors' meetings, listing the offices the incumbents of which are authorized to sign documents or...

  5. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  6. 49 CFR 193.2631 - Internal corrosion control.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Internal corrosion control. 193.2631 Section 193... GAS FACILITIES: FEDERAL SAFETY STANDARDS Maintenance § 193.2631 Internal corrosion control. Each component that is subject to internal corrosive attack must be protected from internal corrosion by— (a...

  7. 49 CFR 193.2635 - Monitoring corrosion control.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Monitoring corrosion control. 193.2635 Section 193... GAS FACILITIES: FEDERAL SAFETY STANDARDS Maintenance § 193.2635 Monitoring corrosion control. Corrosion protection provided as required by this subpart must be periodically monitored to give early...

  8. 49 CFR 193.2187 - Nonmetallic membrane liner.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Nonmetallic membrane liner. 193.2187 Section 193... GAS FACILITIES: FEDERAL SAFETY STANDARDS Design Lng Storage Tanks § 193.2187 Nonmetallic membrane liner. A flammable nonmetallic membrane liner may not be used as an inner container in a storage tank...

  9. 33 CFR 110.193 - Tampa Bay, Fla.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Tampa Bay, Fla. 110.193 Section 110.193 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.193 Tampa Bay, Fla. (a) The anchorage grounds—(1) Explosives...

  10. 33 CFR 110.193a - St. Joseph Bay, Fla.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false St. Joseph Bay, Fla. 110.193a Section 110.193a Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.193a St. Joseph Bay, Fla. (a) The anchorage grounds—(1...

  11. 46 CFR 193.50-20 - Semiportable fire extinguishers.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Semiportable fire extinguishers. 193.50-20 Section 193... VESSELS FIRE PROTECTION EQUIPMENT Hand Portable Fire Extinguishers and Semiportable Fire Extinguishing Systems, Arrangements and Details § 193.50-20 Semiportable fire extinguishers. (a) The frame or support of...

  12. 49 CFR 193.2304 - Corrosion control overview.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Corrosion control overview. 193.2304 Section 193... GAS FACILITIES: FEDERAL SAFETY STANDARDS Construction § 193.2304 Corrosion control overview. (a... materials specifications from a corrosion control viewpoint and determines that the materials involved will...

  13. Photodissociation of ethylene at 193 nm

    Science.gov (United States)

    Balko, B. A.; Zhang, J.; Lee, Y. T.

    1992-07-01

    The photodissociation of ethylene at 193 nm was studied by measuring the product translational energy distributions for the H+C2H3 and H2+C2H2 channels. In agreement with previous workers, it was determined that atomic and molecular elimination occur in relatively equal amounts. Using 1,1 D2CCH2 and 1,2 cis HDCCDH, it was shown that both acetylene and vinylidene are formed and that the acetylene/vinylidene ratio is approximately 2/3 in the molecular elimination. This H2 elimination channel has a translational energy distribution peaked at around 20 kcal/mol, indicating that it is a concerted process with a substantial exit barrier. It was found that the H atom elimination channel is best described as a simple bond rupture occurring after internal conversion of the electronically excited molecule to the vibrationally excited ground state ethylene. Some of the primary C2H3 product has sufficient internal energy to spontaneously decompose to H+HC≡CH. At higher laser intensity a large fraction of the C2H3, however, absorbs another photon and fragments to H+H2C=C: (1A1 and 3B2).

  14. Photodissociation of ethylene at 193 nm

    Energy Technology Data Exchange (ETDEWEB)

    Balko, B.A.; Zhang, J.; Lee, Y.T. (Department of Chemistry, University of California at Berkeley and Chemical Sciences Division, Lawrence Berkeley Laboratory, Berkeley, California 94720 (United States))

    1992-07-15

    The photodissociation of ethylene at 193 nm was studied by measuring the product translational energy distributions for the H+C{sub 2}H{sub 3} and H{sub 2}+C{sub 2}H{sub 2} channels. In agreement with previous workers, it was determined that atomic and molecular elimination occur in relatively equal amounts. Using 1,1 D{sub 2}CCH{sub 2} and 1,2 {ital cis} HDCCDH, it was shown that both acetylene and vinylidene are formed and that the acetylene/vinylidene ratio is approximately 2/3 in the molecular elimination. This H{sub 2} elimination channel has a translational energy distribution peaked at around 20 kcal/mol, indicating that it is a concerted process with a substantial exit barrier. It was found that the H atom elimination channel is best described as a simple bond rupture occurring after internal conversion of the electronically excited molecule to the vibrationally excited ground state ethylene. Some of the primary C{sub 2}H{sub 3} product has sufficient internal energy to spontaneously decompose to H+HC{equivalent to}CH. At higher laser intensity a large fraction of the C{sub 2}H{sub 3}, however, absorbs another photon and fragments to H+H{sub 2}C=C: ({sup 1}{ital A}{sub 1} and {sup 3}{ital B}{sub 2}).

  15. 49 CFR 192.193 - Valve installation in plastic pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Valve installation in plastic pipe. 192.193... Components § 192.193 Valve installation in plastic pipe. Each valve installed in plastic pipe must be designed so as to protect the plastic material against excessive torsional or shearing loads when the valve...

  16. 49 CFR 193.2615 - Isolating and purging.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Isolating and purging. 193.2615 Section 193.2615 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES: FEDERAL SAFETY STANDARDS...

  17. 49 CFR 193.2057 - Thermal radiation protection.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Thermal radiation protection. 193.2057 Section 193.2057 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY LIQUEFIED NATURAL GAS FACILITIES: FEDERAL SAFETY STANDARDS...

  18. 49 CFR 193.2627 - Atmospheric corrosion control.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Atmospheric corrosion control. 193.2627 Section... LIQUEFIED NATURAL GAS FACILITIES: FEDERAL SAFETY STANDARDS Maintenance § 193.2627 Atmospheric corrosion... atmospheric corrosion by— (a) Material that has been designed and selected to resist the corrosive atmosphere...

  19. 49 CFR 193.2013 - Incorporation by reference.

    Science.gov (United States)

    2010-10-01

    ... (ASCE), Parallel Centre, 1801 Alexander Bell Drive, Reston, VA 20191-4400. C. ASME International (ASME..., includes supplement No. 1 and Errata) § 193.2067(b)(1). D. ASME International (ASME): (1) 2007 ASME Boiler..., July 1, 2007) § 193.2321(a). (2) 2007 ASME Boiler & Pressure Vessel Code, Section VIII, Division 2...

  20. 14 CFR 61.193 - Flight instructor privileges.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Flight instructor privileges. 61.193... (CONTINUED) AIRMEN CERTIFICATION: PILOTS, FLIGHT INSTRUCTORS, AND GROUND INSTRUCTORS Flight Instructors Other than Flight Instructors With a Sport Pilot Rating § 61.193 Flight instructor privileges. A person who...

  1. 27 CFR 479.193 - Arms Export Control Act.

    Science.gov (United States)

    2010-04-01

    ..., AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES, AND CERTAIN OTHER FIREARMS Other Laws Applicable § 479.193 Arms Export Control Act. For provisions relating to...

  2. Mir193b-365 is essential for brown fat differentiation.

    Science.gov (United States)

    Sun, Lei; Xie, Huangming; Mori, Marcelo A; Alexander, Ryan; Yuan, Bingbing; Hattangadi, Shilpa M; Liu, Qingqing; Kahn, C Ronald; Lodish, Harvey F

    2011-07-10

    Mammals have two principal types of fat. White adipose tissue primarily serves to store extra energy as triglycerides, whereas brown adipose tissue is specialized to burn lipids for heat generation and energy expenditure as a defence against cold and obesity. Recent studies have demonstrated that brown adipocytes arise in vivo from a Myf5-positive, myoblastic progenitor by the action of Prdm16 (PR domain containing 16). Here, we identified a brown-fat-enriched miRNA cluster, MiR-193b-365, as a key regulator of brown fat development. Blocking miR-193b and/or miR-365 in primary brown preadipocytes markedly impaired brown adipocyte adipogenesis by enhancing Runx1t1 (runt-related transcription factor 1; translocated to, 1) expression, whereas myogenic markers were significantly induced. Forced expression of Mir193b and/or Mir365 in C2C12 myoblasts blocked the entire programme of myogenesis, and, in adipogenic conditions, miR-193b induced myoblasts to differentiate into brown adipocytes. Mir193b-365 was upregulated by Prdm16 partially through Pparα. Our results demonstrate that Mir193b-365 serves as an essential regulator for brown fat differentiation, in part by repressing myogenesis.

  3. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.

    2017-04-01

    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  4. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination.

    Science.gov (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick

    2007-01-01

    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  5. 7 CFR 3015.193 - Other non-profit organizations.

    Science.gov (United States)

    2010-01-01

    ... OFFICER, DEPARTMENT OF AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Cost Principles § 3015.193 Other... Circulars published in the Federal Register by OMB, shall be used in determining the allowable costs of... contracts, and other contracts in which costs are used in pricing, administration, or settlement. It does...

  6. The photochemistry of ozone at 193 and 222 nm

    Science.gov (United States)

    Turnipseed, Andrew A.; Vaghjiani, Ghanshyam L.; Gierczak, Tomasz; Thompson, John E.; Ravishankara, A. R.

    1991-09-01

    Measurements at 193 and 222nm are reported for the quantum yields for the formation of O(1D) and O(3P) from the photolysis of ozone. The quantum yield for O(3P) was observed to be 0.13 + or - 0.02 at 222 nm, and the primary quantum yield for O(1D) was found to be 0.87 + or - 0.04. The present measurements are consistent with other studies of O3 photolysis within the Hartley band which indicate that a significant portion (5-12 percent) of the products are formed in the ground state. At 193 nm the quantum yield for the production of excited state O(1D) atoms is 0.46 + or - 0.29, which is significantly less than what is observed during photolysis within the lower energy Hartley band. The quantum yield for O(3P) atoms at 193 nm was found to be 0.57 + or - 0.14. It was also observed that the quantum yield for O atoms is greater than unity at 193 nm, indicating the presence of a channel which produces three O(3P) atoms.

  7. Phenotype abnormality: 193 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 193 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u699i decreased number... of root in organ named whole plant ... whole plant ... present in fewer numbers in organism ... root ...

  8. 37 CFR 2.193 - Trademark correspondence and signature requirements.

    Science.gov (United States)

    2010-07-01

    ... TRADEMARK OFFICE, DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES General Information and Correspondence in Trademark Cases § 2.193 Trademark correspondence and signature requirements. (a) Signature... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Trademark correspondence and...

  9. 27 CFR 24.193 - Conversion into still wine.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Conversion into still wine..., DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Effervescent Wine § 24.193 Conversion into still wine. Sparkling wine or artificially carbonated wine may be dumped for use as still wine. The dumping process will...

  10. Cycloolefin/maleic anhydride copolymers for 193-nm resist compositions

    Science.gov (United States)

    Rahman, M. D.; Dammel, Ralph R.; Cook, Michelle M.; Ficner, Stanley A.; Padmanaban, Munirathna; Oberlander, Joseph E.; Durham, Dana L.; Klauck-Jacobs, Axel

    1999-06-01

    Several novel norbornene carboxylate monomers consisting of isobornyl and alkyl ether chains on the ester groups were synthesized and polymerized with maleic anhydride (MA), t- butylnorbornene carboxylate (BNC), hydroxyethylnorbornene carboxylate (HNC) and norbornene carboxylic acid (NC). These polymers were compared with BNC/HNC/NC/MA tetra-polymers with respect to glass transition temperature (Tg) as well as photoresist performance using a 193 nm exposure tool. It was observed that introduction of these groups decreases the Tg but not to the extent where the polymers can be used as an annealing type resist. The synthesis of these polymers, their characterization, and their lithographic evaluation as 193 resists will be discussed in this paper. Further optimization in terms of final polymer composition as well as resist formulation is on-going in order to fully exploit these monomers for photoresist application.

  11. 1 CFR 19.3 - Routing and certification of originals and copies.

    Science.gov (United States)

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Routing and certification of originals and copies. 19.3 Section 19.3 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER PREPARATION, TRANSMITTAL, AND PROCESSING OF DOCUMENTS EXECUTIVE ORDERS AND PRESIDENTIAL PROCLAMATIONS § 19.3 Routing and...

  12. 31 CFR 103.193 - Special measures against Banco Delta Asia.

    Science.gov (United States)

    2010-07-01

    ... Asia. 103.193 Section 103.193 Money and Finance: Treasury Regulations Relating to Money and Finance... Law Enforcement Access to Foreign Bank Records § 103.193 Special measures against Banco Delta Asia. (a) Definitions. For purposes of this section: (1) Banco Delta Asia means all branches, offices, and subsidiaries...

  13. Development program for 1.93-micron lasers

    Science.gov (United States)

    Longeway, P.; Zamerowski, T.; Martinelli, R.; Stolzenberger, R.; Digiuseppe, N.

    1988-01-01

    For the first time lasers operating at 1.93 microns were demonstrated. The lasers were fabricated by Vapor Phase Epitaxial (VPE) growth techniques currently used for the fabrication of high power lasers at 1.3 microns. The structure of these laser diodes consisted of compositionally graded, sulfur-doped InAsP, grown on an InP substrate; a constant-composition n+InAs(0.27)P(0.73) layer, which is the first cladding layer; an In(0.66)Ga(0.34)As layer, which is the active region, and a second InAs(0.27)P(0.73) layer. The devices were oxide-stripe DH lasers (gain-guided only). The best devices had 80 K lasing thresholds in the range of from 80 to 150 mA, and T sub o (below 220 K) in the range of 60 to 90 K. The highest observed temperature of oscillation was 15.5 C. The highest observed power output at 80 K was in the range of 3 to 5 mW. The calculated delta I/delta T was 4.4 A/K. As a part of the materials development, PIN homojunction detectors having the band edge near 1.93 were also fabricated. The best devices (100 micron diameter, mesa structure) exhibited room temperature dark currents in the range of from 20 to 50 nA and had QE at 1.93 microns in the range of 35 to 40 percent. In addition to the device results, the InGaAs-InAsP materials system was extensively investigated and low defect density layers can now be grown allowing for significant device performance improvement.

  14. Negative-tone cycloolefin photoresist for 193-nm lithography

    Science.gov (United States)

    Fu, ShihChi; Hsieh, Kuo-Huang; Wang, Lon A.

    2001-08-01

    The chemistry of acid-catalyzed dehydration reaction and followed by crosslinking of the tert-alcohol group in the cycloolefin photoresists was used to tailor the performance of the photoresists for 193nm lithography. A radiation- sensitive photoacid generator (PAG) in this chemically amplified photoresist (CAMP) can change the polarity of the exposed area of the resist and exhibit a negative-tone behavior. The cycloolefin resists are synthesized by the free radical copolymerization of alicyclic monomer and maleic anhydride, and/or by the cationic polymerization of alicyclic monomer via Pd catalyst followed by the attaching of tert-alcohol group in to the resist. The side reaction of cycloolefin copolymer was observed at the temperature below the post exposure baking (PEB) temperature, but this problem can be eliminated by the introduction of isobornyl methacrylate into the polymer. The lithographic performance of the resists was investigated by using isopropyl alcohol as a developer under various processing conditions. The results demonstrate that these resists are the promising candidates for being used in 193nm lithography.

  15. Vitreoretinal surgery with the 193-nm excimer laser

    Science.gov (United States)

    Palanker, Daniel V.; Hemo, Itzhak; Turovets, Igor; Zauberman, Hanan; Lewis, Aaron

    1994-06-01

    The 193-nm excimer laser is known for its ability to precisely ablate soft biological tissues in the air environment with sub- micron depth control and sub-micron damage zones in the surrounding. The lack of a convenient delivery system and strong absorption of this radiation by biological liquids prevented, until recently, microsurgical applications of this laser. We have constructed special tips that are capable of delivering enough energy for effective removal of soft tissues in a strongly absorbing liquid environment. These tips attach to an articulated arm-based delivery system. This instrument was applied to vitreoretinal membranes removal. The accepted technique for these membranes removal is mechanical peeling and cutting which is associated with strong traction of the retina and this occasionally results in retinal damage. It was demonstrated in this study that the 193-nm excimer laser is capable of safely and precisely cutting and ablating these membranes which enable their removal without exerting any tractional forces on the retina. The effective cutting regime of retina and vitreoretinal membranes occurred at energy fluence of about 250- to 350-mJ/cm2/pulse with a corresponding cutting depth of 50 to 150 micrometers /pulse. The results obtained in this study suggest that this technology could be applicable to a wide variety of intraocular procedures.

  16. New single-layer positive photoresists for 193-nm photolithography

    Science.gov (United States)

    Okoroanyanwu, Uzodinma; Shimokawa, Tsutomu; Byers, Jeff D.; Medeiros, David R.; Willson, C. Grant; Niu, Qingshang J.; Frechet, Jean M. J.; Allen, Robert D.

    1997-07-01

    New series of chemically amplified, single layer, positive tone photoresists for 193 nm lithography have been developed. These resists were formulated from a series of cycloaliphatic co- and terpolymers of 2-methyl propyl bicyclo(2.2.1)hept-2- ene-5-carboxylate (carbo-tert-butoxynorbornene), bicyclo(2.2.1)hept-2-ene carboxylic acid (norbornene carboxylic acid), 8-methyl-8-carboxy tetracyclo(4,4,0.12,5,17,10)dodec-3-ene (methyltetracyclododecene carboxylic acid), norbornenemethanol, and maleic anhydride, which were synthesized by free radical, vinyl addition and ring opening metathesis polymerization techniques. The polymers derived from ring opening metathesis polymerization have bee successfully hydrogenated to provide yet another member of this group of materials. The cycloaliphatic polymer backbones provide etch resistance, mechanical properties and stability to radiation. The lithographic function is provided by carefully tailored pendant groups, which include an acid functionality that is masked by protecting groups that undergo acid catalyzed thermolysis as well as polar groups that influence the adhesion, wetability and dissolution properties of the polymer. The polymers are soluble in common organic solvents and have glass transition temperatures ranging from less than 60 degrees Celsius to higher than 250 degrees Celsius depending on their specific structure and mode of polymerization. They are at least as transparent at 193 nm as the corresponding acrylics. Their dry etch resistance varies with the formulation, but the base polymers etch more slowly than novolac under conditions typically used to pattern polysilicon. Upon exposure and baking, the resists have demonstrated high sensitivities (9-25 mJ/cm2), and 0.16 micrometer features have bean resolved.

  17. Study of {sup 193}Os beta{sup -} decay; Estudo do decaimento beta{sup -} do {sup 193}Os

    Energy Technology Data Exchange (ETDEWEB)

    Zahn, Guilherme Soares

    2006-07-01

    In this work, the excited levels of {sup 193}Ir populated by the beta{sup -} decay of {sup 193}Os (T{sub 1/2} {approx} 30h) were investigated. For that purpose, {approx} 5 mg samples of 99%-enriched {sup 192}Os were irradiated under a thermal neutron flux of {approx} 10{sup 12} s{sup -1} and then analysed both using single gamma spectroscopy and a 4-detector multi parametric acquisition facility, which provided data for both a gamma gamma coincidence analysis and a directional angular correlation gamma gamma ({theta} ) study. From these data, 28 transitions were added to this decay scheme, 11 of which were previously known from nuclear reactions and 17 observed for the first time. Eight excited levels were also added to the decay scheme, 3 of which were known from nuclear reaction studies - the remaining 5 are suggested for the first time. Moreover, it was possible to confirm suspicions found in reference that the levels at 848.93 keV and 849.093 keV are indeed the same; it was also possible to confirm the existence of an excited level at 806.9 keV, which had been inferred, but not experimentally confirmed in beta decay studies to date. The angular correlation analysis allowed for the definition of the spin of the excited level at 874 keV as 5/2{sup +;} moreover, the results showed a 79% probability that the spin of the 1078 keV level is 5/2/'-, and also restricted the spin possibilities for the new excited level at 960 keV to two values (1/2 or 3/2). It was also possible to measure the multipolarity mixing ratio ({delta}{sub Ln+1}/L{sub n}) for 43 transitions - 19 of them for the first time and most of the others with a better precision than previously known. Finally, an attempt was made to understand the low-lying levels structure for this nucleus using a theoretical model, which reproduced the ground state and the two lowest-lying excited levels in {sup 193}Ir. (author)

  18. Photodissociation dynamics of methoxybenzoic acid at 193 nm

    Science.gov (United States)

    Ho, Yu-Chieh; Dyakov, Yuri A.; Hsu, Wen-Hsin; Ni, Chi-Kung; Sun, Yi-Lun; Hu, Wei-Ping

    2012-11-01

    The theoretical prediction and experimental confirmation of the 1πσ* repulsive excited state along O-H bond of phenol have large impact on the interpretation of phenol and tyrosine photochemistry. In this work, we investigated the photodissociation dynamics of 2-, 3-, and 4-methoxybenzoic acid (MOBA) in a molecular beam at 193 nm using multimass ion imaging techniques. In addition, the ground state and the excited state potential energy surfaces of MOBA were investigated using ab initio calculations, and branching ratios were predicted by Rice-Ramsperger-Kassel-Marcus theory. The results show that (1) the excited state potential of 1πσ* along O-CH3 bond remains similar to that of phenol and anisole, (2) CH3 elimination is the major channel for three MOBA isomers, and (3) photofragment translational energy distributions show bimodal distributions, representing the dissociation on the ground state and repulsive excited state, respectively. Comparison to the study of hydroxbenzoic acid [Y. L. Yang, Y. A. Dyakov, Y. T. Lee, C. K. Ni, Y. L. Sun, and W. P. Hu, J. Chem. Phys. 134, 034314 (2011), 10.1063/1.3526059] shows that only the intramolecular hydrogen bonding has significant effects on the excited state dynamics of phenol chromophores.

  19. 47 CFR 61.193 - Vacation of suspension order; supplements announcing same; etc.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Vacation of suspension order; supplements announcing same; etc. 61.193 Section 61.193 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED...; supplements announcing same; etc. If the Commission vacates a suspension order, the affected carrier must...

  20. 9 CFR 381.193 - Poultry carcasses, etc., not intended for human food.

    Science.gov (United States)

    2010-01-01

    ... Food,” or “(name of species) Food” (e.g., “Dog Food” or “Cat Food”). To be considered conspicuous, the... for human food. 381.193 Section 381.193 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE... food. (a) Except as provided in paragraph (b) of this section, poultry carcasses, and parts and...

  1. 14 CFR 193.5 - How may I submit safety or security information and have it protected from disclosure?

    Science.gov (United States)

    2010-01-01

    ... SUBMITTED INFORMATION § 193.5 How may I submit safety or security information and have it protected from... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false How may I submit safety or security information and have it protected from disclosure? 193.5 Section 193.5 Aeronautics and Space FEDERAL AVIATION...

  2. 41 CFR 102-193.25 - What type of records management business process improvements should my agency strive to achieve?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What type of records management business process improvements should my agency strive to achieve? 102-193.25 Section 102-193.25...-193.25 What type of records management business process improvements should my agency strive to...

  3. 36 CFR 223.193 - Procedures for reporting acquisition and disposition of unprocessed Federal timber.

    Science.gov (United States)

    2010-07-01

    ... Forest Resources Conservation and Shortage Relief Act of 1990 Program § 223.193 Procedures for reporting...; (iii) An agreement to maintain and/or replace all brands and paint identifying the Federal origin of...

  4. Excitation energy and spins of the Yrast superdeformed states in {sup 193}Tl; Energie d`excitation et spins des etats superdeformes Yrast de {sup 193}Tl

    Energy Technology Data Exchange (ETDEWEB)

    Bouneau, S.; Duprat, J.; Azaiez, F. [Experimental Research Division, Inst. de Physique Nucleaire, Paris-11 Univ., 91 - Orsay (France)] [and others

    1999-11-01

    Discrete {gamma}-rays of high energy connecting states of the two Yrast superdeformed bands in {sup 193}Tl to the normal deformed states have been identified. Thus, for the first time, in an odd SD nucleus, it has been possible to propose an excitation energy and spins of the two lowest bands. (authors) 3 refs., 2 figs.

  5. Changes in gene expression by 193- and 248-nm excimer laser radiation in cultured human fibroblasts.

    Science.gov (United States)

    Rimoldi, D; Flessate, D M; Samid, D

    1992-09-01

    Tissue ablation by ultraviolet excimer lasers results in exposure of viable cells to subablative doses of radiation. To understand the potential biological consequences better, we have studied changes in gene expression in cultured human skin fibroblasts exposed to either 193- or 248-nm laser light. Northern blot analyses revealed that both treatments up-regulate a common set of genes, including interstitial collagenase, tissue inhibitor of metalloprotease, metallothionein, and the proto-oncogene c-fos. Dose-response and kinetic studies of collagenase induction by 193-nm radiation showed a maximal effect with 60 J/m2 and at approximately 24 h. The induction was still persistent 96 h later. In addition to the commonly affected genes, known to be activated also by conventional UV light (254 nm) and tumor-promoting phorbol esters, other genes were found to be selectively induced by the 193-nm radiation. The heat-shock hsp70 mRNA, undetectable in controls and in cultures irradiated at 248 nm, was transiently induced 8 h after exposure to 193-nm radiation. Furthermore, a selective up-regulation of collagen type I expression was observed. The results indicate that the 193- and 248-nm radiations by excimer lasers elicit specific and different cellular responses, in addition to an overlapping pathway of gene activation common also to UV radiation by germicidal lamps. The laser-induced genes could serve as molecular markers in evaluating cell injury in situ.

  6. Design, synthesis, and characterization of fluorine-free PAGs for 193-nm lithography

    Science.gov (United States)

    Liu, Sen; Glodde, Martin; Varanasi, Pushkara R.

    2010-04-01

    Photoacid generators (PAGs) are a key component in chemically amplified resists used in photolithography. Perfluorooctanesulfonates (PFOS) and other perfluoroalkylsulfonates (PFAS) have been well adopted as PAGs in 193 nm photoresist. Recently, concerns have been raised about their environmental impact due to their chemical persistency, bioaccumulation and toxicity. It is a general interest to find environmentally benign PAGs that are free of fluorine atoms. Here we describe the design, synthesis and characterization of a series of novel fluorine-free onium salts as PAGs for 193 nm photoresists. These PAGs demonstrated desirable physical and lithography properties when compared with PFAS-based PAGs for both dry and immersion exposures.

  7. 14 CFR 121.193 - Airplanes: Turbine engine powered: En route limitations: Two engines inoperative.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplanes: Turbine engine powered: En route... Performance Operating Limitations § 121.193 Airplanes: Turbine engine powered: En route limitations: Two...). No person may operate a turbine engine powered airplane along an intended route unless he complies...

  8. 46 CFR 193.15-90 - Installations contracted for prior to March 1, 1968.

    Science.gov (United States)

    2010-10-01

    ... shall be protected by a system discharging principally below the floorplates. Perforated pipe may be used in lieu of discharge nozzles for such systems. The number of pounds of carbon dioxide shall be... as noted in Table 193.15-90(a)(6). This table is based on cylinders having discharge outlets and...

  9. Open reading frame 193R of Chilo iridescent virus encodes a functional inhibitor of apoptosis (IAP)

    NARCIS (Netherlands)

    Ince, I.A.; Westenberg, M.; Vlak, J.M.; Demirbag, Z.; Nalcacioglu, R.; Oers, van M.M.

    2008-01-01

    Programmed cell death or apoptosis is a major defense mechanism in insects in response to viral infections. The genome of Chilo iridescent virus (CIV) has three ORFs with homology to baculovirus inhibitor of apoptosis (iap) genes. The proteins encoded by the 157L, 193R, and 332L ORFs contain 152,

  10. The topoisomerase II catalytic inhibitor ICRF-193 preferentially targets telomeres that are capped by TRF2.

    Science.gov (United States)

    Chen, Lianxiang; Zhu, Xiaowei; Zou, Yaru; Xing, Jun; Gilson, Eric; Lu, Yiming; Ye, Jing

    2015-03-01

    The increased level of chromosome instability in cancer cells is not only a driving force for oncogenesis but also can be the Achille's heel of the disease since many chemotherapies kill cells by inducing a nontolerable rate of DNA damage. A wealth of published evidence showed that telomere stability can be more affected than the bulk of the genome by several conventional antineoplastic drugs. In the present study, HT1080 cell lines compromised for either telomere repeats binding factor 2 (TRF2) or POT1 were treated with ICRF-193 (3 μM, 24 h) or bleomycin (1 μM, 24 h). DNA damage was assayed by combining telomeric DNA staining of a (CCCTAA)n PNA probe with immunofluorescence of 53BP1 to score the rate of telomere colocalization with 53BP1 foci. We found that ICRF-193, but not bleomycin, leads to DNA damage preferentially at telomeres, which can be rescued by TRF2 inhibition. POT1 inhibition exacerbates telomere dysfunction induced by ICRF-193. Thus, ICRF-193 induces damage at telomeres properly capped by TRF2 but not by POT1. These findings are expected to broaden our view on the mechanism by which conventional therapeutic molecules act to eliminate cancer cells and how to use TRF2 and POT1 levels as surrogate markers for anti-topoisomerase II sensitivity. Copyright © 2015 the American Physiological Society.

  11. 46 CFR 193.05-15 - Hand portable fire extinguishers and semiportable fire extinguishing systems.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Hand portable fire extinguishers and semiportable fire... Equipment, Where Required § 193.05-15 Hand portable fire extinguishers and semiportable fire extinguishing systems. (a) Approved hand portable fire extinguishers and semiportable fire extinguishing systems shall...

  12. O(P-3(J)) alignment from the photodissociation of SO2 at 193 nm

    NARCIS (Netherlands)

    Brouard, M.; Cireasa, D.R.; Clark, A.P.; Preston, T.J.; Vallance, C.; Groenenboom, G.C.; Vasyutinskii, O.S.

    2004-01-01

    The 193-nm photodissociation Of SO2 has been studied using the resonantly enhanced multiphoton ionization of ground-state O(P-3(J)), coupled with velocity-map ion imaging. The dependence of the ion images on the linear polarization of pump and probe radiation has been used to determine the

  13. 40 CFR 761.193 - Maintenance of monitoring records by persons who import, manufacture, process, distribute in...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Maintenance of monitoring records by persons who import, manufacture, process, distribute in commerce, or use chemicals containing inadvertently generated PCBs. 761.193 Section 761.193 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...

  14. 25 CFR 900.193 - Does FTCA coverage extend to individuals who provide health care services under a personal...

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Does FTCA coverage extend to individuals who provide health care services under a personal services contract providing services in a facility that is owned, operated, or constructed under the jurisdiction of the IHS? 900.193 Section 900.193 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR, AND...

  15. 41 CFR 102-193.15 - What are the records management responsibilities of the Administrator of General Services (the...

    Science.gov (United States)

    2010-07-01

    ... management responsibilities of the Administrator of General Services (the Administrator), the Archivist of the United States (the Archivist), and the Heads of Federal agencies? 102-193.15 Section 102-193.15... Administrator), the Archivist of the United States (the Archivist), and the Heads of Federal agencies? (a) The...

  16. Aging effect of AlF3 coatings for 193 nm lithography

    Science.gov (United States)

    Zhao, Jia; Wang, Lin; Zhang, Weili; Yi, Kui; Shao, Jianda

    2018-02-01

    As important part of components for 193 nm lithography, AlF3 coatings deposited by resistive heating method acquire advantages like lower optical loss and higher laser damage threshold, but they also possess some disadvantages like worse stability, which is what aging effect focuses on. AlF3 single-layer coatings were deposited; optical property, surface morphology and roughness, and composition were characterized in different periods. Owing to aging effect, refractive index and extinction coefficient increased; larger and larger roughness caused more and more scattering loss, which was in the same order with absorption at 193.4 nm and part of optical loss; from composition analysis, proportional substitution of AlF3 by alumina may account for changes in refractive index as well as absorption.

  17. 193nm resist deprotection study from outgassing measurements by TD-GCMS/FID

    Science.gov (United States)

    Tiron, Raluca; Derrough, Samir; Fontaine, Hervé; Cetre, Sylviane; Perret, Damien; Thackeray, James W.; Paniez, Patrick

    2010-05-01

    A methodology was developed in order to characterize the deprotection mechanisms implied in 193nm chemically amplified (CA) resists. This method is based on resist outgassing measurements as a function of exposure dose and bake temperature using Thermal Desorption-Gas Chromatography - Mass Spectrometry / Flame Ionization Detector (TDGCMS/ FID) technique. This approach allows both quantitative and qualitative studies of the outgassing behaviour and was validated from a 193nm model resist representative of CA formulations. In so doing, the identification of outgassed by-products respectively coming from the PAG, from the polymer as well as from the solvent is made possible. In parallel, quantitative results as a function of exposure dose and temperature allowed us to monitor the deprotection process and the solvent evaporation. The quantitative results obtained by this technique were in good agreement with Thermo-Gravimetric Analysis (TGA) results. Such a methodology can be used not only to characterise 193nm resist outgassing during exposure, but also be extended to monitor resist behaviour during implant, thermal treatment, e-beam exposure.

  18. Evaluating resist degradation during reactive ion oxide etching using 193 nm model resist formulations

    Science.gov (United States)

    May, M. J.; Mortini, B.; Sourd, C.; Perret, D.; Chung, D. W.; Barclay, G.; Brochon, C.; Hadziioannou, G.

    2006-03-01

    The weaker etch resistance of 193 nm resists1 is raising questions concerning their usability for the coming nodes as a single layer resist. We have found that 193 nm positive tone resists, that have been designed2 incorporating etch resistant groups like adamantyl or isobornyl 3-7, exhibit chemical modifications concerning these grafted functions while undergoing an oxide etch step. Previously performed experiments have pointed out that the photoacid generator (PAG) that is still contained in the unexposed regions of the sacrificial layer might be a reason for the modifications in the chemical buildup of this resists. Therefore, this work has focused on evaluating the impact of reactive ion oxide etching 8-10 on 193nm materials, for positive and negative tone chemically amplified resists. We used Thermo Gravimetric Analysis (TGA), Fourier Transformed Infra Red Spectroscopy (FTIR) and Atomic Force Microscopy (AFM) in order to check model formulations based on PHS, methacrylate or cyclic olefin polymers with various protecting groups having different activation energies and formulated with or without PAG and in order to understand the impact of the photoactive compound in the resist degradation behavior during plasma etch.

  19. Comparing 193 nm photoresist roughening in an inductively coupled plasma system and vacuum beam system

    Science.gov (United States)

    Titus, M. J.; Nest, D. G.; Chung, T.-Y.; Graves, D. B.

    2009-12-01

    We present a comparison of blanket 193 nm photoresist (PR) roughening and chemical modifications of samples processed in a well-characterized argon (Ar) inductively coupled plasma (ICP) system and an ultra-high vacuum beam system. In the ICP system, PR samples are irradiated with Ar vacuum ultraviolet (VUV) and Ar ions, while in the vacuum beam system, samples are irradiated with either a Xe-line VUV source or Ar-lamp VUV source with Ar ions. Sample temperature, photon flux, ion flux and ion energy are controlled and measured. The resulting chemical modifications to bulk 193 nm PR and surface roughness are analysed with Fourier transform infrared (FTIR) spectroscopy and atomic force microscopy. We demonstrate that under VUV-only conditions in the vacuum beam and ICP (with no substrate bias applied) systems 193 nm PR does not roughen. However, roughness increases with simultaneous high energy (>70 eV) ion bombardment and VUV irradiation and is a function of VUV fluence, substrate temperature and photon-to-ion flux ratio. PR processed in the ICP system experiences increased etching, probably due to release of H- and O-containing gaseous products and subsequent chemical etching, in contrast to samples in the vacuum beam system where etch-products are rapidly pumped away. The surface roughness structure and behaviour, however, remain similar and this is attributed to the synergy between VUV-photon and positive ions.

  20. Photodissociation dynamics of 2-nitropropane and 2-methyl-2-nitropropane at 248 and 193 nm.

    Science.gov (United States)

    Sengupta, Sumana; Indulkar, Yogesh; Kumar, Awadhesh; Dhanya, Suresh; Naik, Prakash Dattatray; Bajaj, Parma Nand

    2008-12-11

    Dynamics of formation of electronically excited NO2 and formation of OH fragment, during photo dissociation of 2-nitropropane (NP) and 2-methyl-2-nitropropane (MNP), were investigated at 193 and 248 nm. The radiative lifetime of the electronically excited NO2 fragment, observed at 193 nm, was measured to be 1.2 ( 0.1 micros and the rate coefficient of quenching of its emission by MNP was measured as (2.7 ( 0.1) x 10(-10) molecule(-1) cm3 s(-1). Formation of the ground electronic state of OH was confirmed in both molecules. State selective laser induced fluorescence technique was used to detect the nascent OH (X 2Pi, v'', J'') fragments in different ro-vibrational states, and to obtain information on energy partitioning. Though MNP and NP differ in the types of the available H atoms, the dynamics of OH formation is found to be the same in both. The relative population in different rotational states does not follow Boltzmann equilibrium distribution in both the molecules at 193 and 248 nm. The translational energies of the OH fragments, calculated from the Doppler width, are 21.2 ( 7.2 and 25.0 ( 2.5 kcal mol-1 for NP at 248 and 193 nm, respectively. The translational energies of the OH fragments, in the case of MNP, are found to be lower, 17.5 ( 4.1 and 22.0 ( 3.2 kcal mol-1,respectively, at 248 nm 193 nm. These results are compared with the earlier reports on photodissociation of nitromethane (NM), nitroethane (NE), and other nitroalkanes. All possible dissociation pathways of these molecules--NM, NE, NP, and MNPs leading to the formation of the OH fragment were investigated computationally, with geometry optimization at the B3LYP/6-311+G(d,p) level and energy calculation at the MP4(SDQ)/6-311+G (d,p) level. The results suggest that in NM, OH is formed after isomerization to CH2N(OH)O, whereas in all other cases OH is formed from HONO, a primary product of molecular elimination of nitroalkanes, formed with sufficient internal energy.

  1. miR-193b Modulates Resistance to Doxorubicin in Human Breast Cancer Cells by Downregulating MCL-1

    Directory of Open Access Journals (Sweden)

    Jingpei Long

    2015-01-01

    Full Text Available MicroRNAs (miRNAs family, which is involved in cancer development, proliferation, apoptosis, and drug resistance, is a group of noncoding RNAs that modulate the expression of oncogenes and antioncogenes. Doxorubicin is an active cytotoxic agent for breast cancer treatment, but the acquisition of doxorubicin resistance is a common and critical limitation to cancer therapy. The aim of this study was to investigate whether miR-193b mediated the resistance of breast cancer cells to doxorubicin by targeting myeloid cell leukemia-1 (MCL-1. In this study, we found that miR-193b levels were significantly lower in doxorubicin-resistant MCF-7 (MCF-7/DOXR cells than in the parental MCF-7 cells. We observed that exogenous miR-193b significantly suppressed the ability of MCF-7/DOXR cells to resist doxorubicin. It demonstrated that miR-193b directly targeted MCL-1 3′-UTR (3′-Untranslated Regions. Further studies indicated that miR-193b sensitized MCF-7/DOXR cells to doxorubicin through a mechanism involving the downregulation of MCL-1. Together, our findings provide evidence that the modulation of miR-193b may represent a novel therapeutic target for the treatment of breast cancer.

  2. MiR-193b-365, a brown fat enriched microRNA cluster, is essential for brown fat differentiation

    Science.gov (United States)

    Sun, Lei; Xie, Huangming; Mori, Marcelo A; Alexander, Ryan; Yuan, Bingbing; Hattangadi, Shilpa M.; Liu, Qingqing; Kahn, C. Ronald; Lodish, Harvey F.

    2011-01-01

    Mammals have two principal types of fat. White adipose tissue (WAT) primarily serves to store extra energy as triglycerides, while brown adipose tissue (BAT) is specialized to burn lipids for heat generation and energy expenditure as a defense against cold and obesity 1, 2. Recent studies demonstrate that brown adipocytes arise in vivo from a Myf5-positive, myoblastic progenitor by the action of Prdm16 (PR domain containing 16). Here, we identified a brown fat-enriched miRNA cluster, miR-193b-365, as a key regulator of brown fat development. Blocking miR-193b and/or miR-365 in primary brown preadipocytes dramatically impaired brown adipocyte adipogenesis by enhancing Runx1t1 (runt-related transcription factor 1; translocated to, 1) expression whereas myogenic markers were significantly induced. Forced expression of miR-193b and/or miR-365 in C2C12 myoblasts blocked the entire program of myogenesis, and, in adipogenic condition, miR-193b induced myoblasts to differentiate into brown adipocytes. MiR-193b-365 was upregulated by Prdm16 partially through Pparα. Our results demonstrate that miR-193b-365 serves as an essential regulator for brown fat differentiation, in part by repressing myogenesis. PMID:21743466

  3. Research of cornea section's shape ablated by 193-nm ArF laser spots

    Science.gov (United States)

    Zhu, Zhiqiang; Yu, Yinshan; Deng, Guoqing

    2005-11-01

    The ablation theory of cornea and biology effect by 193-nm ArF excimer laser are introduced. The ablation tracks model is put forward to make laser spots scan around cornea by many steps and many areas to change cornea curvature. The corneal average ablation curve is calculated by software so as to explain the feasibility of the ablation tracks model. By analyzing the actual ablation shapes of many arbitrary cornea sections, the optimal ablation method for deciding the random position of every laser spot in every ablation track is obtained. Experiments combining the ablation model with the device testify the energy stability of laser spots and the accuracy of rectifying anisometropia.

  4. Photodissociation of H2S and the HS radical at 193.3 nm

    Science.gov (United States)

    Continetti, R. E.; Balko, B. A.; Lee, Y. T.

    1991-08-01

    Photodissociation of H2S has been studied at 193.3 nm using H atom photofragment-translational spectroscopy with mass-spectrometric detection. H + HS(v) product branching ratios are reported which are not in quantitative agreement with other recent experimental results. Secondary photodissociation of HS radicals has also been observed, showing that both S(3P) and S(1D) are produced via perpendicular transition. The HS bond energy was found to be 3.62 ± 0.03 eV.

  5. Absolute vacuum ultraviolet flux in inductively coupled plasmas and chemical modifications of 193 nm photoresist

    Science.gov (United States)

    Titus, M. J.; Nest, D.; Graves, D. B.

    2009-04-01

    Vacuum ultraviolet (VUV) photons in plasma processing systems are known to alter surface chemistry and may damage gate dielectrics and photoresist. We characterize absolute VUV fluxes to surfaces exposed in an inductively coupled argon plasma, 1-50 mTorr, 25-400 W, using a calibrated VUV spectrometer. We also demonstrate an alternative method to estimate VUV fluence in an inductively coupled plasma (ICP) reactor using a chemical dosimeter-type monitor. We illustrate the technique with argon ICP and xenon lamp exposure experiments, comparing direct VUV measurements with measured chemical changes in 193 nm photoresist-covered Si wafers following VUV exposure.

  6. [Cleavage of DNA fragments induced by UV nanosecond laser excitation at 193 nm].

    Science.gov (United States)

    Vtiurina, N N; Grokhovskiĭ, S L; Filimonov, I V; Medvedkov, O I; Nechipurenko, D Iu; Vasil'ev, S A; Nechipurenko, Iu D

    2011-01-01

    The cleavage of dsDNA fragments in aqueous solution after irradiation with UV laser pulses at 193 nm has been studied. Samples were investigated using polyacrylamide gel electrophoresis. The intensity of damage of particular phosphodiester bond after hot alkali treatment was shown to depend on the base pair sequence. It was established that the probability of cleavage is twice higher for sites of DNA containing two or more successively running guanine residues. A possible mechanism of damage to the DNA molecule connected with the migration of holes along the helix is discussed.

  7. Performance of 193-nm resists based on alicyclic methacrylate and cyclo-olefin systems

    Science.gov (United States)

    Padmanaban, Munirathna; Cook, Michelle M.; Durham, Dana L.; Khanna, Dinesh N.; Klauck-Jacobs, Axel; Oberlander, Joseph E.; Rahman, M. D.; Dammel, Ralph R.

    1999-04-01

    Among the chemistries/polymers reported for the 193nm photoresist applications, methacrylate copolymers consisting of 2-methyl-2-adamantane methacrylate and mevalonic lactone methacrylate and cycloolefin polymers derived from derivatives of norbornene have shown promising results. We have studied the lithographic properties of these two but different promising chemistries. Both system offer linear resolutions down to 0.13 micrometers using conventional 193 nm illumination and high sensitivity at standard developer conditions. While the methacrylate based system shows best performance on substrates with bottom coats, the cycloolefin-Maleic anhydride alternate copolymer based resists performs well on bare silicon as well as substrates with bottom coats. The etch rates of the methacrylate and cycloolefin based resists were found to be 1.4 and 1.3 times relative to that of KrF resist APEX-E. Further, new polymers consisting of isobornyl and alkyl ether chains on the ester groups of norbornene carboxylate were made in order to decrease the glass-transition temperatures of the norbornene-maleic anhydride type polymers. These results will be included and discussed in detail.

  8. The Soybean Rfg1 Gene Restricts Nodulation by Sinorhizobium fredii USDA193

    Directory of Open Access Journals (Sweden)

    Yinglun Fan

    2017-09-01

    Full Text Available Sinorhizobium fredii is a fast-growing rhizobial species that can establish a nitrogen-fixing symbiosis with a wide range of legume species including soybeans (Glycine max. In soybeans, this interaction shows a high level of specificity such that particular S. fredii strains nodulate only a limited set of plant genotypes. Here we report the identification of a dominant gene in soybeans that restricts nodulation with S. fredii USDA193. Genetic mapping in an F2 population revealed co-segregation of the underlying locus with the previously cloned Rfg1 gene. The Rfg1 allele encodes a member of the Toll-interleukin receptor/nucleotide-binding site/leucine-rich repeat class of plant resistance proteins that restricts nodulation by S. fredii strains USDA257 and USDA205, and an allelic variant of this gene also restricts nodulation by Bradyrhizobium japonicum USDA122. By means of complementation tests and CRISPR/Cas9-mediated gene knockouts, we demonstrate that the Rfg1 allele also is responsible for resistance to nodulation by S. fredii USDA193. Therefore, the Rfg1 allele likely provides broad-spectrum resistance to nodulation by many S. fredii and B. japonicum strains in soybeans.

  9. Comparison of 3D surfaces produced by 248-nm and 193-nm excimer laser radiation

    Science.gov (United States)

    Toenshoff, Hans K.; Graumann, Christoph; Rinke, Marcus; Hesener, Hanno; Kulik, Christian

    1998-10-01

    Currently there is a strong demand for refractive optical elements made from glass in 21/2D and 3D-structures. Due to the characteristics of brittle materials like glass, only a limited number of manufacturing methods can be used to machine these materials with sub-micron resolution. Thus, current microstructures made out of glass are mainly manufactured by photolithography and etching process. Lithography techniques are only for economic purposes for a series production, but is not suitable for manufacturing prototypes or a small series. Micromachining done with Excimer Lasers in combination with high precision CNC- controlled handling systems offers flexible design possibilities for optical components. Due to the limitations of conventional machining techniques for brittle materials, a new laser machining system for material processing at a wavelength of 193 nm has been designed and built. The better absorption of 193 nm compared to 248 nm or larger wavelengths leads to damage free microstructuring of most glasses. Data generation for the volume to be ablated starts with the mathematical description of the surface shape of the optical component. The contour can be derived from a mathematical function or individual xyz-data point information from any CAD-program. A pre-processor calculates the CNC-data for laser triggering, xyz-table and the CNC- mask control. Each laser pulse leads to a material removal, defined by the illuminated surface on the workpiece as well as the energy density. Superposition or overlapping of pulses allows the creation of the desired surface. The surface roughness is determined by the wavelength as well as the chosen ablation strategy. To achieve best results, the process has to be carefully adjusted for a specific material. This technique is a sufficient method for structuring grooves in ceramics or glass as well as producing aspherical transparent optical surfaces or micro lens arrays. This paper shall describe the potential of 193 nm

  10. New approaches to production-worthy 193-nm photoresists based on acrylic copolymers

    Science.gov (United States)

    Wallow, Thomas I.; Allen, Robert D.; Opitz, Juliann; Di Pietro, Richard A.; Brock, Phillip J.; Sooriyakumaran, Ratnam; Hofer, Donald C.

    1998-06-01

    We describe a series of improvements to the `v2' etch- resistant methacrylate 193 nm photoresist platform. `V2' itself possesses many desirable characteristics, but requires weak developers and lacks ultimate etch resistance for production processes. Modifications to address these challenges include incorporation of polar modifier monomers which provide improved developer compatibility, and use of alternative etch-resistant monomers which ameliorate the excessive hydrophobicity of isobornyl methacrylate. Specifically, we explore the use of methacrylonitrile as a polar modifier which simultaneously imparts strong-developer compatibility and improves RIE performance. Integration of these improvements results in methacrylate resists displaying strong-developer compatibility, sub-0.15 micrometers resolution, and etch rates equivalent to current 248 nm photoresists in prototype materials.

  11. The effect of 193 nm excimer laser radiation on the human corneal endothelial cell density

    Energy Technology Data Exchange (ETDEWEB)

    Isager, P.; Hjortdal, J.Oe.; Ehlers, N. [Aarhus Univ. Hospital, Dept. of Ophthalmology, Aarhus (Denmark)

    1996-06-01

    The effect of 193 nm excimer laser radiation on human corneal endothelial cell density was examined. Fifty-five eyes from 35 patients underwent photorefractive keratectomy for myopia. Photomicrographs of the endothelium were taken a short time before the operation and on an average of 7 months postoperatively with a specular microscope. The average endothelial cell densities were preoperatively 3375 {+-} 266 cells/mm{sup 2} (means {+-} SD) and postoperatively 3348 {+-} 287 cells/mm{sup 2}, corresponding to a fall of 27 cells/mm{sup 2} (N = 55). This fall in endothelial cell density was not statistically significant. A significant correlation between the change in cell density and age of the patient was found, with older patients losing more cells (N = 35, 2p < 0.05). The magnification of the specular microscope was found to change with corneal thickness. The importance of correcting the endothelial cell densities for corneal thickness is discussed. (au) 14 refs.

  12. CD-SEM image acquisition effects on 193-nm resists line slimming

    Science.gov (United States)

    Sullivan, Neal T.; Mastovich, Martin E.; Bowdoin, Scott; Brandom, Robert

    2003-05-01

    ArF resist slimming under electron beam exposure introduces significant measurement uncertainty in the metrology of 193nm resists. Previous studies have demonstrated the primary effect of electron landing energy on ArF resist line slimming; this work examines the influence of acquisition time, beam blanking, probe current and measurement magnification. This work will demonstrate, in concurrence with other research, that reducing landing energy remains the most effective method for minimizing line slimming of ArF resist under electron beam exposure. However, the other parameters studied can also affect the magnitude of line slimming. This becomes especially important for line edge roughness (LER) measurements which require a greater total dose be imparted to the sample to maintain measurement precision. Control over all acquisition parameters is essential to achieve accurate and repeatable LER measurements.

  13. Three-body dissociations: The photodissociation of dimethyl sulfoxide at 193 nm

    Energy Technology Data Exchange (ETDEWEB)

    Blank, D.A.; North, S.W.; Stranges, D. [Lawrence Berkeley National Lab., CA (United States)] [and others

    1997-04-01

    When a molecule with two equivalent chemical bonds is excited above the threshold for dissociation of both bonds, how the rupture of the two bonds is temporally coupled becomes a salient question. Following absorption at 193 nm dimethyl sulfoxide (CH{sub 3}SOCH{sub 3}) contains enough energy to rupture both C-S bonds. This can happen in a stepwise (reaction 1) or concerted (reaction 2) fashion where the authors use rotation of the SOCH{sub 3} intermediate prior to dissociation to define a stepwise dissociation: (1) CH{sub 3}SOCH{sub 3} {r_arrow} 2CH{sub 3} + SO; (2a) CH{sub 3}SOCH{sub 3} {r_arrow} CH{sub 3} + SOCH{sub 3}; and (2b) SOCH{sub 3} {r_arrow} SO + CH{sub 3}. Recently, the dissociation of dimethyl sulfoxide following absorption at 193 nm was suggested to involve simultaneous cleavage of both C-S bonds on an excited electronic surface. This conclusion was inferred from laser induced fluorescence (LIF) and resonant multiphoton ionization (2+1 REMPI) measurements of the internal energy content in the CH{sub 3} and SO photoproducts and a near unity quantum yield measured for SO. Since this type of concerted three body dissociation is very interesting and a rather rare event in photodissociation dynamics, the authors chose to investigate this system using the technique of photofragment translational spectroscopy at beamline 9.0.2.1. The soft photoionization provided by the VUV undulator radiation allowed the authors to probe the SOCH{sub 3} intermediate which had not been previously observed and provided good evidence that the dissociation of dimethyl sulfoxide primarily proceeds via a two step dissociation, reaction 2.

  14. Photoinitiated decomposition of substituted ethylenes: The photodissociation of vinyl chloride and acrylonitrile at 193 nm

    Energy Technology Data Exchange (ETDEWEB)

    Blank, D.A.; Suits, A.G.; Lee, Y.T. [Lawrence Berkeley National Lab., CA (United States)] [and others

    1997-04-01

    Ethylene and its substituted analogues (H{sub 2}CCHX) are important molecules in hydrogen combustion. As the simplest {pi}-bonded hydrocarbons these molecules serve as prototypical systems for understanding the decomposition of this important class of compounds. The authors have used the technique of photofragment translational spectroscopy at beamline 9.0.2.1 to investigate the dissociation of vinyl chloride (X=Cl) and acrylonitrile (X=CN) following absorption at 193 nm. The technique uses a molecular beam of the reactant seeded in helium which is crossed at 90 degrees with the output of an excimer laser operating on the ArF transition, 193.3 nm. The neutral photoproducts which recoil out of the molecular beam travel 15.1 cm where they are photoionized by the VUV undulator radiation, mass selected, and counted as a function of time. The molecular beam source is rotatable about the axis of the dissociation laser. The authors have directly observed all four of the following dissociation channels for both systems: (1) H{sub 2}CCHX {r_arrow} H + C{sub 2}H{sub 2}X; (2) H{sub 2}CCHX {r_arrow} X + C{sub 2}H{sub 3}; (3) H{sub 2}CCHX {r_arrow} H{sub 2} + C{sub 2}HX; and (4) H{sub 2}CCHX {r_arrow} HX + C{sub 2}H{sub 2}. They measured translational energy distributions for all of the observed channels and measured the photoionization onset for many of the photoproducts which provided information about their chemical identity and internal energy content. In the case of acrylonitrile, selective product photoionization provided the ability to discriminate between channels 2 and 4 which result in the same product mass combination.

  15. An AC phase measuring interferometer for measuring dn/dT of fused silica and calcium fluoride at 193 nm

    Energy Technology Data Exchange (ETDEWEB)

    Shagam, R.N.

    1998-09-01

    A novel method for the measurement of the change in index of refraction vs. temperature (dn/dT) of fused silica and calcium fluoride at the 193 nm wavelength has been developed in support of thermal modeling efforts for the development of 193 nm-based photolithographic exposure tools. The method, based upon grating lateral shear interferometry, uses a transmissive linear grating to divide a 193 nm laser beam into several beam paths by diffraction which propagate through separate identical material samples. One diffracted order passing through one sample overlaps the undiffracted beam from a second sample and forms interference fringes dependent upon the optical path difference between the two samples. Optical phase delay due to an index change from heating one of the samples causes the interference fringes to change sinusoidally with phase. The interferometer also makes use of AC phase measurement techniques through lateral translation of the grating. Results for several samples of fused silica and calcium fluoride are demonstrated.

  16. A mathematical model of bimodal epigenetic control of miR-193a in ovarian cancer stem cells.

    Directory of Open Access Journals (Sweden)

    Frank H C Cheng

    Full Text Available Accumulating data indicate that cancer stem cells contribute to tumor chemoresistance and their persistence alters clinical outcome. Our previous study has shown that ovarian cancer may be initiated by ovarian cancer initiating cells (OCIC characterized by surface antigen CD44 and c-KIT (CD117. It has been experimentally demonstrated that a microRNA, namely miR-193a, targets c-KIT mRNA for degradation and could play a crucial role in ovarian cancer development. How miR-193a is regulated is poorly understood and the emerging picture is complex. To unravel this complexity, we propose a mathematical model to explore how estrogen-mediated up-regulation of another target of miR-193a, namely E2F6, can attenuate the function of miR-193a in two ways, one through a competition of E2F6 and c-KIT transcripts for miR-193a, and second by binding of E2F6 protein, in association with a polycomb complex, to the promoter of miR-193a to down-regulate its transcription. Our model predicts that this bimodal control increases the expression of c-KIT and that the second mode of epigenetic regulation is required to generate a switching behavior in c-KIT and E2F6 expressions. Additional analysis of the TCGA ovarian cancer dataset demonstrates that ovarian cancer patients with low expression of EZH2, a polycomb-group family protein, show positive correlation between E2F6 and c-KIT. We conjecture that a simultaneous EZH2 inhibition and anti-estrogen therapy can constitute an effective combined therapeutic strategy against ovarian cancer.

  17. 75 FR 63504 - Outer Continental Shelf, Alaska OCS Region, Chukchi Sea Planning Area, Oil and Gas Lease Sale 193

    Science.gov (United States)

    2010-10-15

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF THE INTERIOR Bureau of Ocean Energy Management, Regulation and Enforcement Outer Continental Shelf, Alaska OCS Region, Chukchi Sea Planning Area, Oil and Gas Lease Sale 193 AGENCY: Bureau of Ocean Energy Management...

  18. The photodissociation dynamics of ozone at 193 nm: An O(D-1(2)) angular momentum polarization study

    NARCIS (Netherlands)

    Brouard, M.; Cireasa, D.R.; Clark, A.P.; Groenenboom, G.C.; Hancock, G.; Horrocks, S.J.; Quadrini, F.; Ritchie, G.A.D.; Vallance, C.

    2006-01-01

    Polarized laser photolysis, coupled with resonantly enhanced multiphoton ionization detection of O(D-1(2)) and velocity-map ion imaging, has been used to investigate the photodissociation dynamics of ozone at 193 nm. The use of multiple pump and probe laser polarization geometries and probe

  19. Determination of effective resonance energy for the 193Ir(n,γ)194Ir reaction by the cadmium ratio method

    Science.gov (United States)

    Budak, Mustafa Guray; Karadag, Mustafa; Yücel, Haluk

    2016-04-01

    In this work, the effective resonance energy, Ebarr -value for the 193Ir(n,γ)194Ir reaction was measured using cadmium ratio method. A dual monitor (197Au-98Mo), which has convenient resonance properties, was employed for characterization of the irradiation sites. Then analytical grade iridium oxide samples diluted with CaCO3 to lower neutron self-shielding effect stacked in small cylindrical Teflon boxes were irradiated once with a 1 mm thick Cd cylindrical box placed in a thermalized neutron field of an 241Am-Be neutron source then without it. The activities produced in samples during 193Ir(n,γ)194Ir reaction were measured using a p-type HPGe detector γ-ray spectrometer with a 44.8% relative efficiency. The correction factors for thermal, epithermal neutron self-shielding (Gth, Gepi), true coincidence summing (Fcoi) and gamma-ray self-absorption (Fs) effects were determined with appropriate approaches and programs. Thus, the experimental Ebarr -value was determined to be 2.65 ± 0.61 eV for 193Ir target nuclide. The recent data for Q0 and FCd values for Ebarr determination were based on k0-NAA online database. The present experimental Ebarr value was calculated and compared with more recent values for Q0 and FCd for 193Ir. Additionally, the Ebarr -values was theoretically calculated from the up-to-date resonance data obtained from ENDF/B VII library using two different approaches. Since there is no experimentally determined Ebarr -value for the 193Ir isotope, the results are compared with the calculated ones given in the literature.

  20. Phase I biodistribution and pharmacokinetic study of Lewis Y-targeting immunoconjugate CMD-193 in patients with advanced epithelial cancers.

    Science.gov (United States)

    Herbertson, Rebecca A; Tebbutt, Niall C; Lee, Fook-Thean; MacFarlane, David J; Chappell, Bridget; Micallef, Noel; Lee, Sze-Ting; Saunder, Timothy; Hopkins, Wendie; Smyth, Fiona E; Wyld, David K; Bellen, John; Sonnichsen, Daryl S; Brechbiel, Martin W; Murone, Carmel; Scott, Andrew M

    2009-11-01

    This phase I study explored the biodistribution and pharmacokinetics of the immunoconjugate CMD-193 [a humanized anti-Lewis Y (Le(y)) antibody conjugated with calicheamicin in patients with advanced cancers expressing the Le(y) antigen. The primary objectives were to determine biodistribution and pharmacokinetics of CMD-193. Secondary objectives included response rates and change in tumor metabolism. Patients with progressive, measurable, and Le(y) positive malignancies were eligible for enrollment in one of two dose cohorts, 1.0 and 2.6 mg/m(2). The first cycle was trace labeled with (111)In for biodistribution assessment using gamma camera imaging. Subsequent cycles were administered every 3 weeks up to a maximum of six cycles, depending on toxicity and response. Pharmacokinetic analysis was based on radioassay and ELISA. Nine patients were enrolled in the study. Biodistribution images showed initial blood pool activity, followed by markedly increased hepatic uptake by day 2, and fast blood clearance in all patients. There was low uptake in tumor in all patients. The overall T(1/2)beta of (111)In-CMD-193 was 102.88 +/- 35.67 hours, with no statistically significant difference between the two dose levels. One patient had a partial metabolic response on (18)F-fluorodeoxyglucose-positron emission tomography ((18)F-FDG PET) after four cycles, but no radiological responses were observed. Myelosuppression and effects on liver function were the most significant adverse effects. CMD-193 shows rapid blood clearance and increased hepatic uptake compared with prior studies of the parental antibody hu3S193. These results highlight the importance of biodistribution and pharmacodynamic assessment in early phase studies of new biologics to assist in clinical development.

  1. Continuous evolution of lithographic films through process steps: an example with 193 chemically amplified resists

    Science.gov (United States)

    Derrough, Samir; Tiron, Raluca; Perret, Damien; Thackeray, James W.; Sourd, Claire; Paniez, Patrick

    2010-04-01

    Chemically Amplified resists are complex systems. If the main mechanisms implied have already been described, the challenge to even better control and model these formulations remains important as performance requirements become more and more stringent and critical dimensions get smaller and smaller. This paper tries to assess and deconvolute some of the main potential mechanisms involved during the process of a 193 nm chemically amplified resist, before correlating them with the final lithographic results obtained. A formulation was selected in order to offer a large range of film physical properties, thus allowing the resist film to switch from non-annealing to annealing conditions. The use of thermal analysis as the main characterization technique allowed correlation between the variations in physico-chemical properties and process conditions. This investigation also included a study of the behavior of some additives during bake steps. In so doing, it became possible to correlate the variations of the resist properties under different bake conditions to the changes in its final lithographic performance, i.e. contrast, sensitivity and line edge roughness.

  2. Photolysis of pure solid O3 and O2 films at 193 nm

    CERN Document Server

    Raut, U; Famá, M; Baragiola, R A

    2010-01-01

    We studied quantitatively the photochemistry of solid O3 and O2 films at 193 nm and 22 K with infrared spectroscopy and microgravimetry. Photolysis of pure ozone destroyed O3, but a small amount of ozone remained in the film at high fluence. Photolysis of pure O2 produced O3 in an amount that increased with photon fluence to a stationary level. For both O2 and O3 films, the O3:O2 ratio at saturation is 0.03, nearly 10-30 times larger than those obtained in gas phase photolysis. This enhancement is attributed to the increased photodissociation of O2 due to photoabsorption by O2 dimers, a process significant at solid state densities. We obtain initial quantum yield for ozone synthesis from solid oxygen, {\\Phi} (O3) = 0.18 and for destruction of ozone and oxygen in their parent solids, {\\Phi} (- O3) = 1.7 and {\\Phi} (-O2) = 0.28. Combined with known photoabsorption cross sections, we estimate probabilities for germinate recombination of 0.15 for O3 fragments and 0.90 for oxygen atoms from O2 dissociation. Using ...

  3. Spin, quadrupole moment, and deformation of the magnetic-rotational band head in (193)Pb

    CERN Document Server

    Balabanski, D L; Iordachescu, A; Bazzacco, D; Brandolini, F; Bucurescu, D; Chmel, S; Danchev, M; De Poli, M; Georgiev, G; Haas, H; Hubel, H; Marginean, N; Menegazzo, R; Neyens, G; Pavan, P; Rossi Alvarez, C; Ur, C A; Vyvey, K; Frauendorf, S

    2011-01-01

    The spectroscopic quadrupole moment of the T(1/2) = 9.4(5) ns isomer in (193)Pb at an excitation energy E(ex) = (2585 + x) keV is measured by the time-differential perturbed angular distribution method as vertical bar Q(s)vertical bar = 2.6(3) e b. Spin and parity I(pi) = 27/2(-) are assigned to it based on angular distribution measurements. This state is the band head of a magnetic-rotational band, described by the coupling of a neutron hole in the 1i(13/2) subshell with the (3s(1/2)(-2)1h(9/2)1i(13/2))(11-) proton excitation. The pairing-plus-quadrupole tilted-axis cranking calculations reproduce the measured quadrupole moment with a moderate oblate deformation epsilon(2) = -0.11, similar to that of the 11(-)proton intruder states, which occur in the even-even Pb nuclei in the region. This is the first direct measurement of a quadrupole moment and thus of the deformation of a magnetic-rotational band head.

  4. Fast evaluation of photomask near-fields in subwavelength 193-nm lithography

    Science.gov (United States)

    Tirapu-Azpiroz, Jaione; Yablonovitch, Eli

    2004-05-01

    Sub-wavelength lithography places a serious limitation on the conventional "thin mask" approximation of the field immediately behind the patterned mask. This approximation fails to account for the increasingly important topographical effects of the mask or "thick mask" effects. This approximation of the photomask near-fields results from the direct application of Kirchhoff Boundary Conditions, which multiply the incident field by a binary transmission function of the patterned mask. Polarization dependent edge diffraction effects, as well as phase and amplitude transmission errors that arise from the vector nature of light, and the finite thickness of the substrate and chrome layers, produce significant errors in the scalar simulations of the lithographic image. Based on the comparison of aerial images at the wafer plane produced by both rigorous electromagnetic solutions of the field on the mask and their "thin mask" counterparts, a more accurate model is proposed that consists of a fixed-width, locally-determined boundary layer of imaginary transmission coefficient added to every edge of the initial "thin mask" approximation. The accuracy of the resultant Boundary Layer model has been exhaustively tested against rigorously simulated aerial images of isolated as well as periodic features of very different profiles and dimensions. The conclusion being that this simple approach is capable of modeling "thick mask" effects at both 248nm and 193nm wavelength and high NA lithography. This greatly improves the accuracy of aerial image computation in photolithography simulations at a reasonable computational cost.

  5. 193-nm radiation durability study of MoSi binary mask and resulting lithographic performance

    Science.gov (United States)

    Servin, Isabelle; Belledent, Jérôme; Pain, Laurent; Connolly, Brid; Sczyrba, Martin; Lamantia, Matt

    2011-05-01

    Dimensions on mask continue to shrink to keep up with the ITRS roadmap. This has implications on the material of choice for the blanks. For example, the new binary OMOG stack (Opaque MOSi on Glass) was successfully introduced to meet the mask specifications at the 32nm technology node. Obviously 193-nm optical lithography will be further used in production at even higher NA and lower k1 emphasizing, for example, the impact on wafer of any electromagnetic field migration effects. Indeed, long term radiation damage inducing CD growth and consequently, device yield loss, has already been reported [1, 2]. This mechanism, known as Electric Field induced Migration of chrome (EMF) often shortens the mask's lifetime. Here, a study was conducted to investigate the impact of intensive ArF scanner exposure both on final wafer and mask performances. The Si printed wafers measured with top-down CD-SEM were characterized with respect to CD uniformity, linearity, Sub Resolution Assist Feature (SRAF) printability through process window, MEEF, DOF, and OPC accuracy. The data was also correlated to advanced mask inspection results (e.g. AIMSTM) taken at the same location. More precisely, this work follows a preliminary study [1] which pointed out that OMOG is less sensitive to radiation than standard COG (Chrome On Glass). And, in this paper, we report on results obtained at higher energy to determine the ultimate lifetime of OMOG masks.

  6. k193hw.m77t and k193hw.h77t: MGD77T data and header files for single-beam bathymetry data for field activity K-1-93-HW in Oahu, Hawaii from 02/20/1993 to 02/26/1993

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of the U.S. Geological Survey cruise K-1-93-HW. The cruise was conducted in Oahu,...

  7. a193yb.m77t and a193yb.h77t: MGD77T data and header files for single-beam bathymetry data for field activity A-1-93-YB in Yakukat Bay, Alaska from 08/21/1993 to 08/27/1993

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with GPS navigation data was collected as part of the U.S. Geological Survey cruise A-1-93-YB. The cruise was conducted in Yakukat...

  8. [193 excimer laser trepanation in perforating keratoplasty. Report of 70 patients].

    Science.gov (United States)

    Naumann, G O; Seitz, B; Lang, G K; Langenbucher, A; Kus, M M

    1993-10-01

    In penetrating keratoplasty, trephination with the 193 nm excimer laser may help avoid the differences in the deformation of the donor and recipient wound margins which occur with the conventional procedure. By varying the shape of the "open metal mask", other cut configurations can be achieved besides circular. Thus, "vertical tilt" and "horizontal torsion", both potential reasons for persistent long-term astigmatism after PK, may be minimized. Following experimental studies, the authors present the results obtained in their first 70 consecutive patients. 38 women and 32 men were treated (mean age 60.6 years, range 17 to 89 years). Indications were corneal processes without vascularization: Fuchs' dystrophy (n = 32), other stromal dystrophies (n = 5), secondary corneal endothelial decompensation (n = 6), keratoconus (n = 15), nonvascularized corneal scars (n = 4) and miscellaneous (n = 8 ). We used elliptical metal masks with/without orientation teeth and circular masks with four and eight orientation teeth, respectively. The HeNe aiming beam was manually controlled by a micromanipulator ("joystick"). The technical data of the laser were as follows: spot mode, 1.5 x 1.5 mm; repetition rate 30/sec and 25/sec, respectively; pulse energy 15-25 mJ; mean number of pulses 6407 (recipient) and 9150 (donor). With an elliptical outline, wound closure was usually achieved with single sutures. With a circular outline with orientation teeth, wound closure was most commonly achieved with a double running suture. Patients were prospectively documented using modified Erlangen record sheets. Follow-up ranged from 3 months to 3.4 years (mean 11.4 months). With two exceptions, penetration of the anterior chamber with the 193 nm excimer laser was accomplished without deformation of the cut edges. The elliptical outline facilitated fitting of the graft into the recipient wound bed, and the orientation teeth made fitting even easier. Initial intraoperative complications due to

  9. Breast ultrasound elastography-Results of 193 breast lesions in a prospective study with histopathologic correlation

    Energy Technology Data Exchange (ETDEWEB)

    Schaefer, F.K.W., E-mail: fschaefer@email.uni-kiel.de [Breast Centre, University Hospital Schleswig-Holstein Campus Kiel, Arnold-Heller-Str. 3/Haus 24, 24105 Kiel (Germany); Heer, I.; Schaefer, P.J.; Mundhenke, C.; Osterholz, S.; Order, B.M.; Hofheinz, N.; Hedderich, J.; Heller, M.; Jonat, W.; Schreer, I. [Breast Centre, University Hospital Schleswig-Holstein Campus Kiel, Arnold-Heller-Str. 3/Haus 24, 24105 Kiel (Germany)

    2011-03-15

    Purpose: To evaluate the diagnostic performance of ultrasound elastography in breast masses. Material and methods: 193 lesions (129 benign, 64 malignant) were analyzed with the EUB 8500 Logos-ultrasonic-unit (Hitachi Medical, Japan) and a linear-array-transducer of 7.5-13-MHz. Standard of reference was cytology (FNAfine needle aspiration) or histology (core biopsy). The elastic-score was classified according to a 6-point colour-scale (Ueno classification; 1-3 = benign, 4-5 = malignant). Conventional B-mode ultrasound (US) findings were classified according to the BI-RADS classification. Statistical analysis included sensitivity, specificity, ROC-analysis and kappa-values for intra-/interobserver reliability. Results: The mean score for elasticity was 4.1 {+-} 0.9 for malignant lesions, and 2.1 {+-} 1.0 for benign lesions (p < 0.001). With a best cut-off point between elasticity scores 3 and 4, sensitivity was 96.9%, and specificity 76%. Setting a best cut-off point for conventional US between BI-RADS 4 and 5, sensitivity was 57.8%, and specificity 96.1%. Elastography provided higher sensitivity and lower specificity than conventional US, but two lesions with elasticity score 1 were false negative, whereas no lesion scored BI-RADS 1-3 were false negative. ROC-curve was 0.884 for elastography, and 0.820 for conventional US (p < 0.001). Weighted kappa-values for intra-/interobserver reliability were 0.784/0.634 for BI-RADS classification, and 0.720/0.561 for elasticity scores. Conclusion: In our study setting, elastography does not have the potential to replace conventional B-mode US for the detection of breast cancer, but may complement conventional US to improve the diagnostic performance.

  10. Azimuthal anisotropy of strange hadrons in U+U collisions at √SNN = 193 GeV at RHIC

    Directory of Open Access Journals (Sweden)

    Bairathi Vipul

    2018-01-01

    Full Text Available We present the measurement of the azimuthal anisotropy of strange hadrons (K0s, ϕ and Λ at mid-rapidity (|y| < 1.0 in U+U collisions at SNN = 193 GeV using the STAR detector at RHIC. We present the centrality and transverse momentum dependence of flow coefficients υn for n = 2, 3, 4. A strong centrality dependence of υ2 is observed for the particles K0s, ϕ and Λ in U+U collisions at SNN = 193 GeV similar to Au+Au collisions at SNN = 200 GeV. We studied the number of constituent quark scaling (NCQ of the flow coefficients. The NCQ scaling of the flow coefficients holds within uncertainties for the particles studied in the U+U collisions. We also present the comparison of the results to the AMPT transport model.

  11. Experimental measurements of diffraction for periodic patterns by 193-nm polarized radiation compared to rigorous EMF simulations

    Science.gov (United States)

    Bennett, Marylyn H.; Grenville, Andrew; Hector, Scott D.; Palmer, Shane R.; Leunissen, Leonardus H. A.; Philipsen, Vicky; Bloomstein, Theodore M.; Hardy, Dennis E.; Rothschild, Mordechai; Hilfiker, James N.

    2005-05-01

    Polarization dependent diffraction efficiencies in transmission through gratings on specially designed masks with pitch comparable to the wavelength were measured using an angle-resolved scatterometry apparatus with a 193 nm excimer source. Four masks - two binary, one alternating and one attenuated phase shift mask - were included in the experimental measurements. The validity of models used in present commercially available simulation packages and additional polarization effects were evaluated against the experimental scattering efficiencies.

  12. Symmetric stretch excitation of CH3 in the 193.3 nm photolysis of CH3I

    Science.gov (United States)

    Continetti, R. E.; Balko, B. A.; Lee, Y. T.

    1988-09-01

    New high resolution photofragment translational spectroscopy measurements on the 193.3 nm photolysis of CH3I reveal up to four quanta of ν1 C-H symmetric stretch excitation in the C-I bond fission channel. In addition these experiments show for the first time that C-H bond fission occurs at wavelengths longer than 185 nm with a quantum yield of ˜3%. The data yields upper bounds to the C-H bond dissociation energy in CH3I of 101±1 kcal/mol and for the C-I bond energy, 55.0±0.3 kcal/mol.

  13. Metal1 patterning study for random-logic applications with 193i, using calibrated OPC for litho and etch

    Science.gov (United States)

    Mailfert, Julien; Van de Kerkhove, Jeroen; De Bisschop, Peter; De Meyer, Kristin

    2014-03-01

    A Metal1-layer (M1) patterning study is conducted on 20nm node (N20) for random-logic applications. We quantified the printability performance on our test vehicle for N20, corresponding to Poly/M1 pitches of 90/64nm, and with a selected minimum M1 gap size of 70nm. The Metal1 layer is patterned with 193nm immersion lithography (193i) using Negative Tone Developer (NTD) resist, and a double-patterning Litho-Etch-Litho-Etch (LELE) process. Our study is based on Logic test blocks that we OPCed with a combination of calibrated models for litho and for etch. We report the Overlapping Process Window (OPW), based on a selection of test structures measured after-etch. We find that most of the OPW limiting structures are EOL (End-of-Line) configurations. Further analysis of these individual OPW limiters will reveal that they belong to different types, such as Resist 3D (R3D) and Mask 3D (M3D) sensitive structures, limiters related to OPC (Optical Proximity Corrections) options such as assist placement, or the choice of CD metrics and tolerances for calculation of the process windows itself. To guide this investigation, we will consider a `reference OPC' case to be compared with other solutions. In addition, rigorous simulations and OPC verifications will complete the after-etch measurements to help us to validate our experimental findings.

  14. Symmetric stretch excitation of CH/sub 3/ in the 193. 3 nm photolysis of CH/sub 3/I

    Energy Technology Data Exchange (ETDEWEB)

    Continetti, R.E.; Balko, B.A.; Lee, Y.T.

    1988-09-01

    New high resolution photofragment translational spectroscopy measurements on the 193.3 nm photolysis of CH/sub 3/I reveal up to four quanta of ..nu../sub 1/ C--H symmetric stretch excitation in the C--I bond fission channel. In addition these experiments show for the first time that C--H bond fission occurs at wavelengths longer than 185 nm with a quantum yield of approx.3%. The data yields upper bounds to the C--H bond dissociation energy in CH/sub 3/I of 101 +- 1 kcal/mol and for the C--I bond energy, 55.0 +- 0.3 kcal/mol.

  15. PK of immunoconjugate anticancer agent CMD-193 in rats: ligand-binding assay approach to determine in vivo immunoconjugate stability.

    Science.gov (United States)

    Hussain, Azher; Gorovits, Boris; Leal, Mauricio; Fluhler, Eric

    2014-01-01

    Antibody-drug conjugates (ADCs) are a new generation of anticancer therapeutics. The objective of this manuscript is to propose a methodology that can be used to assess the stability of the ADCs by using the PK data obtained by ligand-binding assays that measure various components of ADCs. The ligand-binding assays format of different components of ADCs provided unique valuable PK information. The mathematical manipulation of the bioanalytical data provided an insight into the in vivo integrity, indicating that the loading of the calicheamicin on the G193 antibody declines in an apparent slow first-order process. This report demonstrates the value of analyzing various components of the ADC and their PK profiles to better understand the disposition and in vivo stability of ADCs.

  16. $\\Upsilon$ production in U + U collisions at $\\sqrt{s_{NN}}$=193 GeV measured with the STAR experiment

    CERN Document Server

    Adamczyk, L.

    2016-01-01

    We present a measurement of the inclusive production of Upsilon mesons in U+U collisions at 193 GeV at mid-rapidity (|y| < 1). Previous studies in central Au+Au collisions at 200 GeV show a suppression of Upsilon(1S+2S+3S) production relative to expectations from the Upsilon yield in p+p collisions scaled by the number of binary nucleon-nucleon collisions (Ncoll), with an indication that the Upsilon(1S) state is also suppressed. The present measurement extends the number of participant nucleons in the collision (Npart) by 20% compared to Au+Au collisions, and allows us to study a system with higher energy density. We observe a suppression in both the Upsilon(1S+2S+3S) and Upsilon(1S) yields in central U+U data, which consolidates and extends the previously observed suppression trend in Au+Au collisions.

  17. NC-controlled production of smooth 3D surfaces in brittle materials with 193-nm excimer laser

    Science.gov (United States)

    Toenshoff, Hans K.; Graumann, Christoph; Hesener, Hanno; Rinke, Marcus

    1998-08-01

    Micromachining performed by Excimer Lasers in conjunction with NC-controlled machines offer flexible production possibilities for 3-D-surfaces. Due to the limitations of conventional micromachining technology for brittle transparent materials in the micro range, a new laser machining beam guiding and data handling system was designed and built. The data handling starts with the mathematical description of the surface shape to be machined. The contour can be derived from a mathematical function or individual xyz-data point information from any CAD-program. A pre-processor calculates the nc-data for laser triggering, xyz-motion and the nc-mask control. Each laser pulse leads to a material removal, defined by the illuminated surface on the work piece as well as the energy density. The principal of superposition of pulses allows the creation of the desired contour. The chosen ablation strategy determines the surface roughness and the process speed. To achieve best results, it has to be carefully adjusted for a specific material. This technique does not require prefabricated tools such as semiconductor masks. This is a sufficient method for structuring grooves in ceramics, diamonds or glass as well as aspherical transparent optical surfaces or micro lens arrays. The excellent absorption of 193 nm compared to 248 nm or larger wavelengths leads to damage free structuring of most brittle materials. The optimized surface ablation process requires spot sizes and energy densities on the work piece which can not be realized with a mirror based beam guidance system. To eliminate these restrictions, a new mirror free machining concept with a gas flushed beam guiding system mounted on a granite vibration reduction table with air bearing positioning system was build. This paper describes the potential of 193 nm treatment of 3-D micro surfaces with a process optimized machine and data handling system.

  18. Increasing level of prostate-specific antigen and prostate cancer risk factors among 193 men examined in screening procedure.

    Science.gov (United States)

    Opalińska, Edyta; Michalak, Anna; Stoma, Filip; Latalski, Maciej; Goniewicz, Mariusz

    2003-01-01

    Prostate cancer is one of the most common cancers in men, therefore has become recently an essential problem of public health. The factors influencing cancer include: androgens metabolism disorders, diabetes mellitus, overweight and obesity, smoking, alcohol and black coffee intake, diet rich in saturated fats and poor in unsaturated, lack of physical activity, geographical zone, race, such carcinogenic substances as: cadmium, materials used in rubber, painting, printing, ship industry etc., contagious factors and also older age and a positive family history of the disease. To diagnose prostate cancer in its early stage such screening procedures as physical examination--digital rectal exam (DRE) and determination of prostate-specific antigen (PSA) level in blood serum are used. The aim of the study was to assess prostate cancer risk factors occurrence in the examined 193 men, aged 50-70 years, who reported to urology outpatient department at Clinical Hospital in Lublin, measure the PSA level in blood serum and examine the correlation between them. Respondents filled in a questionnaire about the presence of prostate cancer risk factors and urogenital symptoms. The questionnaire was completed with DRE and PSA measurement. The results led us to the following conclusions: 1/ in the studied population elevated PSA level is determined in 3.1% of 193 examined men, 2/ increased PSA occurs mainly in men from rural areas, with elementary education, divorced, older (>60 years), using fat-rich diet, smokers, black coffee drinkers, with overweight or obesity and non diabetic, 3/ a combination of PSA test with DRE seems to be useful and rather cheap for the detection of prostate cancer in the early stage of its development.

  19. Hb G-Waimanalo [A1] or α64(E13)Asp→Asn (α1) (HBA1: c.193G>A) Observed in a Bulgarian Family.

    Science.gov (United States)

    Petkov, Georgi; Dimishkovska, Marija; Tsoneva Ivanova, Vanya; Yordanov, Georgi; Zdraveski, Alexandar; Plaseska-Karanfilska, Dijana

    2015-01-01

    The abnormal hemoglobin (Hb) with an aspartic acid to asparagine substitution at α64 has been found on both the α2- and α1-globin genes. It has been described in many different populations under different names, but never in Bulgaria. Using the recently proposed nomenclature, Hb G-Waimanalo [A1] refers to the HBA1: c.193G > A, while Hb G-Waimanalo [A2] refers to the HBA2: c.193G > A mutation. Here, we present the first family from Bulgaria with Hb G-Waimanalo [A1].

  20. Monophasic expression of FliC by Salmonella 4,[5],12:i:- DT193 does not alter its pathogenicity during infection of porcine intestinal epithelial cells.

    Science.gov (United States)

    Crayford, Georgina; Coombes, Janine L; Humphrey, Tom J; Wigley, Paul

    2014-11-01

    Non-typhoidal serotypes of Salmonella enterica remain important food-borne pathogens worldwide and the frequent emergence of epidemic strains in food-producing animals is a risk to public health. In recent years, Salmonella 4,[5],12:i:- isolates, expressing only phase 1 (FliC) of the two flagellar antigens, have emerged and increased in prevalence worldwide. In Europe, the majority of 4,[5],12:i:- isolates belong to phage types DT193 and DT120 of Salmonella Typhimurium and pigs have been identified as the reservoir species. In this study we investigated the ability of pig-derived monophasic (4,[5],12:i:-) and biphasic DT193 isolates to invade a porcine intestinal epithelial cell line (IPEC-1) and activate TLR-5, IL-8 and caspases. We found that the 4,[5],12:i:- isolates exhibited comparable adhesion and invasion to that of the virulent S. Typhimurium isolate 4/74, suggesting that these strains could be capable of colonizing the small intestine of pigs in vivo. Infection with 4,[5],12:i:- and biphasic DT193 isolates resulted in approximately the same level of TLR-5 (a flagellin receptor) and IL-8 (a proinflammatory chemokine) mRNA upregulation. The monophasic variants also elicited similar levels of caspase activation and cytotoxicity to the phase-variable DT193 isolates. These findings suggest that failure of 4,[5],12:i:- DT193 isolates to express a second phase of flagellar antigen (FljB) is unlikely to hamper their pathogenicity during colonization of the porcine intestinal tract. © 2014 The Authors.

  1. Production of the therapeutic radionuclides 193mPt and 195mPt with high specific activity via alpha-particle-induced reactions on 192Os.

    Science.gov (United States)

    Hilgers, K; Coenen, H H; Qaim, S M

    2008-04-01

    For the production of therapy-relevant radionuclides (193m)Pt (T(1/2)=4.33 d) and (195m)Pt (T(1/2)=4.03 d) with a high specific activity, the (192)Os(alpha,n)(195m)Pt and (192)Os(alpha,3n)(193m)Pt nuclear reactions were investigated for the first time from their respective thresholds up to 28 MeV. Thin samples of enriched (192)Os were prepared by electrodeposition on Ni, and the conventional stacked-foil technique was used for cross-section measurements. The calculated thick target yields were found to be 0.013 MBq/microA h for the (192)Os(alpha,n)(195m)Pt reaction in the energy range of E(alpha)=24-->18 MeV, and 0.25 MBq/microA h for the (192)Os(alpha,3n)(193m)Pt reaction in the energy range of E(alpha)=28-->24 MeV. The two radionuclides could not be detected in the interactions of (3)He particles with (192)Os. A production method involving high-current alpha-particle irradiation of enriched (192)Os and efficient chemical separation of radioplatinum was developed. Batch yields of about 1 MBq (195m)Pt and 8.7 MBq (193m)Pt were achieved. Compared to the reactor production these batch yields are very low, but the (192)Os(alpha,n)(195m)Pt and (192)Os(alpha,3n)(193m)Pt reactions are superior with respect to the specific activity of the products which is higher by two orders of magnitude.

  2. Electro-optical and dielectric properties of a high tilt antiferroelectric liquid crystal mixture (W-193B)

    Energy Technology Data Exchange (ETDEWEB)

    Nayek, Prasenjit; Ghosh, Sharmistha; Kundu, Sudarshan; Roy, Subir Kr [Department of Spectroscopy, Indian Association for the Cultivation of Science, Jadavpur, Calcutta-700032 (India); Majumder, Tapas Pal [Department of Physics, University of Kalyani, Kalyani-741235, West Bengal (India); Bennis, Noureddine; Oton, Jose Manuel [Department of TecnologIa Fotonica, ETSI Telecomunicacion, Universidad Politecnica de Madrid, Ciudad Universitaria, 28040 Madrid (Spain); Dabrowski, Roman, E-mail: spskr@iacs.res.i [Institute of Chemistry, Military University of Technology, 00-908 Warsaw (Poland)

    2009-11-21

    The electro-optical properties and dielectric relaxation have been investigated for an antiferroelectric liquid crystal mixture W-193B. The material exhibits smectic A*, smectic C* and a wide range of anticlinic smectic C{sub A}{sup *} phases. The high tilt and broad room temperature smectic C{sub A}{sup *} phase make it a good candidate for antiferroelectric display materials. Dielectric studies have been made in a planarly aligned cell in the frequency range 10 Hz-13 MHz. Dielectric spectroscopy reveals the existence of soft mode in the smectic A* phase and Goldstone mode in the smectic C* phase. In the smectic C{sub A}{sup *} phase the dielectric spectrum of the material exhibits two absorption peaks related to the rotational fluctuation around the short axis of the molecules and antiphase azimuthal angle fluctuation, respectively, and are separated by about two orders of frequency. Electro-optical response using a low frequency triangular wave showed a very high quasi-static contrast ratio of 132 : 1, threshold voltage of around 7 V and saturation of 17 V. Surface-stabilized, low thickness cells of this mixture showed a perfect double hysteresis loop with a 1 Hz triangular signal, reaching different transmission levels for different voltage amplitudes. These levels can be stabilized with a single holding voltage, making it possible for the material to be passively multiplexed at video rate.

  3. Epidemiology of Diabetes Mellitus among 193,435 Cats Attending Primary-Care Veterinary Practices in England.

    Science.gov (United States)

    O'Neill, D G; Gostelow, R; Orme, C; Church, D B; Niessen, S J M; Verheyen, K; Brodbelt, D C

    2016-07-01

    Diabetes mellitus (DM) is a common endocrine disease of cats. The prevalence of DM in cats in England is not well-defined. To estimate the prevalence and identify risk factors for DM in a large population of cats attending primary-care practices. A cohort of 193,563 cats in the VetCompass Programme attending 118 primary-care practices in England. Cross-sectional analysis of cohort clinical data. Data were extracted covering September 1st 2009 and August 31st 2014. Period prevalence of DM was calculated. Associations between risk factors and DM were assessed using logistic regression modelling. Of 1,128 DM cases were identified among 194,563 cats (period prevalence 0.58%; 95% confidence interval [CI] 0.54-0.61). Multivariable modelling indicated that Tonkinese (OR 4.1; 95% CI 1.8-9.6; P = .001), Norwegian Forest (odds ratio [OR] 3.5; 95% CI 1.3-9.6; P = .001) and Burmese (OR 3.0; 95% CI 2.0-4.4; P Diabetes mellitus is an important component of the primary-care practice caseload with 1-in-200 cats affected. An increased risk of DM in certain cat breeds supports a genetic predisposition. These results can guide future research and preventative healthcare. Copyright © 2016 The Authors. Journal of Veterinary Internal Medicine published by Wiley Periodicals, Inc. on behalf of the American College of Veterinary Internal Medicine.

  4. Controllable Change of Photoluminescence Spectra of Silicone Rubber Modified by 193 nm ArF Excimer Laser

    Science.gov (United States)

    Okoshi, Masayuki; Iyono, Minako; Inoue, Narumi

    2009-12-01

    Photoluminescence spectra of silicone rubber ([SiO(CH3)2]n) photochemically modified by a 193 nm ArF excimer laser was found to be controllable. Compared with the modification in air, the photoluminescence spectra could be blueshifted by the modification in vacuum or the additional irradiation of ArF excimer laser in vacuum after the modification in air. To redshift, on the other hand, the additional irradiation of a 157 nm F2 laser in air after the modification in air, the modification in oxygen gas, or the postannealing after the modification in oxygen gas was effective. The blue and redshifts of the photoluminescence were essentially due to the acceleration of reduction and oxidation reactions of silicone rubber, respectively, because the photoluminescence derives its origin from oxygen deficiency centers and peroxy centers of the silica structure in the modified silicone rubber. On the basis of the spectra changes, colorful light-guiding sheets made of silicone rubber under illumination of a 375 nm light-emitting diode were successfully fabricated for cellular phone use.

  5. Potential impacts of 40 CFR 193 on the development of low-level radioactive waste disposal facilities

    Energy Technology Data Exchange (ETDEWEB)

    Alvarado, R.A. [Texas Low-Level Radioactive Waste Disposal Authority, Austin, TX (United States)

    1989-11-01

    Since the publication of the Advanced Notice of Proposed Rulemaking in August, 1983, the proposed environmental regulations regarding low-level radioactive waste have become a serious uncertainty in the development of new low-level radioactive waste disposal facilities. The proposed rule has been discussed on several occasions by the Technical Coordinating Committee and the purpose of this paper is to present the results of the Committee`s discussions regarding the proposed rule. The proposed standard has several closely related elements. The rule would prescribe limits on radiation exposure to individuals during processing, management and storage of low-level radioactive waste. It would set BRC levels and also set dose standards for the period following site closure. An important portion of the standard, as far as developing new facilities, is the ground water protection standard. The comments received during developing of 40 CFR 193 has also led the Environmental Protection Agency to propose 40 CFR 764 governing the disposal of naturally occurring radioactive material or NORM.

  6. Forward $J/\\psi$ production in U$+$U collisions at $\\sqrt{s_{NN}}$=193 GeV

    CERN Document Server

    Adare, A; Ajitanand, N N; Akiba, Y; Akimoto, R; Alexander, J; Alfred, M; Aoki, K; Apadula, N; Asano, H; Atomssa, E T; Awes, T C; Azmoun, B; Babintsev, V; Bai, M; Bai, X; Bandara, N S; Bannier, B; Barish, K N; Bathe, S; Baublis, V; Baumann, C; Baumgart, S; Bazilevsky, A; Beaumier, M; Beckman, S; Belmont, R; Berdnikov, A; Berdnikov, Y; Black, D; Blau, D S; Bok, J S; Boyle, K; Brooks, M L; Bryslawskyj, J; Buesching, H; Bumazhnov, V; Butsyk, S; Campbell, S; Chen, C -H; Chi, C Y; Chiu, M; Choi, I J; Choi, J B; Choi, S; Christiansen, P; Chujo, T; Cianciolo, V; Citron, Z; Cole, B A; Cronin, N; Crossette, N; Csanád, M; Csörgő, T; Danley, D; Datta, A; Daugherity, M S; David, G; DeBlasio, K; Dehmelt, K; Denisov, A; Deshpande, A; Desmond, E J; Ding, L; Dion, A; Diss, P B; Do, J H; D'Orazio, L; Drapier, O; Drees, A; Drees, K A; Durham, J M; Durum, A; Engelmore, T; Enokizono, A; Esumi, S; Eyser, K O; Fadem, B; Feege, N; Fields, D E; Finger, M; Jr., \\,; Fleuret, F; Fokin, S L; Frantz, J E; Franz, A; Frawley, A D; Fukao, Y; Fusayasu, T; Gainey, K; Gal, C; Gallus, P; Garg, P; Garishvili, A; Garishvili, I; Ge, H; Giordano, F; Glenn, A; Gong, X; Gonin, M; Goto, Y; de Cassagnac, R Granier; Grau, N; Greene, S V; Perdekamp, M Grosse; Gu, Y; Gunji, T; Guragain, H; Hachiya, T; Haggerty, J S; Hahn, K I; Hamagaki, H; Hamilton, H F; Han, S Y; Hanks, J; Hasegawa, S; Haseler, T O S; Hashimoto, K; Hayano, R; He, X; Hemmick, T K; Hester, T; Hill, J C; Hollis, R S; Homma, K; Hong, B; Hoshino, T; Hotvedt, N; Huang, J; Huang, S; Ichihara, T; Ikeda, Y; Imai, K; Imazu, Y; Inaba, M; Iordanova, A; Isenhower, D; Isinhue, A; Ivanishchev, D; Jacak, B V; Jeon, S J; Jezghani, M; Jia, J; Jiang, X; Johnson, B M; Joo, K S; Jouan, D; Jumper, D S; Kamin, J; Kanda, S; Kang, B H; Kang, J H; Kang, J S; Kapustinsky, J; Kawall, D; Kazantsev, A V; Key, J A; Khachatryan, V; Khandai, P K; Khanzadeev, A; Kijima, K M; Kim, C; Kim, D J; Kim, E -J; Kim, G W; Kim, M; Kim, Y -J; Kim, Y K; Kimelman, B; Kistenev, E; Kitamura, R; Klatsky, J; Kleinjan, D; Kline, P; Koblesky, T; Kofarago, M; Komkov, B; Koster, J; Kotchetkov, D; Kotov, D; Krizek, F; Kurita, K; Kurosawa, M; Kwon, Y; Lacey, R; Lai, Y S; Lajoie, J G; Lebedev, A; Lee, D M; Lee, G H; Lee, J; Lee, K B; Lee, K S; Lee, S; Lee, S H; Leitch, M J; Leitgab, M; Lewis, B; Li, X; Lim, S H; Liu, M X; Lynch, D; Maguire, C F; Makdisi, Y I; Makek, M; Manion, A; Manko, V I; Mannel, E; Maruyama, T; McCumber, M; McGaughey, P L; McGlinchey, D; McKinney, C; Meles, A; Mendoza, M; Meredith, B; Miake, Y; Mibe, T; Mignerey, A C; Milov, A; Mishra, D K; Mitchell, J T; Miyasaka, S; Mizuno, S; Mohanty, A K; Mohapatra, S; Montuenga, P; Moon, T; Morrison, D P; Moskowitz, M; Moukhanova, T V; Murakami, T; Murata, J; Mwai, A; Nagae, T; Nagamiya, S; Nagashima, K; Nagle, J L; Nagy, M I; Nakagawa, I; Nakagomi, H; Nakamiya, Y; Nakamura, K R; Nakamura, T; Nakano, K; Nattrass, C; Netrakanti, P K; Nihashi, M; Niida, T; Nishimura, S; Nouicer, R; Novak, T; Novitzky, N; Nyanin, A S; O'Brien, E; Ogilvie, C A; Oide, H; Okada, K; Koop, J D Orjuela; Osborn, J D; Oskarsson, A; Ozawa, K; Pak, R; Pantuev, V; Papavassiliou, V; Park, I H; Park, J S; Park, S; Park, S K; Pate, S F; Patel, L; Patel, M; Peng, J -C; Perepelitsa, D V; Perera, G D N; Peressounko, D Yu; Perry, J; Petti, R; Pinkenburg, C; Pinson, R; Pisani, R P; Purschke, M L; Qu, H; Rak, J; Ramson, B J; Ravinovich, I; Read, K F; Reynolds, D; Riabov, V; Riabov, Y; Richardson, E; Rinn, T; Riveli, N; Roach, D; Rolnick, S D; Rosati, M; Rowan, Z; Rubin, J G; Ryu, M S; Sahlmueller, B; Saito, N; Sakaguchi, T; Sako, H; Samsonov, V; Sarsour, M; Sato, S; Sawada, S; Schaefer, B; Schmoll, B K; Sedgwick, K; Seele, J; Seidl, R; Sekiguchi, Y; Sen, A; Seto, R; Sett, P; Sexton, A; Sharma, D; Shaver, A; Shein, I; Shibata, T -A; Shigaki, K; Shimomura, M; Shoji, K; Shukla, P; Sickles, A; Silva, C L; Silvermyr, D; Singh, B K; Singh, C P; Singh, V; Skolnik, M; Slunečka, M; Snowball, M; Solano, S; Soltz, R A; Sondheim, W E; Sorensen, S P; Sourikova, I V; Stankus, P W; Steinberg, P; Stenlund, E; Stepanov, M; Ster, A; Stoll, S P; Stone, M R; Sugitate, T; Sukhanov, A; Sumita, T; Sun, J; Sziklai, J; Takahara, A; Taketani, A; Tanaka, Y; Tanida, K; Tannenbaum, M J; Tarafdar, S; Taranenko, A; Tennant, E; Tieulent, R; Timilsina, A; Todoroki, T; Tomášek, M; Torii, H; Towell, C L; Towell, R; Towell, R S; Tserruya, I; van Hecke, H W; Vargyas, M; Vazquez-Zambrano, E; Veicht, A; Velkovska, J; Vértesi, R; Virius, M; Vrba, V; Vznuzdaev, E; Wang, X R; Watanabe, D; Watanabe, K; Watanabe, Y; Watanabe, Y S; Wei, F; Whitaker, S; White, A S; Wolin, S; Woody, C L; Wysocki, M; Xia, B; Xue, L; Yalcin, S; Yamaguchi, Y L; Yanovich, A; Yokkaichi, S; Yoo, J H; Yoon, I; You, Z; Younus, I; Yu, H; Yushmanov, I E; Zajc, W A; Zelenski, A; Zhou, S; Zou, L

    2015-01-01

    The invariant yields for $J/\\psi$ production at forward rapidity $(1.2<|y|<2.2)$ in U$+$U collisions at $\\sqrt{s_{_{NN}}}$=193 GeV have been measured as a function of collision centrality. The invariant yields and nuclear-modification factor $R_{AA}$ are presented and compared with those from Au$+$Au collisions in the same rapidity range. Additionally, the direct ratio of the invariant yields from U$+$U and Au$+$Au collisions within the same centrality class is presented, and used to investigate the role of $c\\bar{c}$ coalescence. Two different parameterizations of the deformed Woods-Saxon distribution were used in Glauber calculations to determine the values of the number of nucleon-nucleon collisions in each centrality class, $N_{\\rm coll}$, and these were found to give significantly different $N_{\\rm coll}$ values. Results using $N_{\\rm coll}$ values from both deformed Woods-Saxon distributions are presented. The measured ratios show that the $J/\\psi$ suppression, relative to binary collision scaling...

  7. Study of (n,2n reaction on 191,193Ir isotopes and isomeric cross section ratios

    Directory of Open Access Journals (Sweden)

    Vlastou R.

    2017-01-01

    Full Text Available The cross section of 191Ir(n,2n190Irg+m1 and 191Ir(n,2n190Irm2 reactions has been measured at 17.1 and 20.9 MeV neutron energies at the 5.5 MV tandem T11/25 Accelerator Laboratory of NCSR “Demokritos”, using the activation method. The neutron beams were produced by means of the 3H(d,n4He reaction at a flux of the order of 2 × 105 n/cm2s. The neutron flux has been deduced implementing the 27Al(n,α reaction, while the flux variation of the neutron beam was monitored by using a BF3 detector. The 193Ir(n,2n192Ir reaction cross section has also been determined, taking into account the contribution from the contaminant 191Ir(n,γ192Ir reaction. The correction method is based on the existing data in ENDF for the contaminant reaction, convoluted with the neutron spectra which have been extensively studied by means of simulations using the NeusDesc and MCNP codes. Statistical model calculations using the code EMPIRE 3.2.2 and taking into account pre-equilibrium emission, have been performed on the data measured in this work as well as on data reported in literature.

  8. Pages 193 - 197.pmd

    African Journals Online (AJOL)

    Administrator

    Results: Age >60 years, female sex, presence of diabetic retinopathy (DR), proliferative DR, shorter DM duration, glaucoma, macular ... Conclusion: The risk of visual disability is 4 times higher in patients with diabetic retinopathy and 2 times higher in females with DM. ..... patients. Oxidative stress may accelerate DR and.

  9. Pages 193 - 197.pmd

    African Journals Online (AJOL)

    Administrator

    cataracts, macular degeneration and glaucoma)4. The same situation is shown in emerging economic areas5,6. In sub-Saharan Africa (SSA) however, the issues of visual disability due to Diabetes Mellitus. (DM) are overshadowed by the ...

  10. Strangeness production in Ni+Ni collisions at 1.93 AGeV; Production d'etrangete dans les collisions Ni+Ni a 1.93 AGeV

    Energy Technology Data Exchange (ETDEWEB)

    Lopez, X

    2004-12-15

    This work deals with the production of strange particles in Ni + Ni collisions at 1.93 A GeV detected with the Fopi (four pi) detector at the heavy ion synchrotron SIS (GSI - Germany). We have limited our investigation to the study of {lambda} and {xi} hyperons. The first chapter presents the models used to describe ultra-relativistic heavy ions collisions. In the second chapter we present the main experimental results concerning the production and transport of strange particles in an energy domain ranging from SIS to RHIC (relativistic heavy ion collider) energies. The third chapter is dedicated to the specificities of the Fopi detector. The fourth chapter deals with the production of {lambda} particles in Ni + Ni collisions. An analysis method based on neuron network has been used in parallel with a more classical method. The production rate and temperature of {lambda} have been deduced from both methods. The neuron network method gives a statistical gain and allows a better identification of particles with low transverse impulses. The fifth chapter is dedicated to the detection of the doubly strange {xi}{sup -} particle. A detailed study about the stability of the signal is presented. In the last chapter all our experimental results are confronted with theoretical predictions. The UrQMD model that uses a hard equation of state, can simulate satisfactorily the production rates of {lambda} and K{sup +} as well as their dependency on collision centrality despite the fact that this model does not use a potential linked to the medium density. The comparison between experimental results and predictions given by the IQMD model (that is based on a soft equation of state) is better when the version of the model that does not take into account the effects of the media is used. We see that the choices for the nuclear matter compressibility, for the particles involved in Kaon and {lambda} creation process, or for the interaction potential with dense medium, appear to be

  11. Clinical significance of miR-140-5p and miR-193b expression in patients with breast cancer and relationship to IGFBP5

    Directory of Open Access Journals (Sweden)

    Gökçe Güllü

    2015-03-01

    Full Text Available The functional role of IGFBP5 in breast cancer is complicated. Experimental and bioinformatics studies have shown that IGFBP5 is targeted by miR-140-5p and miR-193b, although this has not yet been proven in clinical samples. The aim of this study was to evaluate the expression of miR-140-5p and miR-193b in breast cancer and adjacent normal tissue and assess its correlation with IGFBP5 and the clinicopathological characteristics of the tumors. IGFBP5 protein expression was analyzed immunohistochemically and IGFBP5, miR-140 and miR-193b mRNA expression levels were analyzed with real-time RT-PCR. Tumor tissue had higher miR-140-5p expression than adjacent normal tissue (p = 0.015. Samples with no immunohistochemical staining for IGFBP5 showed increased miR-140-5p expression (p = 0.009. miR-140-5p expression was elevated in invasive ductal carcinomas (p = 0.002, whereas basal-like tumors had decreased expression of miR-140-5p compared to other tumors (p = 0.008. Lymph node-positive samples showed an approximately 13-fold increase in miR-140-5p expression compared to lymph node-negative tissue (p = 0.049. These findings suggest that miR-140-5p, but not miR-193b, could be an important determinant of IGFBP5 expression and clinical phenotype in breast cancer patients. Further studies are needed to clarify the expressional regulation of IGFBP5 by miR-140-5p.

  12. Infection of chickens with antimicrobial-resistant Salmonella enterica Typhimurium DT193 and monophasic Salmonella Typhimurium-like variants: an emerging risk to the poultry industry?

    Science.gov (United States)

    Parsons, B N; Crayford, G; Humphrey, T J; Wigley, P

    2013-01-01

    Antimicrobial-resistant Salmonella enterica poses a particular risk to public health, and in particular isolates belonging to clonal lineages such as Salmonella Typhimurium DT104 cause epidemics across species including poultry. In recent years, antimicrobial-resistant S. Typhimurium DT193 and specifically the monophasic S. Typhimurium-like variants of this phage type, serotypes 4,12:i:- and 4,5,12:i:-, have become an increasing risk to public health in Europe and the USA and now account for nearly one-half of human S. Typhimurium infections in the UK. Unlike S. Typhimurium that possesses two forms of flagella which can vary between phase 1 and phase 2 during infection, monophasic variants possess only phase 1 flagella. These monophasic antimicrobial-resistant variants have become a major problem in pig production but human cases have also been associated with poultry consumption and have been found in UK flocks through surveillance schemes since 2010. In this study we determined the ability of antimicrobial-resistant DT193 serotype 4,12:i:- and 4,5,12:i:- isolates from pigs to infect chickens. All isolates were found to colonize the caeca and liver. All but one isolate of serotype 4,5,12:i:- also infected the spleen. Levels of infection and pathology were comparable with those found with the virulent S. Typhimurium isolate 4/74. These findings indicate that both S. Typhimurium DT193 and monophasic variants of this phage type usually associated with pigs are capable of colonizing the chicken. This shows that both S. Typhimurium DT193 and monophasic variants represent a significant and potential emerging threat to poultry production from "spill-over" of these isolates from the pig industry or other sources.

  13. Point mutation in the NF2 gene of HEI-193 human schwannoma cells results in the expression of a merlin isoform with attenuated growth suppressive activity

    Energy Technology Data Exchange (ETDEWEB)

    Lepont, Pierig; Stickney, John T.; Foster, Lauren A.; Meng, Jin-Jun; Hennigan, Robert F. [Department of Cell and Cancer Biology, Vontz Center for Molecular Studies, University of Cincinnati College of Medicine, 3125 Eden Avenue, Cincinnati, OH 45267-0521 (United States); Ip, Wallace [Department of Cell and Cancer Biology, Vontz Center for Molecular Studies, University of Cincinnati College of Medicine, 3125 Eden Avenue, Cincinnati, OH 45267-0521 (United States)], E-mail: wallace.ip@uc.edu

    2008-01-01

    Neurofibromatosis type 2 (NF2) is a genetic disorder characterized by the formation of bilateral schwannomas of the eighth cranial nerve. Although the protein product of the NF2 gene (merlin) is a classical tumor suppressor, the mechanism by which merlin suppresses cell proliferation is not fully understood. The availability of isolated tumor cells would facilitate a better understanding of the molecular function of merlin, but primary schwannoma cells obtained from patients grow slowly and do not yield adequate numbers for biochemical analysis. In this study, we have examined the NF2 mutation in HEI-193 cells, an immortalized cell line derived from the schwannoma of an NF2 patient. Previous work showed that the NF2 mutation in HEI-193 cells causes a splicing defect in the NF2 transcript. We have confirmed this result and further identified the resultant protein product as an isoform of merlin previously designated as isoform 3. The level of isoform 3 proteins in HEI-193 cells is comparable to the levels of merlin isoforms 1 and 2 in normal human Schwann cells and several other immortalized cell lines. In contrast to many mutant forms of merlin, isoform 3 is as resistant to proteasomal degradation as isoforms 1 and 2 and can interact with each of these isoforms in vivo. Cell proliferation assays showed that, in NF2{sup -/-} mouse embryonic fibroblasts, exogenously expressed merlin isoform 3 does exhibit growth suppressive activity although it is significantly lower than that of identically expressed merlin isoform 1. These results indicate that, although HEI-193 cells have undetectable levels of merlin isoforms 1 and 2, they are, in fact, not a merlin-null model because they express the moderately active growth suppressive merlin isoform 3.

  14. Polymorphisms of Tumor Necrosis Factor Alpha in Moroccan Patients with Gastric Pathology: New Single-Nucleotide Polymorphisms in TNF-α−193 (G/A

    Directory of Open Access Journals (Sweden)

    A. Essadik

    2015-01-01

    Full Text Available Polymorphisms in tumor necrosis factor alpha (TNF-α gene are emerging as key determinants of gastric diseases. The TNF-α−308 (G/A and TNF-α−238 (G/A single-nucleotide polymorphisms SNPs are the most extensively studied. However, all these studies are conducted in Caucasian and Asian populations. Thus, for the first time in Africa, we sought to investigate whether polymorphisms in TNF-α gene were associated with the development of gastric pathology in Morocco. Two SNPs located in the promoter region (positions −308 and −238 in TNF-α gene were genotyped in 244 individuals (170 patients and 74 healthy controls. Odds ratios (ORs and 95% confidence intervals (CI were estimated using logistic regression analysis. The TNF-α−238 (G/A genotype was significantly associated with a high risk of gastritis and gastric cancer (GC (P=0.001 and P=0.002, resp.. Furthermore, a new polymorphism located in the promoter region at position −193 in TNF-α gene was identified. The distribution of this SNP was markedly different in patients suffering from ulcers. The association between TNF-α−193 (G/A genotype and high risk of ulcer was significant (P=0.03. These results suggest that the TNF-α−193 (G/A allele has a protective function against gastric cancer by developing ulcer.

  15. Neonatal mortality levels for 193 countries in 2009 with trends since 1990: a systematic analysis of progress, projections, and priorities.

    Directory of Open Access Journals (Sweden)

    Mikkel Zahle Oestergaard

    2011-08-01

    Full Text Available BACKGROUND: Historically, the main focus of studies of childhood mortality has been the infant and under-five mortality rates. Neonatal mortality (deaths <28 days of age has received limited attention, although such deaths account for about 41% of all child deaths. To better assess progress, we developed annual estimates for neonatal mortality rates (NMRs and neonatal deaths for 193 countries for the period 1990-2009 with forecasts into the future. METHODS AND FINDINGS: We compiled a database of mortality in neonates and children (<5 years comprising 3,551 country-years of information. Reliable civil registration data from 1990 to 2009 were available for 38 countries. A statistical model was developed to estimate NMRs for the remaining 155 countries, 17 of which had no national data. Country consultation was undertaken to identify data inputs and review estimates. In 2009, an estimated 3.3 million babies died in the first month of life-compared with 4.6 million neonatal deaths in 1990-and more than half of all neonatal deaths occurred in five countries of the world (44% of global livebirths: India 27.8% (19.6% of global livebirths, Nigeria 7.2% (4.5%, Pakistan 6.9% (4.0%, China 6.4% (13.4%, and Democratic Republic of the Congo 4.6% (2.1%. Between 1990 and 2009, the global NMR declined by 28% from 33.2 deaths per 1,000 livebirths to 23.9. The proportion of child deaths that are in the neonatal period increased in all regions of the world, and globally is now 41%. While NMRs were halved in some regions of the world, Africa's NMR only dropped 17.6% (43.6 to 35.9. CONCLUSIONS: Neonatal mortality has declined in all world regions. Progress has been slowest in the regions with high NMRs. Global health programs need to address neonatal deaths more effectively if Millennium Development Goal 4 (two-thirds reduction in child mortality is to be achieved.

  16. Ultraviolet photochemistry of trichlorovinylsilane and allyltrichlorosilane: vinyl radical (HCCH2) and allyl radical (H2CCHCH2) production in 193 nm photolysis.

    Science.gov (United States)

    DeSain, John D; Jusinski, Leonard E; Taatjes, Craig A

    2006-05-21

    The absolute gas phase ultraviolet absorption spectra of trichlorovinylsilane and allyltrichlorosilane have been measured from 191 to 220 nm. Over this region the absorption spectra of both species are broad and relatively featureless, and their cross sections increase with decreasing wavelength. The electronic transitions of trichlorovinylsilane were calculated by ab initio quantum chemical methods and the observed absorption bands assigned to the A(1)A''<-- X[combining tilde](1)A'' transition. The maximum absorption cross section in the region, at 191 nm, is sigma = (8.50 +/- 0.06) x 10(-18) cm(2) for trichlorovinylsilane and sigma = (2.10 +/- 0.02) x 10(-17) cm(2) for allyltrichlorosilane. The vinyl radical and the allyl radical are formed promptly from the 193 nm photolysis of their respective trichlorosilane precursors. By comparison of the transient visible absorption and the 1315 nm I atom absorption from 266 nm photolysis of vinyl iodide and allyl iodide, the absorption cross sections at 404 nm of vinyl radical ((2.9 +/- 0.4) x 10(-19) cm(2)) and allyl radical ((3.6 +/- 0.8) x 10(-19) cm(2)) were derived. These cross sections are in significant disagreement with literature values derived from kinetic modeling of allyl or vinyl radical self-reactions. Using these cross sections, the vinyl radical yield from trichlorovinylsilane was determined to be phi = (0.9 +/- 0.2) per 193 nm photon absorbed, and the allyl radical yield from allyltrichlorosilane phi = (0.7 +/- 0.2) per 193 nm photon absorbed.

  17. Production of isomers by neutron-induced inelastic scattering on 193Ir and influence of spin distribution in the pre-equilibrium process

    Science.gov (United States)

    Kawano, Toshihiko; Talou, Patrick; Chadwick, Mark B.

    2006-06-01

    We present calculations of the production cross-section of isomeric-state for 193Ir. The isomer was produced by neutron inelastic scattering, and several γ-ray production cross-sections were measured at LANSCE with the GEANIE detector. The total isomer production cross-section is then inferred by combining the experimental data with the GNASH statistical model calculations. The spin distribution is calculated with the Feshbach-Kerman-Koonin (FKK) quantum mechanical pre-equilibrium theory, and it is incorporated with the GNASH results. We found that the inclusion of FKK has a significant impact on the isomer production cross-sections at high energies.

  18. Production of isomers by neutron-induced inelastic scattering on {sup 193}Ir and influence of spin distribution in the pre-equilibrium process

    Energy Technology Data Exchange (ETDEWEB)

    Kawano, Toshihiko [Los Alamos National Laboratory, NM 87545 (United States)]. E-mail: kawano@lanl.gov; Talou, Patrick [Los Alamos National Laboratory, NM 87545 (United States); Chadwick, Mark B. [Los Alamos National Laboratory, NM 87545 (United States)

    2006-06-23

    We present calculations of the production cross-section of isomeric-state for {sup 193}Ir. The isomer was produced by neutron inelastic scattering, and several {gamma}-ray production cross-sections were measured at LANSCE with the GEANIE detector. The total isomer production cross-section is then inferred by combining the experimental data with the GNASH statistical model calculations. The spin distribution is calculated with the Feshbach-Kerman-Koonin (FKK) quantum mechanical pre-equilibrium theory, and it is incorporated with the GNASH results. We found that the inclusion of FKK has a significant impact on the isomer production cross-sections at high energies.

  19. Synthesis of Narrow Molecular Weight Distribution Norbornene-Lactone Functionalized Polymers by Nitroxide-Mediated Polymerization: Candidates for 193-nm Photoresist Materials

    Directory of Open Access Journals (Sweden)

    Zi Jun Wang

    2014-02-01

    Full Text Available One hundred ninety three-nanometer candidate photoresist materials were synthesized by nitroxide-mediated polymerization (NMP. Statistical copolymerizations of 5-methacryloyloxy-2,6-norboranecarbolactone (NLAM with 5–10 mol% of controlling co-monomers (which are necessary for controlled polymerizations of methacrylates by NMP with the initiator used in the feed, such as styrene (ST, p-acetoxystyrene (AcOST, 2-vinyl naphthalene (VN and pentafluorostyrene (PFS, using the unimolecular BlocBuilder® initiator in 35 wt% dioxane solution at 90 °C were performed. As little as 5 mol% controlling comonomer in the feed was demonstrated to be sufficient to lead to linear evolution of number average molecular weight  with respect to conversion up to 50%, and the resulting copolymers had dispersities  of ~1.3 in most cases, an attractive feature for reducing line width roughness (LWR in photoresists. The copolymers generally showed relatively low absorbance at 193 nm, comparable to other 193-nm candidate photoresists reported previously, despite the inclusion of a small amount of the styrenic co-monomers in the copolymer.

  20. INFRACŢIUNI CONTRA PATRIMONIULUI, SĂVÂRŞITE ÎN LIPSA UNUI SCOP SPECIAL (art.193, 197 şi 199 CP RM: ASPECTE TEORETICE ŞI PRACTICE

    Directory of Open Access Journals (Sweden)

    Sergiu BRÎNZA

    2016-03-01

    Full Text Available Prezentul articol este dedicat analizei juridico-penale a infracţiunilor contra patrimoniului, săvârşite în lipsa unui scop special. Acestea sunt prevăzute la art.193, 197 şi 199 CP RM. Sunt examinate elementele constitutive (obiectul, latura obiectivă, latura subiectivă şi subiectul, precum şi elementele circumstanţiale agravante ale infracţiunilor în cauză. Sunt propuse criterii de delimitare a infracţiunilor specificate la art.193, 197 şi 199 CP RM de faptele conexe de factură penală sau nepenală. Regulile de calificare a faptelor conform acestor articole, precum şi procedeele de interpretare a art.193, 197 şi 199 CP RM, urmăresc scopul eficientizării aplicării răspunderii pentru faptele infracţionale corespunzătoare. OFFENCES AGAINST PATRIMONY, COMMITED IN THE ABSENCE OF A SPECIAL PURPOSE (art.193, 197 and 199 PC RM: THEORETICAL AND PRACTICAL ASPECTSThis article is dedicated to the legal-penal analysis of the offences against patrimony, committed in the absence of a special purpose. The offences mentioned above are included in art.193, 197 and 199 PC RM; there are examined the constituents (the object, objective side, subjective side and the subject, as well as the circumstantial aggravating elements of the offences in question. There are also proposed delimitation criteria of the offences specified at art.193, 197 and 199 PC RM from the ancillary penal or non-penal acts. The rules of qualification of the acts under these articles, including the methods of interpretation of art.193, 197 and 199 PC RM, aim to streamline the application of penal liability for the appropriate criminal acts. 

  1. Chemonuclear studies for identification for new production routes for the therapeutically useful radionuclides {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt, und {sup 195m}Pt; Kernchemische Studien zur Entwicklung neuerer Produktionsverfahren fuer die therapierelevanten Radionuklide {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt, und {sup 195m}Pt

    Energy Technology Data Exchange (ETDEWEB)

    Hilgers, K.

    2005-12-15

    New production routes for the therapeutically useful radionuclides {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt and {sup 195m}Pt were investigated. Cross section data were measured using the stacked-foil technique and compared with theoretical calculations. A production method for the platinum nuclides was developed. The {sup 141}Pr(p, 2n){sup 140}Nd and {sup nat}Ce({sup 3}He, xn){sup 140}Nd reactions were investigated for production of {sup 140}Nd. Cross section data of nuclear reactions leading to the side products {sup 141}Nd, {sup 139}Nd and {sup 139}Ce could also be achieved. The experimental data were compared with theoretical calculations using the code ALICE-IPPE. A comparison of the calculated thick target yields showed that the {sup 141}Pr(p, 2n){sup 140}Nd reaction gives a higher yield. The {sup 192}Os(p, n){sup 192}Ir reaction was examined in the context of the production of {sup 192}Ir. Cross section data were determined and compared with theoretical calculations using the codes ALICE-IPPE and EMPIRE II. The yield of this reaction was compared with the yield of the reactor production of this nuclide. The reactor production seems to be more suitable because of a higher purity and yield. Cross section data were measured for the {sup 192}Os({alpha}, n){sup 195m}Pt, {sup 192}Os({alpha}, 3n){sup 193m}Pt and {sup 192}Os({sup 3}He, 4n){sup 191}Pt reactions. The activity of {sup 193m}Pt and {sup 195m}Pt was determined by X-ray spectroscopy after a chemical separation procedure. The ALICE-IPPE code was found to be inappropriate to reproduce the experimental values. The calculated yields were compared with the yields of other reactions, especially the reactor production of {sup 195m}Pt. The yield of the {sup 192}Os({alpha}, n){sup 195m}Pt reaction is lower compared to the yield of the reactor production, but offers lower target costs and higher specific activity. A production method for {sup 193m}Pt and {sup 195m}Pt was developed. Batch yields of 0.9 MBq

  2. Cl2O photochemistry: ultraviolet/vis absorption spectrum temperature dependence and O(3P) quantum yield at 193 and 248 nm.

    Science.gov (United States)

    Papanastasiou, Dimitrios K; Feierabend, Karl J; Burkholder, James B

    2011-05-28

    The photochemistry of Cl(2)O (dichlorine monoxide) was studied using measurements of its UV/vis absorption spectrum temperature dependence and the O((3)P) atom quantum yield, Φ(Cl(2)O)(O)(λ), in its photolysis at 193 and 248 nm. The Cl(2)O UV/vis absorption spectrum was measured over the temperature range 201-296 K between 200 and 500 nm using diode array spectroscopy. Cl(2)O absorption cross sections, σ(Cl(2)O)(λ,T), at temperatures <296 K were determined relative to its well established room temperature values. A wavelength and temperature dependent parameterization of the Cl(2)O spectrum using the sum of six Gaussian functions, which empirically represent transitions from the ground (1)A(1) electronic state to excited states, is presented. The Gaussian functions are found to correlate well with published theoretically calculated vertical excitation energies. O((3)P) quantum yields in the photolysis of Cl(2)O at 193 and 248 nm were measured using pulsed laser photolysis combined with atomic resonance fluorescence detection of O((3)P) atoms. O((3)P) quantum yields were measured to be 0.85 ± 0.15 for 193 nm photolysis at 296 K and 0.20 ± 0.03 at 248 nm, which was also found to be independent of temperature (220-352 K) and pressure (17 and 28 Torr, N(2)). The quoted uncertainties are at the 2σ (95% confidence) level and include estimated systematic errors. ClO radical temporal profiles obtained following the photolysis of Cl(2)O at 248 nm, as reported previously in Feierabend et al. [J. Phys. Chem. A 114, 12052, (2010)], were interpreted to establish a <5% upper-limit for the O + Cl(2) photodissociation channel, which indicates that O((3)P) is primarily formed in the three-body, O + 2Cl, photodissociation channel at 248 nm. The analysis also indirectly provided a Cl atom quantum yield of 1.2 ± 0.1 at 248 nm. The results from this work are compared with previous studies where possible. © 2011 American Institute of Physics

  3. A thin FinFET Si-fin body structure fabricated with 193-nm scanner photolithography and composite hard mask etching technique upon bulk-Si substrate

    Science.gov (United States)

    Liao, Wen-Shiang; Liu, Yu-Huan; Chang, Wen-Tung; Chen, Tung-Hung; Shih, Tommy; Tsen, Huan-Chiu; Chung, Lee

    2007-03-01

    A thin FinFET bulk Si-fin body structure has been successfully fabricated upon bulk-Si wafers through using 193nm scanner lithography and a composite hard mask etching technique. First, a 100Å-thick buffer SiO II layer was thermally grown upon the bulk silicon layer and subsequently a 1200Å-thick SiN x layer and a 1000Å-thick TEOS SiO II hard mask layer was chemically vapor deposited to form a composite hard mask structure of buffer-SiO II/SiN x/TEOS. Second, both 1050Å-thick BARC and 2650Å-thick photoresist (P/R) were coated and a 193nm scanner lithography tool was used for the Si-fin body layout patterning under relatively high exposure energy. This achieves the ADI (after develop inspection) of 80nm from the original as-drawn Si-fin layout of 110nm. Then, a deep sub-micron plasma etcher was used for an aggressive P/R and BARC trimming down processing and both the capping TEOS and CVD-SiN x with its underlying buffer oxide layers were subsequently etched in other etching plasma chambers, respectively. Resultantly, the AMI (after mask inspection) can reach 60nm. Subsequently, both the P/R and BARC were removed with a nominal plasma ashing as well as a RCA cleaning for the final sub-micron Si-fin plasma etching. Eventually, a 60nm-width and 400nm-height bulk Si-fin body structure can be successfully etched out after a fixed time-mode silicon plasma etching.

  4. Demethylation of miR-9-3 and miR-193a Genes Suppresses Proliferation and Promotes Apoptosis in Non-Small Cell Lung Cancer Cell Lines

    Directory of Open Access Journals (Sweden)

    Jinliang Wang

    2013-12-01

    Full Text Available Background: MicroRNAs miR-9-3 and miR-193a have recently been found to be hypermethylated in a variety of non-small cell lung cancer (NSCLC cells and primary human tumors. The objectives of this study were to investigate the role of demethylation of miR-9-3 and miR-193a genes in regulating proliferation and apoptosis in NSCLCs, and to decipher the potential mechanisms underlying the properties. Methods: MTT and population doubling time by flow cytometry were used to assess cell proliferation. Enzyme-Linked Immunosorbent Assay and caspase-3 activity assay were employed to evaluate apoptosis. Real-time RT-PCR and Western blot were used to quantify gene expression at mRNA and protein levels, respectively. Methylation-specific PCR was utilized to assess methylation status. Results: We found that demethylation agent 5-Aza-2'-deoxycytidine (5-AzaC reduced cell numbers and prolonged population doubling time (PDT, and promoted doxorubicin-induced apoptosis in seven NSCLC cell lines with different methylation statuses on miR-9-3 and miR-193a promoter regions: NCI-H1993/NCI-H1915 (miR-9-3+/miR-193a+, NCI-H1975/NCI-H200 (miR-9-3+/miR-193a-, A427/NCI-H2073 (miR-9-3-/miR-193a+, and NCI-H1703 (miR-9-3-/miR-193a-. Treatment with 5-AzaC concomitantly upregulated expression of miR-9-3 and miR-193a, and downregulated their respective target genes NF-κB and Mcl-1. The effects of 5-AzaC were abolished by concomitant knockdown of miR-9-3 and miR-193a using the complex antisense technique, whereas forced ectopic expression of miR-9-3 and miR-193a mimicked the effects of 5-AzaC. We further observed that the strength of proliferation inhibition and apoptosis promotion elicited by 5-AzaC was in the order of NCI-H1993/NCI-H1915 > A427/NCI-H2073 > NCI-H1975/NCI-H200 > NCI-H1703. Conclusions: Methylation-silencing of miR-9-3 and miR-193a may be an important epigenetic mechanisms favoring NSCLC cell growth and survival for carcinogenesis and cancer progression, and

  5. Fast neutron capture cross sections of /sup 169/Tm, /sup 191/Ir, /sup 193/Ir, and /sup 175/Lu for 3 less than or equal to E/sub n/ less than or equal to 2000 keV

    Energy Technology Data Exchange (ETDEWEB)

    Macklin, R.L.; Drake, D.M.; Malanify, J.J.

    1977-11-01

    Fast neutron capture cross sections of /sup 169/Tm, /sup 191/Ir, /sup 193/Ir, and /sup 175/Lu, and the /sup 6/Li(n,..cap alpha..)/sup 3/H cross sections to which they are normalized are presented in tabular form for neutron energies between 3 and 2000 keV.

  6. The Environmental Protection Agency`s proposed regulation of low level radioactive waste (40 CFR Part 193): A Department of Energy overview

    Energy Technology Data Exchange (ETDEWEB)

    Frangos, T.G. [Dept. of Energy, Washington, DC (United States)

    1989-11-01

    The Department of Energy (DOE) manages one of the world`s largest programs for storage, treatment, and disposal of low-level radioactive wastes. This system with facilities located at sites across the nation has evolved over some forty years in response to changing needs, technologies, and increasing public awareness and concerns for environmental protection. The DOE has operated in a self regulatory mode in most aspects of its low-level waste (LLW) programs. It has been DOE`s policy and practice to provide at least the same level of safety and protection for the public, DOE and contractor employees, and the general environment, as that required by the Nuclear Regulatory Commission for commercial operations. DOE`s policies have been implemented through a management system that historically has been highly decentralized so as to be responsive to the needs of DOE sites which generate a wide variety of wastes at some 25 locations. In addition to concerns with the LLW that it manages, DOE has an interest in the US Environmental Protection Agency`s (EPA) promulgation of 40 CFR Part 193 because of its responsibilities under the Low Level Radioactive Waste Policy Amendments Act (LLRWPAA) to manage certain classes of waste and to assist and encourage the development of interstate compact-managed regional low-level waste disposal sites.

  7. A high aspect ratio Si-fin FinFET fabricated with 193nm scanner photolithography and thermal oxide hard mask etching techniques

    Science.gov (United States)

    Liao, Wen-Shiang

    2006-03-01

    A vertical double gate (FinFET) devices with a high Si-fin aspect ratio of height/width (H/W) = 87nm/11nm have been successfully fabricated on SOI wafers. Firstly, a 50nm-thick capping oxide layer was thermally grown upon the SOI crystalline silicon layer. Secondly, both 105nm-thick BARC and 265nm-thick photoresist were coated and a 193nm scanner lithography tool was used for the Si-fin layout patterning under high ASML exposure energy. Then, a deep sub-micron plasma etcher was used for an aggressive photoresist and BARC trimming down processing and the Si-fin capping oxide layer was subsequently plasma etched in another etching chamber without breaking the plasma etcher's loadlock vacuum. Continuously, the photoresist and BARC were removed with a plasma ashing and a RCA cleaning. Also, the patterned Si-fin capping oxide can be further trimmed down with an additional DHF cleaning and the remained ~22nm-thick capping oxide was still thick enough to act as a robust hard mask for the subsequent Si-fin plasma etching. Finally, an ultra thin Si-fin width 11nm and Si-fin height of 87nm can be successfully fabricated through the last silcon plasma etching.

  8. Update on the in vitro activity of daptomycin tested against 17,193 Gram-positive bacteria isolated from European medical centers (2005-2007).

    Science.gov (United States)

    Sader, H S; Moet, G; Jones, R N

    2009-11-01

    The antimicrobial susceptibility patterns of 17,193 Gram-positive isolates consecutively collected from 28 medical centers in 12 countries in europe and israel in 2005-2007 were evaluated by Clinical and laboratory Standards institute (CLSI) broth microdilution methods supplemented with calcium to 50 mg/l for testing daptomycin. Overall, the rate of methicillin-resistant Staphylococcus aureus (MRSA) was 28.3%, varying from 32.3% in 2005 to 27.1% in 2006 and 28.5% in 2007. Vancomycin resistance rates were 0.8% and 21.5% among Enterococcus faecalis and E. faecium, respectively. Among E. faecium, vancomycin resistance increased from 17.9% in 2005 to 26.3% in 2007, and varied from 0.0% in Spain, Sweden and Switzerland to as high as 54.6% in ireland for 2007. All isolates tested, except for seven CoNS (0.2%; 3,234 tested) were considered susceptible to daptomycin using breakpoints established by the United States food and Drug Administration, the CLSI and the EUCAST. Daptomycin was very active against all Gram-positive species with the highest minimum inhibitory concentration (MIC) results being 1, 4, 2 and 4 mg/l for S. aureus, coagulase-negative staphylococci, E. faecalis and E. faecium, respectively. Daptomycin activity was not adversely influenced by resistance to oxacillin among staphylococci or to vancomycin among enterococci.

  9. Search and analysis of superdeformed and oblate states in {sup 193}Pb nucleus with the EUROGAM II multidetector array; Recherche et analyse des etats superdeformes et aplatis dans le noyau {sup 193}Pb a l'aide du multidetecteur EUROGAM II

    Energy Technology Data Exchange (ETDEWEB)

    Ducroux, L. [Lyon-1 Univ., 69 - Villeurbanne (France). Inst. de Physique Nucleaire]|[Universite Claude Bernard, 69 - Lyon (France)

    1997-01-09

    This work is devoted to the search and analysis of superdeformed and oblate states in {sup 193}Pb nucleus. High spin states of this isotope, populated via fusion-evaporation reaction {sup 168}Er ({sup 30}Si, 5n) {sup 193}Pb, have been studied with the EUROGAM II {gamma} multidetector array located near the VIVITRON accelerator in Strasbourg. New sorting and analysis programs have been developed in particular related to the background treatment. Angular distribution and linear polarisation analysis allowed us to assign the {gamma} transition multipolarities. Five dipole bands, corresponding to a weakly oblate-deformed shape of the nucleus, have been observed and connected to the low-lying states. The level scheme has been considerably extended up to a spin of 61/2 {Dirac_h} and an excitation energy of about 8 MeV. These structures have been interpreted as based on a high-K two-quasi-proton excitation coupled to rotation aligned quasi-neutrons. Six superdeformed bands, corresponding to a high prolate-deformed shape of the nucleus, have been observed. These six bands have been interpreted as three pairs of signature partners based on quasineutron excitations. The extraction of the g-factor of a K=9/2 neutron superdeformed orbital has been done for the first time in lead isotopes, giving access to the magnetic properties of the extreme nuclear matter. All these results have been discussed in terms of microscopic mean field self-consistent Hartree-Fock calculations using the microscopic 'rotor + particle(s)' model. (author)

  10. High-efficient discharge-pumped ArF (193 nm) excimer laser with a TPI thyratron as a high-voltage switch

    Science.gov (United States)

    Razhev, Alexander M.; Zhupikov, Andrey A.; Churkin, Dmitry S.

    2007-06-01

    The results of using the thyratron of the TPI series (pseudo spark gap) as a high-voltage switch in the excitation system of ArF (193 nm) excimer laser are presented. The excitation system of the LC-inverter type based on TPI 10k/20 thyratron in absence of any non-linear elements was developed. An experimental investigation of the energy and temporal parameters of the pumping and lasing for ArF laser on the He:Ar:F II mixture with excitation system developed was carried out. The comparative analysis of the ArF laser pumping and radiation parameters in dependence of the high-voltage switch type such as a standard spark gap RU-65, and thyratron TPI 10k/20 was performed. The output radiation energy for a laser with thyratron TPI 10k/20 was obtained to be of 1.4 times higher than that with standard spark gap RU-65 at the same pumping conditions. Such increase the output energy was shown to be achieving owing to higher level of the pumping intensity due to higher voltage on the discharge gap that occurs due to lower energy losses into TPI thyratron in comparison with the RU- 65 spark gap and leads to more efficient energy transfer from storage to discharge circuit. As a result for ArF laser with TPI thyratron in He:Ar:F II mixture the output radiation energy of 1.0 J with the total efficiency of 1.7% has been achieved. The advantages of using the TPI thyratron in the excitation system of the ArF excimer laser over spark gap are described.

  11. FEM for modelling 193 nm excimer laser treatment of SiO{sub 2}/Si/Si{sub (1-x)}Ge{sub x} heterostructures on SOI substrates

    Energy Technology Data Exchange (ETDEWEB)

    Conde, J.C.; Chiussi, S.; Gontad, F.; Gonzalez, P. [Dpto. Fisica Aplicada, E.T.S.I.I. University of Vigo, Campus Universitario, Rua Maxwell s/n, 36310 Vigo (Spain); Martin, E. [Dpto. de Mecanica, Maquinas, Motores Termicos y Fluidos, E.T.S.I.I. University of Vigo, Campus Universitario, Rua Maxwell s/n, 36310 Vigo (Spain)

    2011-03-15

    Research on epitaxial crystalline silicon (c-Si) and silicon-germanium (Si{sub 1-x}Ge{sub x}) alloys growth and annealing for microelectronic purposes, such as Micro- or Nano-Electro-Mechanical Systems (MEMS or NEMS) and Silicon-On-Nothing (SON) devices is continuously in progress. Laser assisted annealing techniques using commercial ArF Excimer Laser sources are based on ultra-rapid heating and cooling cycles induced by the 193 nm pulses of 20 ns, which are absorbed in the near surface region of the heterostructures. During and after the absorption of these laser pulses, complex physical processes appear that strongly depend on sample structure and applied laser pulse energy densities. The control of the experimental parameters is therefore a key task for obtaining high quality alloys. The Finite ElementsMethod (FEM) is a powerful tool for the optimization of such treatments, because it provides the spatial and temporal temperature fields that are produced by the laser pulses. In this work, we have used a FEM commercial software, to predict the temperatures gradients induced by ArF excimer laser over a wide energy densities range, 0.1<{phi}<0.4 J/cm{sup 2}, on different SiO{sub 2}/Si/Si{sub (1-x)}Ge{sub (x)} thin films deposited on SOI substrate. These numerical results allow us to predict the threshold energies needed to reach the melting point (MP) of the Si and SiGe alloy without oxidation of the thin films system. Therefore, it is possible to optimize the conditions to achieve high quality epitaxy films. (copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  12. Pharmacodynamic and cytogenetic evaluation in CYP2C19*2 and CYP2C19*3 allelomorphism in South Indian population with clopidogrel therapy.

    Science.gov (United States)

    Tantray, Javeed Ahmad; Reddy, K Pratap; Jamil, Kaiser; Kumar, Y Shiva

    2017-02-15

    Genetic factors play a significant role in pathogenesis of most diseases of heart. The present study was undertaken to correlate coronary artery disease with demographical, biochemical alterations, SNPs, gene expression and chromosomal abnormalities and for further enlightening the investigation in this field. 150 patients taking clopidogrel drug were selected and single nucleotide polymorphism was done by PCR-RFLP techniques. With the same patients cytogenetic analysis was carried out on leukocyte cultures by karyotyping. Gene expression studies for 20 CAD patients and normal controls were done by RT-PCR techniques. In this study of patients with coronary artery disease the frequencies of the Extreme Metabolizers, Intermediate Metabolizers in CYP2C19*2 (rs4244285) were present in 90% and 10% but no Poor Metabolizers were found in this allele. The frequencies of Extreme Metabolizer, Intermediate Metabolizer and Poor Metabolizer in CYP2C19*3 (rs4986893) were present in 41%, 50% and 9% respectively. Among 20 CAD samples, 13 of 20 (65%) showed CYP2C19 gene over expression in CAD patients and all controls showed normal expression. Among the 150 CAD patients, 145 had normal karyotype, only five patients showed change in normal karyogram carried out by leukocyte culture. Genetic testing of CYP2C19 may help in prescribing a dose according to genetic makeup and represent the initial steps towards the development of diagnostic tests and therapeutic strategies that will substantially improve human health. This study highlights the progress that has been made in using pharmacogenomic and gene expression analysis, cardiovascular genomic research and the potential for applying these findings in clinical medicine. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  13. Structure of the Escherichia coli O157:H7 heme oxygenase ChuS in complex with heme and enzymatic inactivation by mutation of the heme coordinating residue His-193

    Energy Technology Data Exchange (ETDEWEB)

    Suits,M.; Jaffer, N.; Jia, Z.

    2006-01-01

    Heme oxygenases catalyze the oxidation of heme to biliverdin, CO, and free iron. For pathogenic microorganisms, heme uptake and degradation are critical mechanisms for iron acquisition that enable multiplication and survival within hosts they invade. Here we report the first crystal structure of the pathogenic Escherichia coli O157:H7 heme oxygenase ChuS in complex with heme at 1.45 {angstrom} resolution. When compared with other heme oxygenases, ChuS has a unique fold, including structural repeats and a {beta}-sheet core. Not surprisingly, the mode of heme coordination by ChuS is also distinct, whereby heme is largely stabilized by residues from the C-terminal domain, assisted by a distant arginine from the N-terminal domain. Upon heme binding, there is no large conformational change beyond the fine tuning of a key histidine (His-193) residue. Most intriguingly, in contrast to other heme oxygenases, the propionic side chains of heme are orientated toward the protein core, exposing the {alpha}-meso carbon position where O{sub 2} is added during heme degradation. This unique orientation may facilitate presentation to an electron donor, explaining the significantly reduced concentration of ascorbic acid needed for the reaction. Based on the ChuS-heme structure, we converted the histidine residue responsible for axial coordination of the heme group to an asparagine residue (H193N), as well as converting a second histidine to an alanine residue (H73A) for comparison purposes. We employed spectral analysis and CO measurement by gas chromatography to analyze catalysis by ChuS, H193N, and H73A, demonstrating that His-193 is the key residue for the heme-degrading activity of ChuS.

  14. A NEW RECOMBINANT ADENO-ASSOCIATED VIRUS (AAV)-BASED RANDOM PEPTIDE DISPLAY LIBRARY SYSTEM: INFECTION-DEFECTIVE AAV1.9-3 AS A NOVEL DETARGETED PLATFORM FOR VECTOR EVOLUTION.

    Science.gov (United States)

    Adachi, Kei; Nakai, Hiroyuki

    2010-10-01

    Directed evolution through genetic engineering of viral capsids followed by selection has emerged as a powerful means to create novel recombinant adeno-associated virus (rAAV) vectors with desired tropism and enhanced properties. One of the most effective approaches uses rAAV-based random peptide display libraries. Here we report a novel system based on an infection-defective rAAV1.9-3 as a platform for random peptide display, and show that biopanning of the libraries in vitro effectively identifies the peptides that restore and enhance rAAV transduction. rAAV1.9-3 has a genetically engineered AAV1 capsid with amino acids 445-568 being replaced with those of AAV9, and has been identified as a variant exhibiting significantly impaired infectivity and delayed blood clearance when infused into mice. In this study, we generated rAAV1.9-3 variant libraries in which 7- or 12-mer random peptides were expressed at the capsid amino acid position 590. Three rounds of positive selection for primary human dermal fibroblasts successfully identified new rAAV-peptide variants that transduce them more efficiently than the prototype rAAV2. Thus our study demonstrates that an infection-defective rAAV variant serves as a novel detargeted platform for random peptide display libraries. We also describe a brief review of recent progress in rAAV-based random peptide display library approaches.

  15. A NEW RECOMBINANT ADENO-ASSOCIATED VIRUS (AAV)-BASED RANDOM PEPTIDE DISPLAY LIBRARY SYSTEM: INFECTION-DEFECTIVE AAV1.9-3 AS A NOVEL DETARGETED PLATFORM FOR VECTOR EVOLUTION*

    Science.gov (United States)

    Adachi, Kei; Nakai, Hiroyuki

    2011-01-01

    Directed evolution through genetic engineering of viral capsids followed by selection has emerged as a powerful means to create novel recombinant adeno-associated virus (rAAV) vectors with desired tropism and enhanced properties. One of the most effective approaches uses rAAV-based random peptide display libraries. Here we report a novel system based on an infection-defective rAAV1.9-3 as a platform for random peptide display, and show that biopanning of the libraries in vitro effectively identifies the peptides that restore and enhance rAAV transduction. rAAV1.9-3 has a genetically engineered AAV1 capsid with amino acids 445–568 being replaced with those of AAV9, and has been identified as a variant exhibiting significantly impaired infectivity and delayed blood clearance when infused into mice. In this study, we generated rAAV1.9-3 variant libraries in which 7- or 12-mer random peptides were expressed at the capsid amino acid position 590. Three rounds of positive selection for primary human dermal fibroblasts successfully identified new rAAV-peptide variants that transduce them more efficiently than the prototype rAAV2. Thus our study demonstrates that an infection-defective rAAV variant serves as a novel detargeted platform for random peptide display libraries. We also describe a brief review of recent progress in rAAV-based random peptide display library approaches. PMID:21603583

  16. A NEW RECOMBINANT ADENO-ASSOCIATED VIRUS (AAV)-BASED RANDOM PEPTIDE DISPLAY LIBRARY SYSTEM: INFECTION-DEFECTIVE AAV1.9-3 AS A NOVEL DETARGETED PLATFORM FOR VECTOR EVOLUTION*

    OpenAIRE

    Adachi, Kei; Nakai, Hiroyuki

    2010-01-01

    Directed evolution through genetic engineering of viral capsids followed by selection has emerged as a powerful means to create novel recombinant adeno-associated virus (rAAV) vectors with desired tropism and enhanced properties. One of the most effective approaches uses rAAV-based random peptide display libraries. Here we report a novel system based on an infection-defective rAAV1.9-3 as a platform for random peptide display, and show that biopanning of the libraries in vitro effectively ide...

  17. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  18. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  19. Measurement of the Ir-191,193(n,2n)Ir-190,192 Reaction Cross Section Between 9.0 and 16.5 MeV

    Science.gov (United States)

    Wildenhain, Elizabeth; Finch, Sean; Tornow, Werner; Krishichayan, F.

    2017-09-01

    Iridium is one of the elements prioritized by Nonproliferation and Homeland Security agencies. In addition, Ir-192 is being used in various medical treatments. Improved data and corresponding evaluations of neutron-induced reactions on the iridium isotopes are required to meet the demands of several applications of societal interest. This study measured the cross section of the Ir-191,193(n, 2n)Ir-190,192 reactions at energies from 9.0 to 16.5 MeV using the activation technique. Natural Ir samples [Ir-191 37.3%, Ir-193 62.7%] were sandwiched between Au-197 monitor foils and irradiated with monoenergetic neutron beams at the tandem facility of the Triangle Universities Nuclear Laboratory (TUNL). Gamma rays from the irradiated samples were counted in TUNL's low background facility using high-efficient HPGe detectors. Measured cross-section data are compared to previous data and to predictions from nuclear data libraries (e.g. ENDF). Research at TUNL funded by the NSF.

  20. ArF excimer laser modulation of TNF-alpha and gelatinase B in NIH 3T3 cells; Modulation de l`expression du TNF-alpha et de la gelatinase B, apres irradiation de fibroblastes NIH 3T3 par un laser a excimeres a 193 NM

    Energy Technology Data Exchange (ETDEWEB)

    Naudy-Vives, C.; Courant, D.; Perot, J.C.; Garcia, J.; Fretier, P.; Court, L.; Dormont, D.

    1995-12-31

    The effects on TNF-alpha and gelatinase B activity in mammalian cells induced by 193 nm argon fluoride excimer laser have been investigated. The data show that a secretion of 92 kDa type IV collagenase and TNF-alpha were increased in cell culture supernatants. Moreover, the 193 nm laser radiation produces a decrease of cell proliferation and an increase of cell activation 8 hours after irradiation. The total protein amount increases with the delivered dose. Same, but less effects were obtained after exposure to a conventional UV lamp at 254 nm. (author). 8 refs.

  1. 18 June 2012 - DST Global Founder Y. Milner signing the guest book with Head of International Relations F. Pauss; visiting the AD facility in building 193 with AEGIS Collaboration Spokesperson M. Doser and Adviser for the Russian Federation T. Kurtyka. Managing Director I. Osborne also present with Mrs J. Milner and DST Global A. Lebedkina.

    CERN Multimedia

    Maximilien Brice

    2012-01-01

    18 June 2012 - DST Global Founder Y. Milner signing the guest book with Head of International Relations F. Pauss; visiting the AD facility in building 193 with AEGIS Collaboration Spokesperson M. Doser and Adviser for the Russian Federation T. Kurtyka. Managing Director I. Osborne also present with Mrs J. Milner and DST Global A. Lebedkina.

  2. A damage assessment model of oil spill accident combining historical data and satellite remote sensing information: a case study in Penglai 19-3 oil spill accident of China.

    Science.gov (United States)

    Wei, Lai; Hu, Zhuowei; Dong, Lin; Zhao, Wenji

    2015-02-15

    Oil spills are one of the major sources of marine pollution; it is important to conduct comprehensive assessment of losses that occur as a result of these events. Traditional methods are required to assess the three parts of losses including cleanup, socioeconomic losses, and environmental costs. It is relatively slow because assessment is complex and time consuming. A relatively quick method was developed to improve the efficiency of assessment, and then applied to the Penglai 19-3 accident. This paper uses an SAR image to calculate the oil spill area through Neural Network Classification, and uses historical oil-spill data to build the relationship between loss and other factors including sea-surface wind speed, and distance to the coast. A multiple regression equation was used to assess oil spill damage as a function of the independent variables. Results of this study can be used for regulating and quickly dealing with oil spill assessment. Copyright © 2014 The Authors. Published by Elsevier Ltd.. All rights reserved.

  3. Publications | Page 193 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Clean energy and water : low-cost climate adaptation options for East Africa; draft journal article (restricted access). This study assesses renewable energy use in water services in East Africa and implications for adaptation to climate change impacts. The case studies demonstrate to some extent, that windpumps and treadle ...

  4. Publications | Page 193 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  5. Overall view of AA in Bld. 193

    CERN Multimedia

    1980-01-01

    See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  6. Overall view of AA (Bld 193)

    CERN Multimedia

    1980-01-01

    See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  7. 29 CFR 19.3 - Authorization.

    Science.gov (United States)

    2010-07-01

    ... written request under the Act only if: (a) No administrative summons or subpoena authority reasonably... records are sought; (b) There is reason to believe that the records sought are relevant to a legitimate... delegate this authority to others; (d) The request adheres to the requirements set forth in § 19.4; and (e...

  8. 7 CFR 4280.193 - Combined funding.

    Science.gov (United States)

    2010-01-01

    ... RURAL UTILITIES SERVICE, DEPARTMENT OF AGRICULTURE LOANS AND GRANTS Renewable Energy Systems and Energy... combined funding, the applicant must submit separate applications for both types of assistance (grant and...

  9. 196 193 Species Abundance and Colour Prefer

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... ABSTRACT: A study was conducted to determine the occurrence and colour preferences of oviposition by mosquitoes in man-made containers under field conditions. A total of nine (9) different colour 2 litre plastic containers were used as artificial mosquito oviposition containers. They were filled with equal ...

  10. Ogunkunle and Fatoba 185-193

    African Journals Online (AJOL)

    Natural populations of ectohydric moss Barbula lambarenensis growing in a cement polluted environment were collected and subjected to Sequential Elution Technique using 0.2M EDTA as the extracting agent, in order to quantify the Pb, Cu, Cr, Cd and Zn contents of the extracellular, intracellular and particulate fractions.

  11. Reference: 193 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ous electrophysiological studies as the slow vacuolar channel. Slow vacuolar chan...scisic acid-induced repression of germination and in the response of stomata to extracellular calcium. These studies

  12. April 2002 EAST AFRICAN MEDICAL JOURNAL 193

    African Journals Online (AJOL)

    2002-04-04

    Apr 4, 2002 ... while in females cancer of cervix, breast, NHL, stomach and KS were found most frequent. Conclusion: This pattern ... stomach and penila cancer were found to be rare whereas oesophageal cancer was one of the commonest ..... where screening programmes are established. the incidence of cancer of the ...

  13. 196 193 Species Abundance and Colour Prefer

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... habits. Water collection, human activities and behaviour such as discarding of empty containers, planting ornamental plants around houses may potentially encourage breeding of mosquitoes (Horsfall 1972). Oviposition is an important component of most mosquito-borne diseases (Bentley and Day,. 1989).

  14. 49 CFR 193.2007 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... dikes and floors which is designed to confine a spill of hazardous liquid. Impounding system includes an impounding space, including dikes and floors for conducting the flow of spilled hazardous liquids to an.... Vaporization means an addition of thermal energy changing a liquid to a vapor or gaseous state. Vaporizer means...

  15. Publications | Page 193 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ENACQKT-ing : Caribbean nurses enhancing care, quality and knowledge through technology; final technical report (open access) ... Refugees and migrants in transit countries like Egypt are linked into wider Diaspora networks that help support them, and in turn enable the migrants to support their families and ...

  16. 193-IJBCS-Article-Dr Aboubakar Dandjouma

    African Journals Online (AJOL)

    RHUMSIKI

    caroténoïdes). Une augmentation significative (p < 0,05) des indices d'acide, peroxyde, K232 et K270 a été observée au cours du temps, le stockage à 25 °C ..... de grignons d'olive raffinée. CODEX. STAN 33-1981 (Rév. 1-1989) ; 6p. Coppin EA, Pike O. 2001. Oil Stability Index correlated with sensory determination of.

  17. An ultra-narrow FinFET poly-Si gate structure fabricated with 193nm photolithography and in-situ PR/BARC and TEOS hard mask etching

    Science.gov (United States)

    Liao, Wen-Shiang; Wu, Cheng-Han; Tang, Mao-Chyuan; Huang, Sheng-Yi; Shih, Tommy; Liaw, Yue-Gie; Chen, Kun-Ming; Chen, Tung-Hung; Tsen, Huan-Chiu; Chung, Lee

    2008-03-01

    A vertical double gate MOSFET (FinFET) device with an ultra-small poly-Si gate of 30nm and promising device performances has been successfully developed after integrating a 14Å nitrided gate oxide on silicon-on-insulator (SOI) wafers. First, a 500Å-thick TEOS capping oxide layer was deposited upon a 1000Å-thick poly-Si gate layer. Second, both 1050Å-thick bottom anti-reflective coating (BARC) and 2650Å-thick photoresist (PR) were coated. A deep ultra-violet (DUV) 193nm wavelength ASML scanner lithography tool was used for the ultra-small poly-Si layout patterning under high energy exposure. After an organic-based trimming down plasma etching of both PR and BARC, the TEOS capping oxide layer was plasma etched in another oxide-based etching chambers without breaking the plasma etcher's loadlock vacuum. Then, without removing the already plasma patterned and trim-downed PR and BARC, an in-situ PR/BARC and TEOS hard mask etching was rendered for the final 1000Å-thick poly-Si gate electrode. The poly-Si etching can be automatically stopped by setting the over-time etching mode to a few seconds after detecting the endpoint signal of the bottom buried oxide (BOX) insulating layer. Finally, after PR and BARC plasma as well as additional wet cleaning, an ultra-narrow poly-Si gate electrode, i.e., after etching inspection (AEI) of 30nm, with its capping TEOS hard mask was successfully fabricated.

  18. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  19. Inside Hall 193 for the Antiproton Accumulator (AA) ring

    CERN Multimedia

    1979-01-01

    Installation work is in full swing. A model quadrupole on the left shows where the magnet ring will be. The cables wound on drums are part of the pulse-forming network for the injection kicker. See Annual Report 1979 p. 103, Fig. 9 and photo 7911303. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  20. 40 CFR 98.193 - Calculating GHG emissions.

    Science.gov (United States)

    2010-07-01

    ... month n, determined according to § 98.194(c) (metric tons MgO/metric ton lime). 2000/2205 = Conversion...). 2000/2205 = Conversion factor for metric tons to tons. (iii) You must calculate the annual CO2.../2205 = Conversion factor for metric tons to tons. (iv) You must calculate annual CO2 process emissions...

  1. PODAAC-GHN19-3CO02

    Data.gov (United States)

    National Aeronautics and Space Administration — A Group for High Resolution Sea Surface Temperature (GHRSST) dataset for the North Atlantic Region (NAR) from the Advanced Very High Resolution Radiometer (AVHRR) on...

  2. PODAAC-GHN19-3PE01

    Data.gov (United States)

    National Aeronautics and Space Administration — A Group for HIgh Resolution Sea Surface Temperature (GHRSST) dataset for the North Atlantic Region (NAR) from the Advanced Very High Resolution Radiometer (AVHRR) on...

  3. Dicty_cDB: VSH193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1( AM075832 |pid:none) Malus x domestica mRNA for beclin ... 133 5e-47 (Q9VCE1) RecName: Full=Beclin-1-like ..... 133 2e-45 AM075829_1( AM075829 |pid:none) Glycine max mRNA for beclin 1 prot... 126 4e-45 AY701316_1( AY7...5834 |pid:none) Solanum tuberosum mRNA for beclin ... 124 1e-44 AM075824_1( AM075824 |pid:none) Hordeum vulgare mRNA for beclin...4 4e-44 AY036610_1( AY036610 |pid:none) Triticum aestivum beclin1-like pro... 117

  4. 15 CFR 922.193 - Prohibited or otherwise regulated activities.

    Science.gov (United States)

    2010-01-01

    ..., seizure or disposition of seized property in connection with enforcement of the Act or any regulations... an emergency threatening life or the environment. (d) The prohibitions in paragraphs (a) (1) through...

  5. 46 CFR 193.10-10 - Fire hydrants and hose.

    Science.gov (United States)

    2010-10-01

    ... shall be limited to any position from the horizontal to the vertical pointing downward, so that the hose... a garden hose nozzle that is bronze or metal with strength and corrosion resistance equivalent to...

  6. Dicty_cDB: VHI193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DPATAPNLGDRVPYVVIQGSKGAPIYEKAEDPLYALEHNILLDCQYYLDKQLKAPLIRIF KPIMSNPDLIFHGEHTRTIAQSTLSDNNKGFFGTLKKKKVCMNCPKELTDTESTTCINCQ...DPATAPNLGDRVPYVVIQGSKGAPIYEKAEDPLYALEHNILLDCQYYLDKQLKAPLIRIF KPIMSNPDLIFHGEHTRTIAQSTLSDNNKGFFGTLKKKKVCMNCPKELTDTESTTCINCQ

  7. 40 CFR 264.193 - Containment and detection of releases.

    Science.gov (United States)

    2010-07-01

    ... management as a hazardous waste in accordance with all applicable requirements of parts 262 through 265 of... conducted at least annually. [Note: The practices described in the American Petroleum Institute (API...

  8. 40 CFR 265.193 - Containment and detection of releases.

    Science.gov (United States)

    2010-07-01

    ... material is a hazardous waste under part 261 of this chapter, it is subject to management as a hazardous... to be assessed. Note: The practices described in the American Petroleum Institute (API) Publication...

  9. Dicty_cDB: SFL193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available skt*m*m**sw*kmlcxdsl**sl*frlwxrf*mxn*t*wfrxlcpfrktx xttt*km**xmptrp*mxsxstwkrmlrccpxttxkmlfkmsxkt*m*sqplw*rm...GVKXXP*ixvh*rxphxheckvdpngkemlrqip*ttt trslfikmpskt*m*m**sw*kmlcxdsl**sl*frlwxrf*mxn*t*wfrxlcpfrktx xttt*km*...l *ryi*ylyi*k*ll*kfiq*psc*sik*mlqs*wiy*nynsnrvflf*cqd*rmclir*i m*fpkxllfksnfllpr*inl*rfklw--- ---*rcppnhexrf...ndqxhqxwgkgspmnxcsltxxxxp*m*s*sqw*rnvasdpidhhh qkfvh*dalqnmnvnvmimvknvvxrfivmkfvi*ivvevlnv*ldmmvqxvvsvqkdxt

  10. 193 A Contrastive Morphological Analysis of Tense Formation in ...

    African Journals Online (AJOL)

    formation of tenses in these languages and immediately correct ... language problem. One of such efforts is the National Policy on. Education, which has encouraged the use of the mother tongue as the language of instruction at the primary school level. ..... word, are referentially opaque, that is, it is impossible to refer to.

  11. 14 CFR 21.193 - Experimental certificates: general.

    Science.gov (United States)

    2010-01-01

    ... previously certificated type without appreciable change in the external configuration, three-view drawings or three-view dimensioned photographs of the aircraft. (e) In the case of a light-sport aircraft assembled... aircraft kit manufacturer and issued a special airworthiness certificate in the light-sport category. (2...

  12. 19 CFR 191.193 - Application procedure for compliance program.

    Science.gov (United States)

    2010-04-01

    ... office where the claims will be filed. (c) Letter of application; contents. A party requesting..., along with the number estimated to be filed over the next 12-month period, and the estimated amount of... the records that will be maintained, including at least sample import documents, sample export...

  13. Dicty_cDB: AFG193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Value N L49527 |L49527.1 Dictyostelium discoideum cortexillin I mRNA, complete cds. 813 0.0 1 AX430298 |AX430298...(bits) Value (Q9Y0T4) RecName: Full=Cortexillin-1; AltName: Full=Cortexillin ... 166 3e-40 (Q66H60) RecName:

  14. RT-PCR protocols [Methods in molecular biology, v. 193

    National Research Council Canada - National Science Library

    O'Connell, Joseph

    2002-01-01

    .... Here the newcomer will find readily reproducible protocols for highly sensitive detection and quantification of gene expression, the in situ localization of gene expression in tissue, and the cloning...

  15. All projects related to | Page 193 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2016-08-23

    Sexual Violence and Impunity in South Asia. Project. Silence around the topic of sexual violence has increased in South Asian countries of Bangladesh, India, Nepal, Pakistan and Sri Lanka, even as its incidence has also increased in recent conflicts. End Date: August 23, 2016. Topic: SEXUAL ABUSE, SOCIAL ...

  16. 21 CFR 133.193 - Spiced, flavored standardized cheeses.

    Science.gov (United States)

    2010-04-01

    ... of ingredients prescribed for that specific natural cheese variety promulgated pursuant to section 401 of the Federal Food, Drug, and Cosmetic Act. In addition a spiced and/or flavored standardized... standardized cheese shall include in addition to the varietal name of the natural cheese, a declaration of any...

  17. Dicty_cDB: VSJ193 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qfqninlmklqkk lqlmkrikle*vivqfvyvnsqsiqkh*nyhvniifimnv*ipg*kllllvqtvvihyrq lmlnmnqwle*leimn*kmvqlivrqppiitmt...*ilkelnlh*nidqyhqfqninlmklqkk lqlmkrikle*vivqfvyvnsqsiqkh*nyhvniifimnv*ipg*kllllv...liikkkk*ilkelnlh*nidqyhqfqninlmkl qkklqlmkrikle*vivqfvyvnsqsiqkh*nyhvniifimnv*ipg*kllllvqtvvih yrqlmlnmnqwle

  18. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  19. Decay of {sup 185}Tl, {sup 185m+g}Hg, {sup 189m+g}Pb and energy location of the 13/2{sup +} isomeric states in {sup 185}Hg, {sup 189}Pb, {sup 193}Po and {sup 197}Rn

    Energy Technology Data Exchange (ETDEWEB)

    Sauvage, J.; Roussiere, B.; Franchoo, S.; Barre, N.; Bourgeois, C.; Clavelin, J.F.; Grave, X.; Kilcher, P.; Oms, J. [IN2P3-CNRS/Universite Paris-Sud, Institut de Physique Nucleaire, Orsay Cedex (France); Genevey, J. [IN2P3-CNRS/Universite Joseph Fourier, Laboratoire de Physique Subatomique et de Cosmologie, Grenoble Cedex (France); Andreyev, A.N. [University of York, Department of Physics, York (United Kingdom); Ben Braham, A. [Faculte des sciences de Tunis, Tunis (Tunisia); Witte, H. de; Huyse, M.; Mukha, I.; Vel, K.V. de; Duppen, P. van [Instituut voor Kern- en Stralingsfysica, Leuven (Belgium); Fedorov, D.V.; Volkov, Yu.M. [Petersburg Nuclear Physics Institute, Gatchina (Russian Federation); Fedoseyev, V.N.; Marsh, B.A. [ISOLDE, CERN, Geneve (Switzerland); Fraile, L.M. [Universidad Complutense, Grupo de Fisica Nuclear, Madrid (Spain); Huber, G. [Johannes Gutenberg Universitaet, Institut fuer Physik, Mainz (Germany); Koester, U. [Institut Laue-Langevin, Grenoble Cedex 9 (France); Kunz, P. [TRIUMF, Vancouver (Canada); Lesher, S.R. [University of Wisconsin-La Crosse, La Crosse (United States); Porquet, M.G. [Centre de Sciences Nucleaires et de Sciences de la Matiere, Orsay (France); Seliverstov, M. [Petersburg Nuclear Physics Institute, Gatchina (Russian Federation); Johannes Gutenberg Universitaet, Institut fuer Physik, Mainz (Germany); Stefanescu, I. [Technische Universitaet Muenchen, Forschungs-Neutronenquelle Heinz Maier-Leibnitz, Garching (Germany); Wojtasiewicz, A. [University of Warsaw, Institute of Experimental Physics, Warsaw (Poland)

    2013-09-15

    The {beta}{sup +} /EC decay of {sup 185}Tl was studied at the ISOLDE facility, the {gamma} -rays belonging to {sup 185}Hg have been identified and a partial low-spin level scheme of {sup 185}Hg has been built. The decay of {sup 185m+g}Hg was studied at the ISOCELE facility. Conversion electron lines of very low-energy transitions were observed for the first time. Electron data have been obtained for four transitions in {sup 185}Au and two transitions in {sup 185}Hg. From the analysis performed using an internal energy calibration procedure the energy location of the {sup 185m}Hg has been determined to be E{sub IS}= 103.7(4) keV. This E{sub IS} value is consistent with that determined independently, E{sub IS}=94(13) keV, using {sup 185m+g}Hg {alpha} -decay data from literature. New {alpha} particles emitted from {sup 189m+g}Pb have been detected and their origins determined by in-source laser spectroscopy at the ISOLDE facility. {alpha} - {gamma} coincidence results have served to locate the 13/2{sup +} isomeric state of {sup 189}Pb at E{sub IS}=40(4) keV. This latter E{sub IS} value added to {alpha} -decay data from literature have allowed the energy location of the 13/2{sup +} isomeric states of {sup 193}Po and {sup 197}Rn at 95(7)keV and 194(12)keV, respectively. The nuclear structure of the isomeric and ground states in the nuclei of the three {alpha} -emitter chains starting with {sup 195m+g,} {sup 197m+g,} {sup 199m+g}Rn are discussed. (orig.)

  20. Enhanced magnetostrictive effect in epoxy-bonded Tb{sub x}Dy{sub 0.9−x}Nd{sub 0.1}(Fe{sub 0.8}Co{sub 0.2}){sub 1.93} pseudo 1–3 particulate composites

    Energy Technology Data Exchange (ETDEWEB)

    Liu, J. J., E-mail: liujinjun1@nbu.edu.cn, E-mail: liujjimr@gmail.com; Pan, Z. B.; Song, X. H.; Zhang, Z. R. [Faculty of Materials Science and Chemical Engineering, Ningbo University, Ningbo 315211 (China); Ren, W. J. [Shenyang National Laboratory for Materials Science, Institute of Metal Research, Chinese Academy of Sciences, Shenyang 110016 (China)

    2015-05-07

    The spin configuration and spontaneous magnetostriction λ{sub 111} of Tb{sub x}Dy{sub 0.9−x}Nd{sub 0.1}(Fe{sub 0.8}Co{sub 0.2}){sub 1.93} (0.20 ≤ x ≤ 0.60) alloys have been investigated. The easy magnetization direction (EMD) at room temperature was observed towards the 〈111〉 axis when 0.40 ≤ x ≤ 0.60, accompanied by a rhombohedral distortion with large spontaneous magnetostriction coefficients λ{sub 111}, which increases from 1640 ppm for x = 0.40 to 1900 ppm for x = 0.60. The strong 〈111〉-oriented pseudo 1–3 particulate composite was fabricated by embedding and aligning particles in a passive epoxy matrix under an applied magnetic field. An enhanced magnetostrictive effect, the large low-field magnetostriction, λ{sub a}, as high as 480 ppm at 3 kOe, was obtained for the sample of x = 0.40, in an excess of 75% of its polycrystalline alloy although it only contains 27 vol. % alloy particles. This enhanced effect can be attributed to its low magnetic anisotropy, anisotropic magnetostrictive nature (e.g., λ{sub 111} ≠ λ{sub 100,} 〈111〉EMD), chain structure, and the 〈111〉-textured orientation. In addition, we give a direct experimental support that the 〈111〉EMD of particle and the strong 〈111〉-textured orientation are the crucial factors to realize the enhanced magnetostrictive effect in 1–3 particulate composites.

  1. Anonimi, “Ges al meu grat non sui joglar” (BdT 461.126, “Per zo no·m voil desconortar” (BdT 461.193, “Va, cobla: al Juge de Galur” (BdT 461.246, “Seigner Juge, ben aug dir a la gen” (BdT 461.217, “Ges per li diz non er bons prez sabuz” (BdT 461.133

    Directory of Open Access Journals (Sweden)

    Giuseppe Noto

    2012-09-01

    Full Text Available My paper provides a new critical edition, with critical apparatus, comment and translation of a set of anonymous ‘coblas’, copied as a sequence in the anthology present at ff. 55-66 in chansonnier P: BdT 461.126; BdT 461.193; BdT 461.246; BdT 461.217; BdT 461.133 (all of which are unica. I will examine in particular the attributions suggested so far for one or more of these ‘coblas’ (a name that has frequently been put forward is that of Paolo Lanfranchi da Pistoia, author of the sonnet in ‘cobla’ form copied in P immediately preceding the poems discussed here and address the hypothesis put forward by several scholars (and upheld with convincing evidence by Stefano Asperti that the sequence under consideration points to the strong presence of a Tuscan tradition in chansonnier P, clearly contributing, among other things, to outline a “fundamental coherence” (Asperti between some aspects of Dante’s literary culture and this particular songbook.

  2. KN193L01: WHOI cruise 193 leg 01 aboard the R/V Knorr from 2008-03-14 - 2008-04-12 (NODC Accession 0071817)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Post-cruise download of raw data from shipboard computer(s) as furnished by the Woods Hole Oceanographic Institution Shipboard Scientific Support Group and archived...

  3. KN193L07: WHOI cruise 193 leg 07 aboard the R/V Knorr from 2008-07-14 - 2008-08-07 (NODC Accession 0080943)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Post-cruise download of raw data from shipboard computer(s) as furnished by the Woods Hole Oceanographic Institution Shipboard Scientific Support Group and archived...

  4. KN193L04: WHOI cruise 193 leg 04 aboard the R/V Knorr from 2008-05-24 - 2008-06-03 (NODC Accession 0080942)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Post-cruise download of raw data from shipboard computer(s) as furnished by the Woods Hole Oceanographic Institution Shipboard Scientific Support Group and archived...

  5. Statistical Abstract of Higher Education in North Carolina, 1992-93. Research Report 1-93.

    Science.gov (United States)

    Balfour, Linda F., Comp.

    This abstract presents statistical data on higher education activities in North Carolina from simple counts of enrollment and degrees conferred to complex analyses of the flow of student transfers among institutions. Data for the abstract were assembled from information supplied by the colleges and universities for the 1992-93 academic year.…

  6. Immunogenic potential of a Salmonella Typhimurium live vaccine for pigs against monophasic Salmonella Typhimurium DT 193.

    Science.gov (United States)

    Theuß, Tobias; Ueberham, Elke; Lehmann, Jörg; Lindner, Thomas; Springer, Sven

    2017-11-17

    Monophasic Salmonella Typhimurium (mSTM) strains account for up to 8.6% of all human Salmonellosis cases. They have an increasing prevalence during recent years and several human cases with hospitalisation were reported. These strains are often isolated from pigs and pork - one primary source of human infection. A Salmonella Typhimurium (STM) live vaccine has been proven successful in controlling of STM infections in pigs for many years. The aim of this study was to test the immunogenicity of the vaccine in weaners during oral challenge with a virulent mSTM strain and to examine the kinetics of STM-specific IgA, IgM and IgG antibodies induced by vaccination and infection. Despite clinical signs being present in both groups, the vaccination led to a significant reduction of diarrhoea, overall clinical symptoms and a milder elevation of the body temperature. Necropsy revealed fewer pathological lesions in the gastrointestinal tract of vaccinated compared to control animals. Moreover, in the ileal and caecal mucosa and in the ileocaecal lymph nodes the challenge strain burden was significantly reduced by vaccination. Significant differences in the antibody responses of both groups were present during the vaccination period and after infection. In vaccinated animals Salmonella-specific IgA and IgG antibody levels increased significantly after vaccination and were even more pronounced in response to challenge. In contrast, similarly low levels of IgM antibodies were detected during the vaccination period in both vaccinated and non-vaccinated animals. However, after challenge IgM antibody levels increased significantly in control pigs while neither IgA nor IgG antibodies were detectable. The data demonstrate that mSTM can evoke clinical signs in weaners. Due to the vaccination their incidence and magnitude were significantly milder. Vaccination also led to a significantly reduced challenge strain burden in the intestine and the lymph nodes which is comparable to previous studies using the same vaccine in a challenge with biphasic STM. Therefore, it is concluded that this vaccine induces immunity against monophasic and biphasic STM strains. Furthermore, the results of antibody profiles in response to vaccination and infection provide additional evidence for humoral immune mechanisms triggered during Salmonella infection or vaccination.

  7. 26 CFR 1.193-1 - Deduction for tertiary injectant expenses.

    Science.gov (United States)

    2010-04-01

    ... (which includes oil recovered from sources such as oil shale and condensate). (5) Injectant defined. For... taxpayer why uses the cash receipts and disbursements method of accounting, uses an approved tertiary... components of the injectant before injection, the hydrocarbons would have a fair market value of $80x. B uses...

  8. 1935 15' Quad #193 Aerial Photo Mosaic Index - 2 of 2

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  9. FCJ-193 Harbouring Dissent: Greek Independent and Social Media and the Antifascist Movement

    Directory of Open Access Journals (Sweden)

    Sky Croeser

    2015-06-01

    Full Text Available This article examines Greek activists’ use of a range of communication technologies, including social media, blogs, citizen journalism sites, Web radio, and anonymous networks. Drawing on Anna Tsing’s theoretical model, the article examines key frictions around digital technologies that emerged within a case study of the antifascist movement in Athens, focusing on the period around the 2013 shutdown of Athens Indymedia. Drawing on interviews with activists and analysis of online communications, including issue networks and social media activity, we find that the antifascist movement itself is created and recreated through a process of productive friction, as different groups and individuals with varying ideologies and experiences work together.

  10. Women, Wit, and Witchcraft: The Burden of Stereotypes. Working Paper No. 193.

    Science.gov (United States)

    Levy, Barbara

    This paper examines the negative stereotypes so long foisted on witty women and the move of contemporary witty women writers into a comic vision beyond the imposed connection of female wit to sly cleverness and witchcraft. To illustrate how the woman writer had to cope with a prejudice against and a fear of her wit, the paper considers three…

  11. Yeast Interacting Proteins Database: YPL070W, YPR193C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YPL070W MUK1 Cytoplasmic protein of unknown function containing a Vps9 domain; computational...1 Bait description Cytoplasmic protein of unknown function containing a Vps9 domain; computational

  12. : tous les projets | Page 193 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Des spécialistes canadiens participent à des travaux de recherche portant sur les risques auxquels sont exposés les milieux humides le long de la côte atlantique de l'Amérique du Sud et sur leur vulnérabilité. End Date: 16 mars 2017. Sujet: URUGUAY. Région: Brazil, Uruguay, Canada, Portugal. Programme: Climate ...

  13. Long Coherence Length 193 nm Laser for High-Resolution Nano-Fabrication

    Science.gov (United States)

    2008-06-27

    ArF excimer lasers . In this Phase I STTR we have successfully designed and modeled a solid-state laser source that exceeds our target specifications...briefly in section 6. More details of the fiber modeling and analysis work are given in the appendix. The solid-state196 nm laser system is discussed...will limit the pulse energy . Efficiency of the system is another potential problem, as is scalability in power. A third system would use a 946 nm

  14. Page 1 193 Agro-Science Journal of Tropical Agriculture, Food ...

    African Journals Online (AJOL)

    during the wet season. However, it had longer vines in both seasons as well as higher number of shoots and leaves/cutting during the dry season. Vegetative stem cutting propagation of a selected clone of G. latifolia can thus be achieved with any of the physiological ages in both seasons at varying levels of success.

  15. Yeast Interacting Proteins Database: YJR055W, YPL193W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available unknown function, required for growth at high temperature Rows with this bait as bait (1) Rows with this...unknown function, required for growth at high temperature Rows with this bait as bait Rows with this bait

  16. In-situ Mueller matrix polarimetry of projection lenses for 193-nm lithography

    Science.gov (United States)

    Nomura, Hiroshi; Higashikawa, Iwao

    2010-04-01

    For immersion lithography with aggressive polarization illumination settings, it is important to newly construct two systems for diagnosing lithography tools; Stokes polarimetry of illumination and Mueller matrix polarimetry of projection lenses. At the SPIE conference on Optical Microlithography XXI in 2008, the authors had already reported on the former Stokes polarimetry. True polarization states of several illumination settings emerged. On the other hand, the latter Mueller matrix polarimetry is thought more complicated than the Stokes polarimetry. Therefore, the Mueller matrix polarimetry is reported separating into two papers. A theoretical approach to realizing the polarimetry has reported at the SPIE conference on Lithography Asia 2009. The test mask for the Mueller matrix polarimetry also comprises thin-plate polarizers and wide-view-angle quarter-waveplates, both which are developed by collaboration with Kogakugiken Corporation in Japan. Mueller matrices of the sample projecting optics are reconstructed by sixteen measurements of Stokes parameters of a light ray that reaches the wafer plane though the test mask and the projecting optics. The Stokes parameters are measured with a polarization measurement system already equipped on a side stage lying at the wafer plane. It took about seven hours to capture all the images at five image heights within the static exposure field. Stokes parameters are automatically calculated from the images and outputted from the lithography tools as a text file, and Mueller matrices are calculated by homebuilt software in a short time. All the images were captured under the identical illumination condition that the tool manufacturer calls "un-polarization".

  17. 193nm high power lasers for the wide bandgap material processing

    Science.gov (United States)

    Fujimoto, Junichi; Kobayashi, Masakazu; Kakizaki, Koji; Oizumi, Hiroaki; Mimura, Toshio; Matsunaga, Takashi; Mizoguchi, Hakaru

    2017-02-01

    Recently infrared laser has faced resolution limit of finer micromachining requirement on especially semiconductor packaging like Fan-Out Wafer Level Package (FO-WLP) and Through Glass Via hole (TGV) which are hard to process with less defect. In this study, we investigated ablation rate with deep ultra violet excimer laser to explore its possibilities of micromachining on organic and glass interposers. These results were observed with a laser microscopy and Scanning Electron Microscope (SEM). As the ablation rates of both materials were quite affordable value, excimer laser is expected to be put in practical use for mass production.

  18. 1935 15' Quad #193 Aerial Photo Mosaic Index - 1 of 2

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  19. 34 CFR 403.193 - What are the information requirements regarding special populations?

    Science.gov (United States)

    2010-07-01

    ... grade level in which vocational education programs are first generally available in the State, but in no case later than the beginning of the ninth grade. (c) Each eligible institution or consortium of... seeks admission to, vocational education programs offered by the institution or consortium of eligible...

  20. SU-E-T-193: FMEA Severity Scores - Do We Really Know?

    Energy Technology Data Exchange (ETDEWEB)

    Khan, A; Robertson, JD; Narra, V; Yue, N; Howell, R

    2014-06-01

    Purpose: Mycosis fungoides is a common form of cutaneous T-cell lymphoma which generally affects the skin. A typical course of treatment may include fractionated total skin electron beam therapy. Given the difficulties in uniformly irradiating some regions of the body and the need for frequent visits within the context of a fractionated protocol, this study investigated the feasibility of delivering the dose using form-fitting cloth which contained phosphorous-32 as a source for beta particle irradiation. Methods: A piece of fabric (0.97 g) consisting of a blend of spandex and flame retardant material impregnated with phosphorus-31 (2000 ppm) was bombarded with neutrons to produce phosphorus-32. The cloth was then laid flat and a stack of radiochromic film placed on top. Sheets of film and tissue equivalent plastic were layered to form a stack measuring a total of 1 cm thickness and remained sandwiched for 77.3 hr. Results: The initial activity of the activated cloth was 44 μCi of P-32. The absorbed dose was uniform within planes parallel to the cloth and exponentially dependent on depth, delivering 560cGy at 0.3mm and falling to 20cGy at 3mm. Conclusion: The total dose prescribed for a typical course of TSET for mycosis fungoides is 36Gy delivered over 9 weeks and is expected to treat to at least 5mm depth. Therefore, the P-32 impregnated cloth may not be clinically indicated to treat this disease given the unfavorable depth-dose characteristics. However, a major advantage of using form-fitting cloth is the uniformity with which the dose could be delivered over the skin in areas which are not flat. Increasing the distance between cloth and skin could improve the depth-dose characteristics.

  1. Yeast Interacting Proteins Database: YPR086W, YMR193W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available prey as bait (0) Literature on bait (YPD) 56 Literature on prey (YPD) 8 Literature shared by bait and...and prey 0 Literature sharing score 0 CuraGen (0 or 1) 0 S. Fields (0 or 1) 0 Association (0 or 1,YPD)

  2. Modeling the rovibrationally excited C2H4OH radicals from the photodissociation of 2-bromoethanol at 193 nm.

    Science.gov (United States)

    Ratliff, B J; Womack, C C; Tang, X N; Landau, W M; Butler, L J; Szpunar, D E

    2010-04-15

    This study photolytically generates, from 2-bromoethanol photodissociation, the 2-hydroxyethyl radical intermediate of the OH + ethene reaction and measures the velocity distribution of the stable radicals. We introduce an impulsive model to characterize the partitioning of internal energy in the C(2)H(4)OH fragment. It accounts for zero-point and thermal vibrational motion to determine the vibrational energy distribution of the nascent C(2)H(4)OH radicals and the distribution of total angular momentum, J, as a function of the total recoil kinetic energy imparted in the photodissociation. We render this system useful for the study of the subsequent dissociation of the 2-hydroxyethyl radical to the possible asymptotic channels of the OH + ethene reaction. The competition between these channels depends on the internal energy and the J distribution of the radicals. First, we use velocity map imaging to separately resolve the C(2)H(4)OH + Br((2)P(3/2)) and C(2)H(4)OH + Br((2)P(1/2)) photodissociation channels, allowing us to account for the 10.54 kcal/mol partitioned to the Br((2)P(1/2)) cofragment. We determine an improved resonance enhanced multiphoton ionization (REMPI) line strength for the Br transitions at 233.681 nm (5p (4)P(1/2) distribution of total internal energy, rotational and vibrational, in the C(2)H(4)OH radicals. Then, using 10.5 eV photoionization, we measure the velocity distribution of the radicals that are stable to subsequent dissociation. The onset of dissociation occurs at internal energies much higher than those predicted by theoretical methods and reflects the significant amount of rotational energy imparted to the C(2)H(4)OH photofragment. Instead of estimating the mean rotational energy with an impulsive model from the equilibrium geometry of 2-bromoethanol, our model explicitly includes weighting over geometries across the quantum wave function with zero, one, and two quanta in the harmonic mode that most strongly alters the exit impact parameter. The model gives a nearly perfect prediction of the measured velocity distribution of stable radicals near the dissociation onset using a G4 prediction of the C-Br bond energy and the dissociation barrier for the OH + ethene channel calculated by Senosiain et al. (J. Phys. Chem. A 2006, 110, 6960). The model also indicates that the excited state dissociation proceeds primarily from a conformer of 2-bromoethanol that is trans across the C-C bond. We discuss the possible extensions of our model and the effect of the radical intermediate's J-distribution on the branching between the OH + ethene product channels.

  3. Genome sequences of Mannheimia haemolytica serotype A1 strains D153 and D193 from bovine pneumonia

    Science.gov (United States)

    Here we report two genomes, one complete and one draft, from virulent bovine strains of Mannheimia haemolytica(strains D171 and D35)serotype A2 recovered prior to the field usage of modern antimicrobial drugs....

  4. Development and numerical solution of a mechanistic model for corneal tissue ablation with the 193 nm argon fluoride excimer laser

    Science.gov (United States)

    Fisher, Brian T.; Hahn, David W.

    2007-02-01

    We detail the development and implementation of a global ablation model that incorporates a dynamically changing tissue absorption coefficient. Detailed spectroscopic measurements rule out plasma-shielding effects during the laser-tissue interaction and thereby support a photochemical mechanism. The model predicts ablation rate behavior that agrees well with a variety of experimental ablation rate data and that substantially deviates from a static Beer-Lambert model. The dynamic model predicts an enhancement in the tissue absorption coefficient of about 25%-50% as compared with the initial, static value. In addition, the model predicts an increase in the tissue ablation rate as corneal hydration increases, which may provide additional insight into variations in refractive surgery outcome.

  5. Coaxial Measurement of the Translational Distribution of CS Produced in the Laser Photolysis of CS2 at 193nm.

    Science.gov (United States)

    1983-11-04

    multiplicity during a transition. A similar conclusion was reached earlier (4,5) using methods that are entirely different from those used .. in these...IKasakawi, and R. Bersohn, J. Chemn. Phys. 72, 4058 (1980). *2. M.C. Addison, C.D. Bryne and R.J. Donovan, Chem. Phys. Letters, 64, 57 (1979). *3. J.E

  6. SU-F-T-193: Evaluation of a GPU-Based Fast Monte Carlo Code for Proton Therapy Biological Optimization

    Energy Technology Data Exchange (ETDEWEB)

    Taleei, R; Qin, N; Jiang, S [UT Southwestern Medical Center, Dallas, TX (United States); Peeler, C [UT MD Anderson Cancer Center, Houston, TX (United States); Jia, X [The University of Texas Southwestern Medical Ctr, Dallas, TX (United States)

    2016-06-15

    Purpose: Biological treatment plan optimization is of great interest for proton therapy. It requires extensive Monte Carlo (MC) simulations to compute physical dose and biological quantities. Recently, a gPMC package was developed for rapid MC dose calculations on a GPU platform. This work investigated its suitability for proton therapy biological optimization in terms of accuracy and efficiency. Methods: We performed simulations of a proton pencil beam with energies of 75, 150 and 225 MeV in a homogeneous water phantom using gPMC and FLUKA. Physical dose and energy spectra for each ion type on the central beam axis were scored. Relative Biological Effectiveness (RBE) was calculated using repair-misrepair-fixation model. Microdosimetry calculations were performed using Monte Carlo Damage Simulation (MCDS). Results: Ranges computed by the two codes agreed within 1 mm. Physical dose difference was less than 2.5 % at the Bragg peak. RBE-weighted dose agreed within 5 % at the Bragg peak. Differences in microdosimetric quantities such as dose average lineal energy transfer and specific energy were < 10%. The simulation time per source particle with FLUKA was 0.0018 sec, while gPMC was ∼ 600 times faster. Conclusion: Physical dose computed by FLUKA and gPMC were in a good agreement. The RBE differences along the central axis were small, and RBE-weighted dose difference was found to be acceptable. The combined accuracy and efficiency makes gPMC suitable for proton therapy biological optimization.

  7. 15 CFR Appendix B to Subpart R of... - Minor Projects for Purposes of § 922.193(a)(2)(iii)

    Science.gov (United States)

    2010-01-01

    ... water and drift material. (b) Spring piles and pile clusters when their design and purpose is usual for... values or interests, including navigation and water quality. (h) Fish or wildlife habitat structures..., water monitoring devices, water quality testing devices, survey devices, and core sampling devices, if...

  8. Bogidiella stocki, a new species from the Sinai Peninsula (Amphipoda, Bogidiellidae) (Contribution to the knowledge of the Amphipoda 193)

    NARCIS (Netherlands)

    Karaman, Gordan S.

    1990-01-01

    The new species of the family Bogidiellidae (Amphipoda Gammaridea), Bogidiella stocki, n. sp., is described and figured from the subterranean waters of Beer Gideih (Sinai peninsula), and its taxonomical status is discussed.

  9. Molecular mechanisms of cancer

    National Research Council Canada - National Science Library

    Weber, Georg F

    2007-01-01

    ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 45 4. Cellular Senescence . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 193 5...

  10. American Recovery and Reinvestment Act (ARRA) FEMP Technical Assistance US General Serices Administration - Project 193, John W. Bricker Federal Building, Columbus, OH

    Energy Technology Data Exchange (ETDEWEB)

    Arends, J.; Sandusky, William F.

    2010-05-31

    This report documents the findings from an onsite audit of the John W. Bricker Federal building located in Columbus, Ohio. The Federal landlord for this building is the General Services Administration (GSA). The focus of the audit was to identify various no-cost or low-cost energy efficiency opportunities that, once implemented, would either reduce electrical and gas consumption or increase the operational efficiency of the building. This audit also provided an opportunity to identify potential capital cost projects that should be considered in the future to acquire additional energy (electric and gas) and water savings to further increase the operational efficiency of the building.

  11. « Storehouses and systems at Persepolis. Evidence from the Persepolis Fortification Tablets », JESHO, 42, 2, (1999), pp. 151-193.

    OpenAIRE

    Boucharlat, Rémy

    2010-01-01

    Depuis quelques années l’A. travaille sur les Persepolis Fortification Tablets comme documentation  inépuisable  sur l’économie impériale. Dans cet article, il s’intéresse aux procédures de collecte des taxations sous forme de produits et leur redistribution comme provisions ; ces opérations ont lieu dans les entrepôts à Persépolis et dans plusieurs points de l’Élam  qui pour lui exclut la Susiane. Pour cela, il tente de définir les personnages chargés de ce double mouvement, leur fonction...

  12. The development and validation of an analytical method for doxycycline quantification in human plasma - doi:10.5020/18061230.2007.p193

    Directory of Open Access Journals (Sweden)

    Geysa Aguiar

    2012-01-01

    Full Text Available The aim of this study was to develop and validate a simple, quick and sensitive assay for determination of doxycycline concentration in human plasma by High Performance Liquid Chromatography (HPLC. Doxycycline and Oxytetracycline (internal standard were extracted from 0,5 mL human plasma into ethyl acetate. The HPLC system was operated isocratically at controlled temperature (30°C with reversed phase Phenomenex Luna C8 column (150 mm x 4.6mm i.d.; 4 ?m particle size and using a mobile phase consisting in water: acetonitrile: tetrahydrofuran (80:15:5 v/v/v adjusted to pH 2.5, at a flow rate of 1.0 mL/min. Detection was achieved with a UV detector at 357 nm. Method validation investigated parameters such as the sensitivity, linearity (r2= 0.9946, precision, accuracy, recovery and stability. The limit of quantification was 0,25 ?g/mL. Under the assay conditions, doxycycline and oxytetracycline had retention times of 7,5 and 2,4 minutes, respectively. No interferences with endogenous compounds or with anticoagulant were observed. The mean recovery of doxycycline was 84.57%, and 80.73% for the intern standard at working concentration (20?g/mL. The method showed to be precise and accurate both for analyses held in a same day (intra-day as in different days (inter-days. A good stability of doxycycline and oxytetracycline was observed during extraction and analysis, when stored over a fourmonth period at -20°C, on the auto sample during 24 hours and to 3 freeze-thaw cycles. The present method is suitable for sensitive, precise and accurate determination of doxycycline concentrations in human plasma, within the limits established for this type of analyses

  13. Circulating miR-192 and miR-193b are markers of prediabetes and are modulated by an exercise intervention

    DEFF Research Database (Denmark)

    Párrizas, Marcelina; Brugnara, Laura; Esteban, Yaiza

    2015-01-01

    CONTEXT: Diabetes is frequently diagnosed late, when the development of complications is almost inevitable, decreasing the quality of life of patients. However, early detection of affected individuals would allow the implementation of timely and effective therapies. OBJECTIVE: Here we set to desc...

  14. Detailed gravimetric geoid confirmation of short wavelength features of sea surface topography detected by the Skylab S-193 altimeter in the Atlantic Ocean

    Science.gov (United States)

    Marsh, J. G.; Vincent, S.; Mcclinton, A. T.; Chang, E. S.

    1975-01-01

    A detailed gravimetric geoid was computed for the Northwest Atlantic Ocean and Caribbean Sea area in support of the calibration and evaluation of the GEOS-C altimeter. This geoid, computed on a 15 ft. x 15 ft. grid was based upon a combination of surface gravity data with the GSFC GEM-6 satellite derived gravity data. A comparison of this gravimetric geoid with 10 passes of SKYLAB altimeter data is presented. The agreement of the two data types is quite good with the differences generally less than 2 meters. Sea surface manifestations of numerous short wavelength (approximately 100 km) oceanographic features are now indicated in the gravimetric geoid and are also confirmed by the altimetry data.

  15. Molecular characterization of Salmonella enterica serovar 4,[5],12:i:- DT193 ASSuT strains from two outbreaks in Italy

    DEFF Research Database (Denmark)

    Barco, Lisa; Ramon, Elena; Cortini, Enzo

    2014-01-01

    BlnI-PFGE and MLVA generated different profiles among the strains related to that outbreak. Combining the PFGE profiles obtained by XbaI and BlnI and comparing them with the MLVA profiles, the two methods grouped the same isolates based on identity. Moreover, genomic deletions of the genes included...

  16. SU-F-J-193: Efficient Dose Extinction Method for Water Equivalent Path Length (WEPL) of Real Tissue Samples for Validation of CT HU to Stopping Power Conversion

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, R; Baer, E; Jee, K; Sharp, G; Flanz, J; Lu, H [Massachusetts General Hospital and Harvard Medical School, Boston, MA (United States)

    2016-06-15

    Purpose: For proton therapy, an accurate model of CT HU to relative stopping power (RSP) conversion is essential. In current practice, validation of these models relies solely on measurements of tissue substitutes with standard compositions. Validation based on real tissue samples would be much more direct and can address variations between patients. This study intends to develop an efficient and accurate system based on the concept of dose extinction to measure WEPL and retrieve RSP in biological tissue in large number of types. Methods: A broad AP proton beam delivering a spread out Bragg peak (SOBP) is used to irradiate the samples with a Matrixx detector positioned immediately below. A water tank was placed on top of the samples, with the water level controllable in sub-millimeter by a remotely controlled dosing pump. While gradually lowering the water level with beam on, the transmission dose was recorded at 1 frame/sec. The WEPL were determined as the difference between the known beam range of the delivered SOBP (80%) and the water level corresponding to 80% of measured dose profiles in time. A Gammex 467 phantom was used to test the system and various types of biological tissue was measured. Results: RSP for all Gammex inserts, expect the one made with lung-450 material (<2% error), were determined within ±0.5% error. Depends on the WEPL of investigated phantom, a measurement takes around 10 min, which can be accelerated by a faster pump. Conclusion: Based on the concept of dose extinction, a system was explored to measure WEPL efficiently and accurately for a large number of samples. This allows the validation of CT HU to stopping power conversions based on large number of samples and real tissues. It also allows the assessment of beam uncertainties due to variations over patients, which issue has never been sufficiently studied before.

  17. Energy and cost savings analysis of Wood Burning Boiler Plant, Fort Stewart, Georgia: Final report, Validation of ECIP Project No. 193: DOD, Energy Conservation Investment Program (ECIP)

    Energy Technology Data Exchange (ETDEWEB)

    Broders, M.A.; Miller, D.R.

    1987-08-01

    An Energy Conservation Investment Program (ECIP) project to install a 94,900 lb steam per hour wood burning boiler in the Fort Stewart Central Energy Plant was selected by the US Army for validation by the Oak Ridge National Laboratory. This ECIP project was justified on the basis of fuel cost savings and the use of a renewable energy source: wood waste, which is abundantly available at Fort Stewart, Georgia. This report documents the results of a 1-year postretrofit study designed to validate the energy and cost savings attributed to the installation of the new wood burning boiler. During the postretrofit validation study period (FY 1986), the new wood burning boiler produced approximately 90% of the steam required by the Central Energy Plant to meet the seasonal heating and cooling demands of Fort Stewart. In doing so, over 2,880,000 gal of No. 5 fuel oil (a nonrenewable energy source) was conserved. With full consideration given to the increase in electrical energy required to operate the new Wood Burning Boiler Plant addition, an annual nonrenewable energy savings of over 400,000 MBtu is projected. Based on the results of a life cycle cost analysis performed on this ECIP project, a first-year savings of over $1,200,000 is estimated. The resultant discounted savings ratio is 3.36, and the estimated simple payback period is 6.7 years. It was concluded that installation and operation of a wood burning boiler at a military installation such as Fort Stewart can result in significant cost and nonrenewable energy savings.

  18. Environmental Assessment: MCON Project P-193, Waterfront Improvements for Wharves K10-K11, Pearl Harbor Naval Complex, O'ahu, Hawaii

    National Research Council Canada - National Science Library

    Renard, Gail; Fee, Thomas A

    2004-01-01

    ...) in the Pearl Harbor Naval Complex, Oahu, Hawaii. Based on information gathered during preparation of the EA, the Department of the Navy finds that the proposed waterfront improvements for Wharves K10-K11 at the FISC Pearl, Oahu, Hawaii will...

  19. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  20. δ37Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.

  1. δ³⁷Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine

  2. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  3. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  4. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  5. Production cross section of At radionuclides from 7Li+natPb and 9Be+natTl reactions

    Science.gov (United States)

    Maiti, Moumita; Lahiri, Susanta

    2011-12-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from 6,7Li- and 9Be-induced reactions on natural lead and thallium targets, respectively. The production of astatine radionuclides were investigated experimentally with two heavy-ion-induced reactions: 9Be + natTl and 7Li + natPb. Formation cross sections of the evaporation residues, 207,208,209,210At, produced in the (HI,xn) channel, were measured by the stacked-foil technique followed by off-line γ spectrometry at low incident energies (<50 MeV). Measured excitation functions were interpreted in terms of a compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach models. Measured cross-section values are lower than the respective theoretical predictions.

  6. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Koziorowski, J

    1998-10-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on {sup 211}At and {sup 124}I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[{sup 211}At]astato-2`-deoxyuridine (AUdR) and N-succinimidyl-4-[{sup 211}At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [{sup 124}I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[{sup 124}I]iodo-2`-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for

  7. Grapefruit juice and its constituents augment the effect of low pH on inhibition of survival and adherence to intestinal epithelial cells of Salmonella enterica serovar Typhimurium PT193.

    Science.gov (United States)

    Yin, Xianhua; Gyles, Carlton L; Gong, Joshua

    2012-09-03

    The present study examined the survival of Salmonella Typhimurium and its adherence to intestinal epithelial cells following inoculation into grapefruit juice and apple cider. Both liquids significantly inactivated S. Typhimurium (0.8-2.2 log reduction compared to the control); surviving Salmonella in grapefruit juice was 1.0-1.4 log lower than in apple cider at 24h incubation. Grapefruit juice contains the antimicrobial substances naringin (NAR) and naringenin (NGE); however, the effect of grapefruit juice on growth and adherence of S. Typhimurium appeared not to be related to NAR. NGE at 100-200 μg/mL reduced the adherence of Salmonella to epithelial cells by 57% and 73% compared to the control (TSB at pH 7.4) after 24 h treatment, but stimulated rather than inhibited growth of Salmonella. However, when NGE at 200 μg/mL was added to TSB at pH 3.5 Salmonella survival and adherence to intestinal epithelial cells were reduced by 2.5 log and 79%, respectively, compared to the control (TSB at pH 3.5). Addition of NGE to apple cider also caused a slight reduction in the survival of S. Typhimurium, but did not enhance the inhibitory effect on adherence due to apple cider. These data showed that low pH augmented the inhibitory effect of NGE on growth and adherence of Salmonella to intestinal epithelial cells, but the mechanism of the observed augmentative effect is not clear. Understanding the mechanism of the interaction between low pH and NGE and its inhibitory effect on growth and adherence of enteric pathogens may lead to the development of new antibacterial agents. Crown Copyright © 2012. Published by Elsevier B.V. All rights reserved.

  8. L'aristocrazia senatoria ispanica, nel corso del Ule del IVsecólo d. C, dall'awento di Settimio Severo alia morte di Teodosio (193 d.C-395 d.C

    Directory of Open Access Journals (Sweden)

    Chantal GABRIELLI

    2009-11-01

    Full Text Available RIASSUNTO: Questo articolo analizza l'aristocrazia senatoria, originaria delle tre province romane della Spagna (Baetica, Lusitania ed Hispania Citerior nel periodo tardo imperiale, dall'awento di Settimio Severo alia morte di Teodosio. 11 lavoro presenta una lista dei membri dell'aristocrazia senatoria ispanica e analizza l'estrazione sociale di questi personaggi, la loro distribuzione geográfica, il ruólo politico ed amministrativo che svolsero nella Spagna e nel resto dell'Impero ed i loro rapporti con il Senato di Roma e gli imperatori. L'aristocrazia senatoria spagnola non é mai stata oggetto di uno studio prosopografico completo e questa analisi si propone di esaminare come questo numeroso grupo di senatori spagnoli reagisca di fronte agli eventi del III e del IV secólo d. C. ABSTRACT: This article analyses the senatorial aristocracy, born in one of the three roman provinces of Spain (Baetica, Lusitania and Hispania Citerior in the late imperial period, from the reign of the emperor Septimius Severus to the death of Theodosius the Great. The job presents a list of the members of the Spanish senatorial aristocracy, anol analyses the social extraction of these important persons, their geographical distribution, the political and administrative part that they played in Spain and in the other partes of the Empire and their relations with the Senate of Rome and the emperors. The Spanish senatorial aristocracy hasn't ever been object of a complete prosopographic study and this analysis examines how these numerous senators behave in front of the events of the 3th and the 4th century A.D.

  9. Test accuracy at different cut-offs when plasma concentrations of metabolic indicators are used to detect decreased fertility in dairy cows (Poster topic 01, Poster 27, p. 193)

    DEFF Research Database (Denmark)

    Lomander, H; Gustafsson, H; Svensson, C

    Negative energy balance is a known risk factor for decreased fertility in dairy cows. This study evaluates the accuracy of measuring plasma concentrations of two indicators of negative energy balance, non esterified fatty acids (NEFA) and β-hyrdroxy buturate (BHBA), when they are used to predict ...

  10. Multibeam collection for KN193-06: Multibeam data collected aboard Knorr from 2008-06-29 to 2008-07-12, departing from St. George's, Bermuda and returning to Norfolk, VA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  11. VIDEIRA, Sandra Lúcia; COSTA, Pierre Alves; FAJARDO, Sérgio. (org. Geografia Econômica: (re leituras contemporâneas. Rio de Janeiro: Letra Capital, 2011. 193 p.

    Directory of Open Access Journals (Sweden)

    Maria Terezinha Serafim Gomes

    2012-04-01

    Full Text Available O livro aqui apresentado “Geografia Econômica: (re leituras contemporâneas” é uma coletânea com 9 capítulos, reunindo pesquisadores das regiões Sul, Sudeste e Centro-Oeste do Brasil, que se debruçam sobre a temática da Geografia Econômica. No prefácio, os organizadores apresentam ao leitor a riqueza de temas relacionados à Geografia Econômica abordados no livro, a saber: América do Sul, economia mundial, crise energética, indústria do petróleo, tradings agroindústrias, cooperativas, informação, internacionalização do capital, empresas internacionais, capital estrangeiro, dinâmica econômica, logística e reestruturação produtiva.

  12. Electromyographic activity and scapular dyskenesia in athletes with and without shoulder impingement syndrome. http://dx.doi.org/10.5007/1980-0037.2013v15n2p193

    Directory of Open Access Journals (Sweden)

    Rodrigo Cappato de Araújo

    2013-03-01

    Full Text Available The objective of this study was to evaluate the presence of scapular dyskinesis and pain, satisfaction and function levels, as well as analyze the activation of scapular stabilizing muscles during isometric tasks of shoulder abduction in athletes with and without SIS. Thirty men athletes were divided into two groups: SIS group and Control group. The volunteers answered the Penn Shoulder Score questionnaire translated into Portuguese, which evaluates pain, dysfunction, and satisfaction with the shoulder. They were also evaluated for the presence of scapular dyskinesis through the Slide Scapular Lateral Test. The electromyographic activity of the upper trapezius (UT, middle trapezius (MT, lower trapezius (LT, and serratus anterior (SA muscles was evaluated during the isometric shoulder abduction in the frontal and scapular planes at angles of 45º, 90°, and 120°. The SIS group had a higher indication of pain and scapular dyskinesis when compared to control group. In the SIS group, higher values of electromyographic ratios between UT/LT and UT/SA were observed in the frontal plane in relation to the scapular plane. The conclusion can be made that pain, scapular dyskinesis, and altered muscle activation pattern was more frequent in the SIS group compared to the Control group. Therefore, exercises that emphasize the scapular muscles should be considered when planning rehabilitation programs for the SIS.

  13. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...

  14. ORF Alignment: NC_006582 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available KVVVDLHGQASRTAVQRWINEGAVLVNEKEVKTNSKVQQGDKVTLTEPAAQEVELLG 60 ... Query: 134 RIDKDTSGLIMAAKHDAAHEHLAAQLKAKTTERRY...KAIVHGVIPHAKGTIDAPIGRDPKD 193 ... RIDKDTSGLIMAAKHDAAHEHLAAQLKAKTTERRYKAIVHGVIPHAKGTIDAPIGRDPKD Sbjct: 121 RIDKDTSGLI

  15. ORF Alignment: NC_006138 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available L 60 ... Query: 134 DGTCRNLTAEQIAEKEAAGAPYVLRFRVPECESVSYEDKIAGTIRVARSEIDDFVIVRSN 193 ... DGTCRNLTAEQIAEKEAAGAPYVLRFRVPECES...VSYEDKIAGTIRVARSEIDDFVIVRSN Sbjct: 121 DGTCRNLTAEQIAEKEAAGAPYVLRFRVPECES

  16. LARANJEIRA, Lia Dias. O culto da Serpente no reino de Uidá: um estudo da literatura de viagem europeia, séculos XVII e XVIII. Salvador: EdUFBA. 2015. 193p. (Dossiê:As fontes para a História da África

    Directory of Open Access Journals (Sweden)

    Thiago Henrique Mota

    2016-04-01

    Full Text Available Resumo: Fruto de investigações em fontes europeias para compreensão da história africana e resultado de investidas anteriores da autora na história africana, durante a graduação, o livro destaca-se pelo cuidado metodológico, que a possibilitou acessar informações que vão além da superfície textual. A análise da intertextualidade percorre toda a obra, marcada pelos diferentes lugares sociais ocupados pelos cronistas sob escrutínio, que influenciaram diretamente no sentido produzido dentro de seus textos, no tocante ao objeto central de interesse de Lia Laranjeira, que lhe nomeia o livro: O culto da Serpente no reino de Uidá.Palavras-chave: Uidá, história AfricanaAbstract: As a result of investigations in European sources for understanding of African history and the result of previous advances the author in African history, during graduation, the book stands out for methodological care that enabled access information beyond the textual surface. The analysis of intertextuality runs the work, marked by different social spaces occupied by the chroniclers under scrutiny, which directly influenced the effect produced within their texts, regarding the central object of interest Lia Laranjeira appointing him the book: The Cult Serpent in Ouidah kingdom.Keywords: Ouidah, African historyRecebido em: 23/12/2015  – Aceito em 04/04/2016

  17. Characterization of the microbiota of the skin and oral cavity of Oreochromis niloticusCaracterização da microbiota da pele e cavidade oral de Oreochromis niloticusdoi:10.12662/2317-3076jhbs.v4i3.767.p193-197.2016

    Directory of Open Access Journals (Sweden)

    Edmar Maciel Lima Junior

    2016-09-01

    Full Text Available Introduction: Fish are usually exposed to higher microbial loads than land or air animals. The microbiota of fish mostly consists of Pseudomonas spp., Aeromonas spp., Shewanella putrefasciens, Acinetobacter spp. and Moraxella spp. The objective of this study was to analyze the oral cavity, and skin tissue microbiota on the Nile tilapia (Oreochromis niloticus, a fish species raised commercially in Brazil. Methods: Samples were collected from the oral cavity and skin of 20 Nile tilapia specimens (Oreochromis niloticus, each weighing approximately 1,000 grams. The samples were cultures for quantitative analysis on sheep blood agar (SBA and chromID™ CPS® agar (CPS. Results: Eleven different bacterial species were identified on CPS and SBA plates. Gram-negative species were the most prevalent, while gram-positive Globicatella spp, Streptococcus spp and Enterococcus faecalis were also found. Pseudomonas aeruginosa species were isolated from all samples. Gram-positive Enterococcus faecalis was found in 70 and 60% of the skin and oral samples, respectively. Conclusion: For all samples studied, the microbial load was less than 100,000 CFU/g of tissue. This value is a cutoff standardized for the American Society of Microbiology to differentiate the causal agent from the colonizers. In light of this result and considering the absence of infectious signs in the fish samples, we conclude that the CFU values found in this study reflect a normal, non-infectious colonization/microbiota.

  18. Dicty_cDB: Contig-U13016-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tntgntg 72 Query: 73 atttngatccnaaaccnttcntttgtaaaactgcngctgntgtttcngttggngttgctg 132 ||||||||||||||||||||||...|||||||||||||||||||||||||||||||||||||| Sbjct: 73 atttngatccnaaaccnttcntttgtaaaactgcngctgntgtttcngttggngttgct...gtntttatttttgnnggnaanaaag 192 Query: 193 gttatgacttntggaaancnagtcaaggngntncnatggccccntcnaatgccnatcccc 252 ||...|||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 193 gttatgacttntggaaancnagtcaaggngntncnatggccccntcnaatgccna...e-30 Identities = 165/186 (88%) Strand = Plus / Plus Query: 71 tgatttngatccnaaaccnttcntttgtaaaactgcngctgntgt

  19. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GWITEWQGAWERER Sbjct: 1 ... PTLPTGDGLVLRPWRTEDAPAVHVAFQDPVMHQWHARAADSEEEVRGWITEWQGAWERER 60 ... Query: 143 IGFQRLELLHAVANDA...SCRVAQKTGFALEGTKRKAVLHPDGWHDMHLHARV 193 ... IGFQRLELLHAVANDASCRVAQKTGFALEGTKRKAVLHPDGWHDMHLHARV Sbjct: 121 IGFQRLELLHAVANDASCRVAQKTGFALEGTKRKAVLHPDGWHDMHLHARV 171

  20. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  1. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  2. Nuclear and in-source laser spectroscopy with the ISAC yield station

    Energy Technology Data Exchange (ETDEWEB)

    Kunz, Peter, E-mail: pkunz@triumf.ca; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning [TRIUMF, 4004 Wesbrook Mall, Vancouver, British Columbia V6T 2A3 (Canada); Andreoiu, Corina; Wong, Fiona [Department of Chemistry, Simon Fraser University, Burnaby, British Columbia V5A 1S6 (Canada)

    2014-05-15

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10{sup 11} ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of {sup 46}K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  3. Nuclear and in-source laser spectroscopy with the ISAC yield station.

    Science.gov (United States)

    Kunz, Peter; Andreoiu, Corina; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning; Wong, Fiona

    2014-05-01

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10(11) ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of (46)K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  4. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 86; Issue 2. Issue front cover thumbnail Issue back cover thumbnail. Volume 86, Issue 2. February 2016, pages 193-494. Proceedings of UNICOS-2014 International Workshop on Unification and Cosmology after Higgs Discovery and BICEP2. pp 193-193. Organizing ...

  5. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 71; Issue 2. Issue front cover thumbnail. Volume 71, Issue 2. August 2008, pages 193-436. Proceedings of the International Workshop and Conference on Statistical Physics Approaches to Multidisciplinary Problems. pp 193-193. Foreword · S B Santra S S Manna.

  6. Radiopharmaceutical chemistry of targeted radiotherapeutics, part 4: Strategies for211At labeling at high activities and radiation doses of211At α-particles.

    Science.gov (United States)

    Pozzi, Oscar R; Zalutsky, Michael R

    2017-03-01

    Alpha particles are radiation of high energy and short range, properties that can lead to radiolysis-mediated complications in labeling chemistry at the high radioactivity levels required for clinical application. In previous papers in this series, we have shown that radiation dose has a profound effect on the astatine species that are present in the labeling reaction and their suitability for the synthesis of N-succinimidyl 3-[ 211 At]astatobenzoate. The purpose of this study was to evaluate the effects of adding N-chlorosuccinimide (NCS) to the methanol solution used for initial isolation of 211 At after distillation, a process referred to as 211 At stabilization, on 211 At chemistry after exposure to high radiation doses. High performance liquid chromatography was used to evaluate the distribution of 211 At species present in methanol in the 500-65,000Gy radiation dose range and the synthesis of SAB from N-succinimidyl 3-(tri-n-butylstannyl)benzoate in the 500-120,000Gy radiation dose range using different 211 At timeactivity combinations under conditions with/without 211 At stabilization. In the absence of NCS stabilization, a reduced form of astatine, At(2), increased with increasing radiation dose, accounting for about half the total activity by about 15,000Gy, while with stabilization, At(2) accounted for 60,000Gy. SAB yields without stabilization rapidly declined with increasing dose, falling to ~20% at about 5000Gy while with stabilization, yields >80% were obtained with 211 At solutions stored for more than 23h and receiving radiation doses >100,000Gy. Adding NCS to the methanol solution used for initial isolation of 211 At is a promising strategy for countering the deleterious effects of radiolysis on 211 At chemistry. This strategy could facilitate the ability to perform 211 At labeling at sites remote from its production and at the high activity levels required for clinical applications. Copyright © 2016 Elsevier Inc. All rights reserved.

  7. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC193 (Link to dictyBase) - - - Contig-U16382-1 VFC193P (Link... to Original site) VFC193F 338 VFC193Z 430 VFC193P 768 - - Show VFC193 Library VF (Link to library) Clone ID VFC193 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...producing significant alignments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 ...map 1685067-2090751 strain AX4, complete sequence. 654 0.0 7 X03281 |X03281.1 Dict

  8. The Effect of Knowledge Management Systems on Organizational Performance. Do Soldier and Unit Counterinsurgency Knowledge and Performance Improve Following ’Push’ or ’Adaptive-Push’ Training

    Science.gov (United States)

    2009-01-01

    at Cisco and Enron provided a sense of overconfidence in predictive business models at Cisco and in the online market exchange at Enron that led to...Video reenactments were developed by the battle command training center (BCTC), using videogame software and adding realistic audio. The audio...Secure Mosque 193 Secure market 193 Secure/check on school 193 Establish high ground 194 Secure site through dominant terrain 194 Secure site 195 Secure

  9. Dicty_cDB: VFE631 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available musculus bone marrow macrophag... 193 4e-48 AK151426_1( AK151426 |pid:none) Mus musculus bone marrow macrophag...AK151142_1( AK151142 |pid:none) Mus musculus bone marrow macrophag... 193 4e-48 AJ238851_1( AJ238851 |pid:none)...AK151057_1( AK151057 |pid:none) Mus musculus bone marrow macrophag... 193 4e-48 CR926481_1( CR926481 |pid:none)

  10. Photodissociation dynamics of polyatomic molecules

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Hequan [Iowa State Univ., Ames, IA (United States)

    1998-02-23

    This report consists of five studies as follows: A laser photofragmentation time-of-flight mass spectrometric study of acetophenone at 193 and 248 nm; A 193 nm laser photofragmentation time-of-flight mass spectrometric study of dimethylsulfoxide; 193 nm laser photofragmentation time-of-flight mass spectrometric study of HSCH2CH2SH; Thiophene biradical decay of the primary laser photofragmentation product at 193 nm; and Scattering cross sections for O(3P)[SO(X,3Σ-)] + He[Ne, Ar, Kr]. Chapters are included for the introduction and general conclusions.

  11. Journal of Earth System Science | News

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 120; Issue 2. Volume 120, Issue 2. April 2011, pages 193-336. pp 193-204. Slab detachment of subducted Indo-Australian plate beneath Sunda arc, Indonesia · Bhaskar Kundu V K Gahalaut · More Details Abstract Fulltext PDF. Necking, tearing, slab detachment ...

  12. Development of Antibodies Against Novel Cell Surface Proteins In Hormone Refractory Prostate Cancer. Addendum

    Science.gov (United States)

    2011-07-01

    et al. N-cadherin switching occurs in high Gleason grade prostate cancer. Prostate 66, 193-199 (2006). 5. Gravdal, K., Halvorsen , O.J., Haukaas, S.A...high Gleason grade prostate cancer. Prostate 66, 193–199 (2006). 20. Gravdal, K., Halvorsen , O.J., Haukaas, S.A. & Akslen, L.A. A switch from E-cadherin

  13. Illness Behavior and Transitional States: A Study of Outpatient Rates and Symptom Presentation in Relation to Troop Deployment during Peacetime. Types and Rates of Outpatient Sick Call Visits of Active Duty Soldiers and Their Family Members, June 1980 - May 1981

    Science.gov (United States)

    1982-10-27

    DEVIATION) (5.0) I AKN TIME AT POST, MONTHS 19.3 TDARD DEVIATION) (19.3) A-Wwab-f No. - - - - - - - -14- TABLE 6: NUMBER AND ANNUAL RATE PER 100 OF THE 20...Module OTHER AND UNCODABLE DOQ1-D249 Infective end Parasitf.c Diseases, Neoplasms, and Endocrine, Nutritional and Metabolic Diseases. D950-D999

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 193 of 193 ... Vol 15, No 1 (2013), The effect of spatial planning patterns on distribution of pedestrians in public spaces of residential neighbourhoods in the city of Nairobi, Abstract. M Makworo, BO Moirongo, C Mireri. Vol 13, No 1 (2011), The effect of surface albedo and grain size distribution on eveporation losses ...

  15. 76 FR 17426 - Agency Information Collection Activities: Application for Waiver of Passport and/or Visa (Form I...

    Science.gov (United States)

    2011-03-29

    ... Waiver of Passport and/or Visa (Form I-193) AGENCY: U.S. Customs and Border Protection (CBP), Department... collection requirement concerning the Application for Waiver of Passport and/or Visa (Form I-193). This...: Title: Application for Waiver of Passport and/or Visa. OMB Number: 1651-0107. Form Number: CBP Form I...

  16. Real-time directional wave data collection

    Digital Repository Service at National Institute of Oceanography (India)

    AshokKumar, K.; Diwan, S.G.; Pednekar, P.S.

    stream_size 8 stream_content_type text/plain stream_name Int_Conf_Ocean_Eng_2001_1_193.pdf.txt stream_source_info Int_Conf_Ocean_Eng_2001_1_193.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  17. Characteristics of Low-latitude Coronal Holes near the Maximum of Solar Cycle 24

    DEFF Research Database (Denmark)

    Hofmeister, Stefan J.; Veronig, Astrid; Reiss, Martin A.

    2017-01-01

    We investigate the statistics of 288 low-latitude coronal holes extracted from SDO/AIA-193 filtergrams over the time range of 2011 January 01–2013 December 31. We analyze the distribution of characteristic coronal hole properties, such as the areas, mean AIA-193 intensities, and mean magnetic fie...

  18. Glove Punctures in Orthopedics and Trauma Surgery: Frequency ...

    African Journals Online (AJOL)

    The surgeons' glove was the most frequently perforated 19.3% (85/440). The Index finger and thumb were the most commonly perforated digits 70.8% and 15.6% of perforations respectively. The outer glove had a higher rate compared to inner glove 80.7% to 19.3% respectively. Surgeries lasting more than 90minutes were ...

  19. An Analytical History of Provider Organization Support within Navy Enterprise: Naval Supply Systems Command

    Science.gov (United States)

    2011-12-01

    Journal of Change Management , 10, 2 (2010): 175-193...T. By, “Organisational Change Management: A Critical Review,” Journal of Change Management , 5, 4 (2005), 370. 24 result of their actions or...Drivers and the Organizational Change Process: A Review and Synthesis.” Journal of Change Management , 10, 2 (2010): 175-193. 122 THIS

  20. Intense predation on ascidians by a trunk fish, Ostracion immaculatus (Temminck et Schlege) (Pisces:Ostracidae)

    Digital Repository Service at National Institute of Oceanography (India)

    Raveendran, T.V.; Harada

    stream_size 9 stream_content_type text/plain stream_name Publ_Seto_Mar_Biol_Lab_37_193.pdf.txt stream_source_info Publ_Seto_Mar_Biol_Lab_37_193.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 193 of 193 ... Vol 8 (2010), Socio economic characteristics, micro-credit and technical efficiency of poultry farmers in Lagelu Local Government Area of Oyo State, ... Vol 9 (2011), Use of Lactic Acid Bacteria as Probiotic for Promoting Growth and Nutrient Utilization in Nile Tilapia Oreochromis Niloticus, Abstract.

  2. 8 CFR 103.12 - Definition of the term “lawfully present” aliens for purposes of applying for Title II Social...

    Science.gov (United States)

    2010-01-01

    ... aliens for purposes of applying for Title II Social Security benefits under Public Law 104-193. 103.12... applying for Title II Social Security benefits under Public Law 104-193. (a) Definition of the term an...-Haitian entrants, as defined in section 202(b) Pub. L. 99-603, as amended; (iv) Family Unity beneficiaries...

  3. Composition of heteropods in the Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Aravindakshan, P.N.; Stephen, R.

    stream_size 4 stream_content_type text/plain stream_name 2_Workshop_Scient_Result_FORV_Sagar_Sampada_Proc_1996_193.pdf.txt stream_source_info 2_Workshop_Scient_Result_FORV_Sagar_Sampada_Proc_1996_193.pdf.txt Content-Encoding ISO-8859...

  4. Dicty_cDB: Contig-U12668-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s / Plus Query: 13 aaaaagggacttgngagtntgntgatttngatccnaaaccnnnnnnnngnaaaantgntg 72 |||||||||||||||||||||||||...|||||||||||||||| || |||||||||||| Sbjct: 13 aaaaagggacttgngagtntgntgatttngatccnaaaccnttnntttgnaaaantgntg 72 Q...aaaggntntgnntnctggaaancnagncaaggngnttcaa 192 Query: 193 nggccccntnaaangccnatcccctt 218 |||||||||||||||||||||...||||| Sbjct: 193 nggccccntnaaangccnatcccctt 218 >Contig-U11508-1 (Contig-U11508-1Q) /CSM_Contig/Contig-U1150...us Query: 13 aaaaagggacttgngagtntgntgatttngatccnaaaccnnnnnnnngnaaaantgntg 72 ||||

  5. Dicty_cDB: Contig-U13159-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ntities = 254/254 (100%) Strand = Plus / Plus Query: 13 aaaaagggacttgngagtttgntgatttngatccnaaaccnttnntttgnaa...aactgntg 72 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 13 aaaaagggacttgngagtttgntgatttngatccna...ttttggtggnaaaaaaggttntgnctactggaaancaagtcaaggngntncna 192 Query: 193 nggccncntnaaangccna...||||| Sbjct: 193 nggccncntnaaangccnatcccctttangaaancnatccntcaggnggngaaaanncna 252 Query: 253 tttntnctagcccc .../235 (97%) Strand = Plus / Plus Query: 13 aaaaagggacttgngagtttgntgatttngatccnaaaccnttnntttgnaaaactgntg 72 ||

  6. NCBI nr-aa BLAST: CBRC-CJAC-01-1298 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1298 ref|ZP_01054714.1| type I secretion target repeat protein [Roseob...acter sp. MED193] gb|EAQ47205.1| type I secretion target repeat protein [Roseobacter sp. MED193] ZP_01054714.1 5e-17 40% ...

  7. NCBI nr-aa BLAST: CBRC-OPRI-01-1553 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1553 ref|ZP_01057726.1| Holliday junction DNA helicase RuvA [Roseobact...er sp. MED193] gb|EAQ44205.1| Holliday junction DNA helicase RuvA [Roseobacter sp. MED193] ZP_01057726.1 1.4 34% ...

  8. Alpha particle emitters in medicine

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, D.R.

    1989-09-01

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ({sup 211}At) and natural bismuth-212 ({sup 212}Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ({sup 223}Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs.

  9. α decay of the very neutron-deficient isotopes 197-199Fr

    Science.gov (United States)

    Kalaninová, Z.; Andreyev, A. N.; Antalic, S.; Heßberger, F. P.; Ackermann, D.; Andel, B.; Drummond, M. C.; Hofmann, S.; Huyse, M.; Kindler, B.; Lane, J. F. W.; Liberati, V.; Lommel, B.; Page, R. D.; Rapisarda, E.; Sandhu, K.; Šáro, Š.; Thornthwaite, A.; Van Duppen, P.

    2013-04-01

    Decay properties of the very neutron-deficient isotopes 197-199Fr were studied at the velocity filter Separator for Heavy Ion reaction Products (SHIP) at GSI in Darmstadt. The isotopes were produced in the 2n-4n evaporation channels of the fusion-evaporation reaction 60Ni+141Pr → 201Fr*. Improved α-decay properties of 199Fr were determined and the possible existence of two α-decaying states in this nucleus is discussed. For the isotope 198Fr a broad α-decay energy distribution was detected in the range of (7470-7930) keV and two α-decaying states were observed with half-lives of 1.1(7) and 15(3) ms. The new isotope 197Fr was identified based on the observation of one α-decay chain yielding Eα=7728(15) keV and T1/2=0.6-0.3+3.0 ms. The systematics of reduced α-decay widths are presented for neutron-deficient francium, radon, and astatine isotopes.

  10. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Directory of Open Access Journals (Sweden)

    Sherif S Nafee

    Full Text Available Thallium (81(217Tl, Bismuth (83(217Bi, Astatine (85(217At, Francium (87(217Fr, Actinium (89(217Ac and Protactinium (91(217Pa are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221Fr-, (221Ac- and (221Pa-α-decays.

  11. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Science.gov (United States)

    Nafee, Sherif S; Shaheen, Salem A; Al-Ramady, Amir M

    2016-01-01

    Thallium (81(217)Tl, Bismuth (83(217)Bi), Astatine (85(217)At), Francium (87(217)Fr), Actinium (89(217)Ac) and Protactinium (91(217)Pa) are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α) has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF) calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221)Fr-, (221)Ac- and (221)Pa-α-decays.

  12. On the theory of time dilation in chemical kinetics

    Science.gov (United States)

    Baig, Mirza Wasif

    2017-10-01

    The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

  13. SPECT assay of radiolabeled monoclonal antibodies. Progress report, September 1, 1992--August 24, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1993-08-20

    The overall goal of this project is to improve the effectiveness of single photon emission computed tomography (SPECT) to image and quantify radiolabeled monoclonal antibodies. During the past year, we have made significant progress toward this goal, and this report summarizes that work. Our efforts have been mainly directed along three fronts. First, we have developed and tested new reconstruction methods including three-dimensional iterative algorithms that model non-uniform attenuation and distance-dependent detector response. Both fan beam and parallel beam collimator geometries have been modeled and novel ways of improving the efficiency of the computationally intensive methods have been introduced. Second, an ultra-high resolution, small field-of-view pinhole collimator has been constructed and evaluated. Reconstructed spatial resolution of 1 to 3 mm (FWHM) has been achieved in phantom scans with a useful field-of-view of 9 to 10 cm. Finally, we have investigated the ability of SPECT to image and quantify astatine-211 distributions. Reconstructed images of phantom data demonstrated quantitative accuracy to within 10% with proper attenuation and scatter compensation.

  14. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Science.gov (United States)

    Marsh, B. A.; Andel, B.; Andreyev, A. N.; Antalic, S.; Atanasov, D.; Barzakh, A. E.; Bastin, B.; Borgmann, Ch.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Dehairs, M.; Derkx, X.; De Witte, H.; Fedorov, D. V.; Fedosseev, V. N.; Focker, G. J.; Fink, D. A.; Flanagan, K. T.; Franchoo, S.; Ghys, L.; Huyse, M.; Imai, N.; Kalaninova, Z.; Köster, U.; Kreim, S.; Kesteloot, N.; Kudryavtsev, Yu.; Lane, J.; Lecesne, N.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Molkanov, P. L.; Nicol, T.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Schweikhard, L.; Seliverstov, M. D.; Sels, S.; Sjödin, A. M.; Truesdale, V.; Van Beveren, C.; Van Duppen, P.; Wendt, K.; Wienholtz, F.; Wolf, R. N.; Zemlyanoy, S. G.

    2013-12-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  15. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  16. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  17. Evaluating 99mTc Auger electrons for targeted tumor radiotherapy by computational methods.

    Science.gov (United States)

    Tavares, Adriana Alexandre S; Tavares, João Manuel R S

    2010-07-01

    Technetium-99m (99mTc) has been widely used as an imaging agent but only recently has been considered for therapeutic applications. This study aims to analyze the potential use of 99mTc Auger electrons for targeted tumor radiotherapy by evaluating the DNA damage and its probability of correct repair and by studying the cellular kinetics, following 99mTc Auger electron irradiation in comparison to iodine-131 (131I) beta minus particles and astatine-211 (211At) alpha particle irradiation. Computational models were used to estimate the yield of DNA damage (fast Monte Carlo damage algorithm), the probability of correct repair (Monte Carlo excision repair algorithm), and cell kinetic effects (virtual cell radiobiology algorithm) after irradiation with the selected particles. The results obtained with the algorithms used suggested that 99mTc CKMMX (all M-shell Coster-Kroning--CK--and super-CK transitions) electrons and Auger MXY (all M-shell Auger transitions) have a therapeutic potential comparable to high linear energy transfer 211At alpha particles and higher than 131I beta minus particles. All the other 99mTc electrons had a therapeutic potential similar to 131I beta minus particles. 99mTc CKMMX electrons and Auger MXY presented a higher probability to induce apoptosis than 131I beta minus particles and a probability similar to 211At alpha particles. Based on the results here, 99mTc CKMMX electrons and Auger MXY are useful electrons for targeted tumor radiotherapy.

  18. Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

    Energy Technology Data Exchange (ETDEWEB)

    Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se

    2005-08-01

    Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

  19. Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

  20. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  1. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  2. Cloud Point Extraction of Parabens Using Non-Ionic Surfactant with Cylodextrin Functionalized Ionic Liquid as a Modifier

    Science.gov (United States)

    Noorashikin, Md Saleh; Raoov, Muggundha; Mohamad, Sharifah; Abas, Mhd Radzi

    2013-01-01

    A cloud point extraction (CPE) process using non-ionic surfactant (DC193C) to extract selected paraben compounds from water samples was investigated using reversed phase high performance liquid chromatography (RP-HPLC). The CPE process with the presence of β-cyclodextrin (βCD) functionalized ionic liquid as a modifier (CPE-DC193C-βCD-IL) is a new extraction technique that has been applied on the optimization of parameters, i.e., pH, βCD-IL concentration and phase volume ratio. This CPE-DC193C-βCD-IL method is facilitated at 30 °C, showing great losses of water content in the surfactant-rich phase, resulting in a high pre-concentration factor and high distribution coefficient. The developed method CPE-DC193C-βCD-IL did show enhanced properties compared to the CPE method without the modifier (CPE-DC193C). The developed method of CPE-DC193C-βCD-IL gives an excellent performance on the detection of parabens from water samples with the limit of detection falling in the range of 0.013–0.038 μg mL−1. Finally, the inclusion complex formation, hydrogen bonding, and π–π interaction between the βCD-IL, benzyl paraben (ArP), and DC 193C were proven using 1H NMR and 2D NOESY spectroscopy. PMID:24351832

  3. Cloud Point Extraction of Parabens Using Non-Ionic Surfactant with Cylodextrin Functionalized Ionic Liquid as a Modifier

    Directory of Open Access Journals (Sweden)

    Md Saleh Noorashikin

    2013-12-01

    Full Text Available A cloud point extraction (CPE process using non-ionic surfactant (DC193C to extract selected paraben compounds from water samples was investigated using reversed phase high performance liquid chromatography (RP-HPLC. The CPE process with the presence of β-cyclodextrin (βCD functionalized ionic liquid as a modifier (CPE-DC193C-βCD-IL is a new extraction technique that has been applied on the optimization of parameters, i.e., pH, βCD-IL concentration and phase volume ratio. This CPE-DC193C-βCD-IL method is facilitated at 30 °C, showing great losses of water content in the surfactant-rich phase, resulting in a high pre-concentration factor and high distribution coefficient. The developed method CPE-DC193C-βCD-IL did show enhanced properties compared to the CPE method without the modifier (CPE-DC193C. The developed method of CPE-DC193C-βCD-IL gives an excellent performance on the detection of parabens from water samples with the limit of detection falling in the range of 0.013–0.038 µg mL−1. Finally, the inclusion complex formation, hydrogen bonding, and π–π interaction between the βCD-IL, benzyl paraben (ArP, and DC 193C were proven using 1H NMR and 2D NOESY spectroscopy.

  4. EnviroAtlas - Durham, NC - Ecosystem Services by Block Group

    Data.gov (United States)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset presents environmental benefits of the urban forest in 193 block groups in Durham, North Carolina. Carbon attributes, temperature reduction,...

  5. Gclust Server: 19495 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 19495 ATH_AT3G61350_18411974 Cluster Sequences Related Sequences(193) 358 SKIP4 (SKP1 INTERACTING PARTNER...3) Sequence length 358 Representative annotation SKIP4 (SKP1 INTERACTING PARTNER

  6. Interkulturelle Erwachsenenbildung

    OpenAIRE

    Klemm, Ulrich

    1996-01-01

    Interkulturelle Erwachsenenbildung / verantwortl. Red.: Ulrich Klemm. - Tübingen u.a. : Schöppe & Schwarzenbart, 1996. - (Zeitschrift für internationale Bildungsforschung und Entwicklungspädagogik ; 19/3)

  7. South African Journal of Education - Vol 23, No 3 (2003)

    African Journals Online (AJOL)

    The jagged paths to multicultural education: international experiences and South Africa's response in the new dispensation · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Saloshna Vandeyar, 193-198 ...

  8. On Eneström–Kakeya theorem and related analytic functions

    Indian Academy of Sciences (India)

    Author Affiliations. W M Shah1 A Liman2. P.G. Department of Mathematics, Govt. College Baramulla, Kashmir 193 101, India; Department of Mathematics, National Institute of Technology, Kashmir 190 006, India ...

  9. Electromagnetic Fields and Public Health: Mobile Phones

    Science.gov (United States)

    ... phones Fact sheet N°193 Reviewed October 2014 Key facts Mobile phone use is ubiquitous with an ... the "Guidelines for limiting exposure to time-varying electric, magnetic and electromagetic fields (up to 300 GHz)" , ...

  10. Zooplankton biodiversity and community structure vary along spatiotemporal environmental gradients in restored peridunal ponds.

    Czech Academy of Sciences Publication Activity Database

    Antón-Pardo, Maria; Armengol, X.; Ortells, R.

    2016-01-01

    Roč. 75, č. 1 (2016), s. 193-203 ISSN 1129-5767 Institutional support: RVO:60077344 Keywords : Crustaceans * dispersal * diversity * metacommunity dynamics * rotifers * similarity * singularity Subject RIV: DA - Hydrology ; Limnology Impact factor: 1.451, year: 2016

  11. Černá vlajka pirátů znovu nahání strach? Opatření proti pirátství a ozbrojenému lupičství na moři na začátku 21. století

    Czech Academy of Sciences Publication Activity Database

    Šturma, Pavel

    2009-01-01

    Roč. 8, č. 7 (2009), s. 193-197 ISSN 1213-5313 Institutional research plan: CEZ:AV0Z70680506 Keywords : maritime law * public international law * fight against piracy Subject RIV: AG - Legal Sciences

  12. 1984 walrus harvest, health, and welfare study at Gambell, Alaska: Progress report

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The recorded harvest between 25 April and 8 June in Gambell was 1499 walruses. There were 373 adult males, 528 adult females, 405 calves, and 193 of unknown sex....

  13. 31 CFR 356.31 - How does the STRIPS program work?

    Science.gov (United States)

    2010-07-01

    ...) FISCAL SERVICE, DEPARTMENT OF THE TREASURY BUREAU OF THE PUBLIC DEBT SALE AND ISSUE OF MARKETABLE BOOK-ENTRY TREASURY BILLS, NOTES, AND BONDS (DEPARTMENT OF THE TREASURY CIRCULAR, PUBLIC DEBT SERIES NO. 1-93...

  14. 31 CFR 356.25 - How does the settlement process work?

    Science.gov (United States)

    2010-07-01

    ...) FISCAL SERVICE, DEPARTMENT OF THE TREASURY BUREAU OF THE PUBLIC DEBT SALE AND ISSUE OF MARKETABLE BOOK-ENTRY TREASURY BILLS, NOTES, AND BONDS (DEPARTMENT OF THE TREASURY CIRCULAR, PUBLIC DEBT SERIES NO. 1-93...

  15. 31 CFR 356.16 - Do I have to make any certifications?

    Science.gov (United States)

    2010-07-01

    ...) FISCAL SERVICE, DEPARTMENT OF THE TREASURY BUREAU OF THE PUBLIC DEBT SALE AND ISSUE OF MARKETABLE BOOK-ENTRY TREASURY BILLS, NOTES, AND BONDS (DEPARTMENT OF THE TREASURY CIRCULAR, PUBLIC DEBT SERIES NO. 1-93...

  16. 31 CFR 356.32 - What tax rules apply?

    Science.gov (United States)

    2010-07-01

    ... SERVICE, DEPARTMENT OF THE TREASURY BUREAU OF THE PUBLIC DEBT SALE AND ISSUE OF MARKETABLE BOOK-ENTRY TREASURY BILLS, NOTES, AND BONDS (DEPARTMENT OF THE TREASURY CIRCULAR, PUBLIC DEBT SERIES NO. 1-93...

  17. Gclust Server: 16491 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences Related Sequences(193) 352 putative organic anion transporterno annotation 6 1.00e-99 85.71...length 352 Representative annotation putative organic anion transporterno annotation Number of Sequences

  18. Cancer in Children and Adolescents

    Science.gov (United States)

    ... Children's Cancer and Leukaemia Group. Pediatric and Developmental Pathology 2011; 14(3):189-193. [PubMed Abstract] Jemal ... Armstrong GT, Kawashima T, Leisenring W, et al. Aging and risk of severe, disabling, life-threatening, and ...

  19. Cyclodextrin glucanotransferase production by cell biocatalysts of alkaliphilic bacilli

    Czech Academy of Sciences Publication Activity Database

    Atanasova, N.; Kitayska, T.; Yankov, D.; Šafaříková, Miroslava; Tonkova, A.

    2009-01-01

    Roč. 46, - (2009), s. 278-285 ISSN 1369-703X Institutional research plan: CEZ:AV0Z60870520 Keywords : alkaliphilic bacilli * immobilization Subject RIV: CE - Biochemistry Impact factor: 2.193, year: 2009

  20. EST Table: FS748350 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available PREDICTED: similar to fetal alzheimer antigen, falz [Nasonia vitripennis] 10/09/08 37 %/193 aa FBpp0290563|E...811424.1| PREDICTED: similar to fetal alzheimer antigen, falz [Tribolium castaneum] FS748350 caL- ...

  1. ENTREPRENEURIAL SELF-EFFICACY AND FIRMS' INNOVATION BEHAVIOR: THE NEGATIVE MEDIATING ROLE OF SOCIAL CAPITAL

    National Research Council Canada - National Science Library

    Chen, Ying; Zhou, Xiaohu

    2017-01-01

    ...) and firms' innovation behavior. We analyzed the data from 193 entrepreneurs in China, and the results showed that ESE positively affected firms' innovation behavior, and the entrepreneur's internal social capital played a negative...

  2. EnviroAtlas - Durham, NC - BenMAP Results by Block Group

    Data.gov (United States)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset demonstrates the effect of changes in pollution concentration on local populations in 193 block groups in Durham, North Carolina. The US...

  3. Experiment list: SRX032877 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ider=Dr. Jeffrey Whitsett || antibody reference=Gene Expr Patterns. 2004 Dec;5(2):193-208. Immunohistochem...ical localization of Foxa1 and Foxa2 in mouse embryos and adult tissues. Besnard V,

  4. 10 CFR 205.192A - Burden of proof.

    Science.gov (United States)

    2010-01-01

    ... Remedial Order proceeding the ERA has the burden of establishing a prima facie case as to the validity of... supplemental information that may be made available under § 205.193A. (b) Once a prima facie case has been...

  5. International Journal of Development and Management Review

    African Journals Online (AJOL)

    Organization management today: setting the human resource agenda in the globalized competition · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Oguchialu U. Opara, Emmanuel A. Eboh, 193-201 ...

  6. Sexually Transmitted Infections

    Science.gov (United States)

    ... et al. (2013). Sexually transmitted infections among U.S. women and men: Prevalence and incidence estimates, 2008 . Sexually Transmitted Diseases; 40(3): 187–193. Centers for Disease Control ...

  7. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available QLVVDAIKAEG Sbjct: 1 ... LDGKVALITGAGGGLGEAYAKLFAREGASVVVNDLGGPRDGSGADKSMAQLVVDAIKAEG 60 ... Query: 134 LKGTFCCTMPVFRWMRENGGGVIVNTSSTSGLI...GNFGQTNYGAAKGGIWGLSNVLAIEGR 193 ... LKGTFCCTMPVFRWMRENGGGVIVNTSSTSGLIGNFGQTNY...GAAKGGIWGLSNVLAIEGR Sbjct: 121 LKGTFCCTMPVFRWMRENGGGVIVNTSSTSGLIGNFGQTNYGAAKGGIWGLSNVLAIEGR 180 ... Query: 254 G 254 ... G Sbjct: 241 G 241

  8. Experiment list: SRX150405 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available mesoderm|Description=lymphoblastoid, International HapMap Project, Yoruba in Ibadan, Nigera, treatment: Epst...193 || cell organism=human || cell description=lymphoblastoid, International HapMap Project, Yoruba in Ibadan, Niger

  9. Ajuste psicologico y vida religiosa en adultos mayores

    National Research Council Canada - National Science Library

    Montero-Lopez Lena, Maria; Rivera-Ledesma, Armando

    2014-01-01

    La presente investigacion explora la relacion entre la vida religiosa de las personas y el ajuste psicologico, con base en una muestra de 193 adultos mayores evangelicos de la comunidad de la Ciudad de Mexico...

  10. SUMOylation of the ING1b tumor suppressor regulates gene transcription

    DEFF Research Database (Denmark)

    Satpathy, Shankha; Guérillon, Claire; Kim, Tae-Sun

    2014-01-01

    and senescence, but how the proteins themselves are regulated is not yet clear. Here, we find a small ubiquitin-like modification (SUMOylation) of the ING1b protein and identify lysine 193 (K193) as the preferred ING1b SUMO acceptor site. We also show that PIAS4 is the E3 SUMO ligase responsible for ING1b...... SUMOylation on K193. Sequence alignment reveals that the SUMO consensus site on ING1b contains a phosphorylation-dependent SUMOylation motif (PDSM) and our data indicate that the SUMOylation on K193 is enhanced by the S199D phosphomimic mutant. Using an ING1b protein mutated at the major SUMOylation site (ING...

  11. 10 CFR Appendix L to Part 110 - Illustrative List of Byproduct Materials Under NRC Export/Import Licensing Authority a

    Science.gov (United States)

    2010-01-01

    ... 149 (Nd 149) Neptunium 235 (Np 235) Neptunium 237 (Np 237) Nickel 59 (Ni 59) Nickel 63 (Ni 63) Nickel...) Palladium 109 (Pd 109) Phosphorus 32 (P 32) Phosphorus 33 (P 33) Platinum 191 (Pt 191) Platinum 193m (Pt...

  12. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... views 4:24 Perinatal Palliative Care - The Zimmer Family Story - Duration: 13:34. UnityPoint Health - Meriter 193,342 views 13:34 LIFE Before Death Pediatric Palliative Care - Duration: 5:27. ...

  13. 29 CFR 783.40 - “Documented” vessel.

    Science.gov (United States)

    2010-07-01

    ..., enrolled and licensed, or licensed by the Bureau of Customs under the laws of the United States (46 U.S.C. 11, 193, 251-252, 258, 840). Although Bureau of Customs regulations provide for three types of...

  14. Drug: D10347 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 85'-90', 157'-217', 263'-321'; glycosylation sites (N) :Asn23, Asn46, Asn-193) Peptide Treatment of disea...ses that involve loss of skeletal muscle mass, strength, integrity Myostatin inhibi

  15. Angiotensin-converting enzyme insertion/deletion gene ...

    Indian Academy of Sciences (India)

    2016-03-02

    Haemoglobinopathies and Cystic fibrosis,. LR00SP03', Tunis 1007, Tunisia ... of mutations emphasizes the role of genetic background (modifier gene) and environment. (Cutting ... Journal of Genetics, Vol. 95, No. 1, March 2016. 193 ...

  16. Canine-guide Occlusion and Group Function Occlusion are Equally Acceptable When Restoring the Dentition.

    Science.gov (United States)

    Miralles, Rodolfo

    2016-03-01

    Impact of lateral occlusion schemes: A systematic review. Abduo J, Tennant M. J Prosthet Dent 2015;114(2):193-204 SOURCE OF FUNDING: Not reported Systematic review. Copyright © 2016 Elsevier Inc. All rights reserved.

  17. 78 FR 4469 - Biweekly Notice; Applications and Amendments to Facility Operating Licenses and Combined Licenses...

    Science.gov (United States)

    2013-01-22

    ..., Pilgrim Nuclear Power Station (Pilgrim), Plymouth County, Massachusetts Entergy Nuclear Vermont Yankee...--193; IP2--271; IP3--248; Palisades-- ] 249; Pilgrim--239; RBS--178; VY--253; and Waterford--240...

  18. Low Noise Millimeter Wave LNA Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The Phase I effort will result in a low noise MMIC G-Band amplifier the covers the entire 165 to 193GHz frequency range. The amplifier will be designed using a 50nm...

  19. Addiction in developmental perspective: influence of conduct disorder severity, subtype, and attention-deficit hyperactivity disorder on problem severity and comorbidity in adults with opioid dependence.

    NARCIS (Netherlands)

    Carpentier, P.J.; Knapen, L.J.; Gogh, M.T. van; Buitelaar, J.K.; Jong, C.A.J. de

    2012-01-01

    This retrospective cross-sectional study examines whether conduct disorder and attention deficit hyperactivity disorder are associated with problem severity and psychiatric comorbidity in 193 middle-aged, opioid-dependent patients. Conduct disorder history, attention deficit hyperactivity disorder,

  20. Results of Field and Laboratory Investigations Conducted for Remediation of Interim Response Actions, Other Contamination Sources. Volume 2. Appendixes

    Science.gov (United States)

    1990-12-01

    SoIl WC-1083-071 5/11/89 7.5 to 8 Limited Suite 36193 SampLe Soil WC36S193-001 5/16/89 0.5 to 1 Limited Suite Sample Soil WC36S193-S041 5/ 16189 4 to...5110/89 6/15/89 9 EMI-J083-S041 5/11/89 VEM-1083-SO71 5/111/9 13105 5/11/8Y HASTE STAG. PPE 6/ 16189 Y 13106 5/11/?9 CORING 36-193 SOIL HC36S193-S001 5...6116189 Y 13142 5/24/81 VASTE STAG. PPE 6/16/89 Y 13143 5/24/819 ASTE STRG. PPE 6/ 16189 Y 13144 5/24/69 WASTE STIG. PPE 6/16/89 Y 13145 5/24/81 BASTE

  1. WELFARE REFORM: Progress in Meeting Work-Focused TANF Goals

    National Research Council Canada - National Science Library

    2001-01-01

    .... The 1996 Personal Responsibility and Work Opportunity Reconciliation Act of 1996 (P.L. 104-193) (PRWORA) significantly changed federal welfare policy for low-income families with children, building upon and expanding state-level reforms...

  2. Disease: H01178 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available taminated food. Among many species of Diptera that cause larval infection in humans, Dermatobia hominis, the...an M Ophthalmomyiasis in humans. Nepal J Ophthalmol 3:193-5 (2011) PMID:11216610 (description) Sampson CE, M

  3. Water Entry and the Cavity-Running Behavior of Missiles

    Science.gov (United States)

    1975-01-01

    an der Oberflache von F.*Lussigkeiten (Impact and Planing on the Surface of Liquids)," Z. f. AMM 12, pp 193-215, 1932 1-15. Shiffman, M. and Spencer, D...H., "Ueber Stoss- und Gleitvorg~nge an der Oberflache von Fldssigkeiten (On Impact and Planing at the Surface of Liquids)" Z. f. AMM, 12, pp 193-215

  4. Yeast-expressed recombinant protein of the receptor-binding domain in SARS-CoV spike protein with deglycosylated forms as a SARS vaccine candidate.

    Science.gov (United States)

    Chen, Wen-Hsiang; Du, Lanying; Chag, Shivali M; Ma, Cuiqing; Tricoche, Nancy; Tao, Xinrong; Seid, Christopher A; Hudspeth, Elissa M; Lustigman, Sara; Tseng, Chien-Te K; Bottazzi, Maria Elena; Hotez, Peter J; Zhan, Bin; Jiang, Shibo

    2014-01-01

    Development of vaccines for preventing a future pandemic of severe acute respiratory syndrome (SARS) caused by SARS coronavirus (SARS-CoV) and for biodefense preparedness is urgently needed. Our previous studies have shown that a candidate SARS vaccine antigen consisting of the receptor-binding domain (RBD) of SARS-CoV spike protein can induce potent neutralizing antibody responses and protection against SARS-CoV challenge in vaccinated animals. To optimize expression conditions for scale-up production of the RBD vaccine candidate, we hypothesized that this could be potentially achieved by removing glycosylation sites in the RBD protein. In this study, we constructed two RBD protein variants: 1) RBD193-WT (193-aa, residues 318-510) and its deglycosylated forms (RBD193-N1, RBD193-N2, RBD193-N3); 2) RBD219-WT (219-aa, residues 318-536) and its deglycosylated forms (RBD219-N1, RBD219-N2, and RBD219-N3). All constructs were expressed as recombinant proteins in yeast. The purified recombinant proteins of these constructs were compared for their antigenicity, functionality and immunogenicity in mice using alum as the adjuvant. We found that RBD219-N1 exhibited high expression yield, and maintained its antigenicity and functionality. More importantly, RBD219-N1 induced significantly stronger RBD-specific antibody responses and a higher level of neutralizing antibodies in immunized mice than RBD193-WT, RBD193-N1, RBD193-N3, or RBD219-WT. These results suggest that RBD219-N1 could be selected as an optimal SARS vaccine candidate for further development.

  5. Haze growth on reticles: What's the RigHT thing to do?

    Science.gov (United States)

    McDonald, Steven M.; Chalom, Daniel V.; Green, Michael J.; McMurran, Jeffrey A.; Garrett, Michael B.; Dlouhy, David W.

    2009-04-01

    The authors are reporting on the comparison of various industry methods of managing, controlling and limiting haze growth on 193nm reticles. This comparison includes reporting on the results from the Reticle Haze Treatment (RigHT) process developed at Micron / Photronics Mask Technology Center and transferred to Photronics, Inc. This process provides 193nm PSM reticles that have shown no haze growth after excessive wafer exposures and are usable for the life of the reticle.

  6. Vision, Instruction and Action

    Science.gov (United States)

    1990-04-01

    193 9.6.1 Sonja considered as a technology .. .. .. .. .. ... ... ... ... ... 193 9.6.2 Quality of play...Implementing a serious linguistic theory in this framework would be an enormous project, but Sonja suggests it is possible. 5.2.3 Indexicality Indezicality ...includes the purposes, memories, and histories of the interlocutors. A nice example is provided by Winograd and Flores’ analysis of "Is there any water in

  7. DMPD: Lipopolysaccharide sensing an important factor in the innate immune response toGram-negative bacterial infections: benefits and hazards of LPShypersensitivity. [Dynamic Macrophage Pathway CSML Database

    Lifescience Database Archive (English)

    Full Text Available chet S, Keck S, Fejer G, Huber M, Schutze N, Beutler B,Galanos C. Immunobiology. 2008;213(3-4):193-203. Epub...ersensitivity. Authors Freudenberg MA, Tchaptchet S, Keck S, Fejer G, Huber M, Schutze N, Beutler B,Galanos C. Publication Immunobiol...ogy. 2008;213(3-4):193-203. Epub 2007 Dec 27. Pathway - PNG File (.png) SVG File (.

  8. A Generalized Procedure for Assessing the Inclusion/Non-Inclusion of Passive Solar Techniques in Facility Design.

    Science.gov (United States)

    1976-09-01

    commonly known as the series Present-Worth Factor (uniform series) and the Present-Worth Factor (single payment ), respectively (20:164,168). These...52 2,922,247 May 2,940,665 x .24 = 705,760 urI; 889,525 x 0 = 0 0 x 0 = 0 Augu ,t 62,790 x 1 00 62,790 wptembur 1,193,010 X 1 00 1,193,010 Ot. Uber

  9. EST Table: FY007182 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY007182 bmov21c06 11/11/04 53 %/193 aa ref|XP_391845.2| PREDICTED: similar to tout...e:AGAP010388 11/11/04 53 %/193 aa gnl|Amel|GB17343-PA 11/11/04 48 %/189 aa gi|91076108|ref|XP_968944.1| PREDICTED: similar to tout-velu CG10117-PA [Tribolium castaneum] FS931854 bmov ...

  10. IR and UV Photodissociation as Analytical Tools for Characterizing Lipid A Structures

    OpenAIRE

    Madsen, James A.; Cullen, Thomas W.; Trent, M. Stephen; Brodbelt, Jennifer S.

    2011-01-01

    The utility of 193 nm ultraviolet photodissociation (UVPD) and 10.6 μm infrared multiphoton dissociation (IRMPD) for characterization of lipid A structures was assessed in an ion trap mass spectrometer. The fragmentation behavior of lipid A species was also evaluated by activated – electron photodetachment (a-EPD), which uses 193 nm photons to create charge reduced radicals that are subsequently dissociated by collisional activation. In contrast to collision induced dissociation (CID), IRMPD ...

  11. 77 FR 29694 - Richard H. NG, D.O.; Decision and Order

    Science.gov (United States)

    2012-05-18

    .... (Id. at 1-2.) In support of his motion, Respondent cites Stuart A. Bergman, M.D., 70 Fed. Reg. 33,193... possibility of future reinstatement.'' Bergman, 70 FR at 33,193; Roger A. Rodriguez, M.D., 70 FR 33,206 (DEA... Respondent does not appear to have a scheduled hearing date before the IDFPR. Compare Bergman, 70 FR at 33...

  12. A large outbreak of human salmonellosis traced to a local pig farm.

    OpenAIRE

    Maguire, H. C.; Codd, A. A.; Mackay, V. E.; Rowe, B.; Mitchell, E.

    1993-01-01

    An outbreak of Salmonella typhimurium definitive type (DT) 193 affecting 206 persons occurred in July and August 1989 in a small town in northern England. A descriptive study suggested that cold meats including pork from a butcher's shop in the town were vehicles of infection. An analytical study of a cohort attending a function in the town showed a significant association between illness and consumption of cold roast pork supplied by the butcher's shop (P = 0.00000004). S. typhimurium DT 193...

  13. Achieving 15% Tandem Polymer Solar Cells

    Science.gov (United States)

    2015-06-23

    final support also enabled us to explore novel hybrid perovskite solar cells in depth. For example, single junction cell efficiency of 19.3% under...novel hybrid perovskite solar cells in depth. For example, single junction cell efficiency of 19.3% under reverse bias was achieved and the results...3 In a second effort, a monolithic integration of perovskite and LBG polymer:fullerene subcells into a tandem structure is realized through a full

  14. Optimizing MIBG therapy of neuroendocrine tumors: preclinical evidence of dose maximization and synergy

    Energy Technology Data Exchange (ETDEWEB)

    Mairs, Rob J. [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)], E-mail: r.mairs@beatson.gla.ac.uk; Boyd, Marie [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)

    2008-08-15

    [{sup 131}I]meta-Iodobenzylguanidine ([{sup 131}I]MIBG) has been used for the therapy of tumors of neuroectodermal origin since the 1980s. Its role in the management of these malignancies remains controversial because of the large variation in response rates. Appreciation of the mode of conveyance of [{sup 131}I]MIBG via the noradrenaline transporter into malignant cells and of factors that influence the activity of the uptake mechanism has indicated various ways in which the effectiveness of this type of targeted radiotherapy may be improved. Experimental observations indicate that radiolabeling of MIBG to high specific activity reduced the amount of cold competitor, thereby increasing tumor dose and minimizing pressor effects. We observed supra-additive tumor cell kill and inhibition of tumor growth following combined topotecan and [{sup 131}I]MIBG treatment. The improved efficacy is related to topotecan's increased disruption of DNA repair. Radiation damage to targeted tumors may also be enhanced by the use of the {alpha}-particle emitter [{sup 211}At]astatine rather than {sup 131}I as radiolabel. Furthermore, recent experimental findings indicate that [{sup 123}I]MIBG may have therapeutic potential over and above its utility as an imaging agent. It has recently been demonstrated that potent cytotoxic bystander effects were induced by the intracellular concentration of [{sup 131}I]MIBG, [{sup 123}I]MIBG or meta-[{sup 211}At]astatobenzylguanidine. Identification of the nature of bystander factors could be exploited to maximize the specificity and potency of MIBG-targeted radiotherapy. By employing a range of strategies, there are good prospects for the improvement of the [{sup 131}I]MIBG therapy of neuroectodermal tumors.

  15. Immuno-vectorization of radioelements emitters of alpha particles: a new therapy in cancerology; Immunovectorisation de radioelements emetteurs de particules alpha: une nouvelle voie therapeutique en cancerologie

    Energy Technology Data Exchange (ETDEWEB)

    Bourgeois, M

    2007-05-15

    The radio-immunotherapy is an anti cancerous therapy which consists in vectorising with immuno-specific agents very radio toxic radioelements on tumors or in their environment to destroy them. The first part of this report presents the different characteristics of antibodies as well as their means of production under monoclonal shapes specifically steered against a tumoral antigen of interest. The second part of this report replaces the importance of the immunological vectors in the context of the nuclear medicine. It is notably described that the different methods which allow to radio-label the vector, as well as the different ways of optimization which were envisaged to improve the targeting of radioelements on a tumor. These different developments allow to define the potential place of the alpha radio-immunotherapy in treatments and so re-place the interest of the experimental part. If the radio-immunotherapy, using beta emitters isotopes as the {sup 131}iodine or the{sup 90}yttrium, is today current in anti cancerous therapy, it finds limits because of the disintegration characteristics of the isotopes it uses. Indeed, compared with alpha particles, the beta particles deposit less energy by unit of length in the crossed material.The experimental part of this report aims at studying the feasibility of the coupling between an immunological vector and an alpha emitter isotope.The different tests led on the bismuth 213, the bismuth 212, the lead 212 and the astatine 211 demonstrated that the fixation of these radionuclides was possible. This research theme is strengthened by the construction in Nantes of a cyclotron with high energy ( A.R.R.O.N.A.X.) and the optimization of the obtained promising results should allow a therapeutic use in oncology of the alpha radio-immunotherapy. (N.C.)

  16. Locoregional therapy with α-emitting trastuzumab against peritoneal metastasis of human epidermal growth factor receptor 2-positive gastric cancer in mice.

    Science.gov (United States)

    Li, Huizi Keiko; Morokoshi, Yukie; Nagatsu, Kotaro; Kamada, Tadashi; Hasegawa, Sumitaka

    2017-08-01

    Peritoneal metastasis of gastric cancer (PMGC) is incurable and thus has an extremely poor prognosis. We have found, however, that locoregionally administered trastuzumab armed with astatine-211 ((211) At-trastuzumab) is effective against human epidermal growth factor receptor 2 (HER2)-positive PMGC in a xenograft mouse model. We first observed that (211) At-trastuzumab can specifically bind and effectively kill NCI-N87 (N87) cells, which are HER2-positive human metastatic GC cells, both in vitro and in s.c. tumors. We established a PMGC mouse model using N87 xenografts stably expressing luciferase to test α-particle radioimmunotherapy with (211) At-trastuzumab against PMGC. Biodistribution analysis in this PMGC mouse model revealed that the i.p. administration of (211) At-trastuzumab (1 MBq) was a more efficient means of delivery of (211) At into metastatic tumors than i.v. injection; the maximum tumor uptake with i.p. administration was over 60% injected dose per gram of tissue (%ID/g) compared to approximately 18%ID/g with i.v. injection. Surprisingly, a single i.p. injection of (211) At-trastuzumab (1 MBq) was sufficient to completely eradicate intraperitoneally disseminated HER2-positive GC xenografts in two of six treated mice by inducing DNA double-strand breaks, and to drastically reduce the tumor burden in another three mice. No bodyweight loss, leukocytopenia, or significant biochemical changes in liver or kidney function were observed in the treatment group. Accordingly, locoregionally administered (211) At-trastuzumab significantly prolonged the survival time of HER2-positive PMGC mice compared with control treatments. Our results provide a proof-of-concept demonstration that locoregional therapy with (211) At-trastuzumab may offer a new treatment option for HER2-positive PMGC. © 2017 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.

  17. Toxicity of ricin A chain is reduced in mammalian cells by inhibiting its interaction with the ribosome.

    Science.gov (United States)

    Jetzt, Amanda E; Li, Xiao-Ping; Tumer, Nilgun E; Cohick, Wendie S

    2016-11-01

    Ricin is a potent ribotoxin that is considered a bioterror threat due to its ease of isolation and possibility of aerosolization. In yeast, mutation of arginine residues away from the active site results in a ricin toxin A chain (RTA) variant that is unable to bind the ribosome and exhibits reduced cytotoxicity. The goal of the present work was to determine if these residues contribute to ribosome binding and cytotoxicity of RTA in mammalian cells. The RTA mutant R193A/R235A did not interact with mammalian ribosomes, while a G212E variant with a point mutation near its active site bound ribosomes similarly to wild-type (WT) RTA. R193A/R235A retained full catalytic activity on naked RNA but had reduced activity on mammalian ribosomes. To determine the effect of this mutant in intact cells, pre R193A/R235A containing a signal sequence directing it to the endoplasmic reticulum and mature R193A/R235A that directly targeted cytosolic ribosomes were each expressed. Depurination and protein synthesis inhibition were reduced by both pre- and mature R193A/R235A relative to WT. Protein synthesis inhibition was reduced to a greater extent by R193A/R235A than by G212E. Pre R193A/R235A caused a greater reduction in caspase activation and loss of mitochondrial membrane potential than G212E relative to WT RTA. These findings indicate that an RTA variant with reduced ribosome binding is less toxic than a variant with less catalytic activity but normal ribosome binding activity. The toxin-ribosome interaction represents a novel target for the development of therapeutics to prevent or treat ricin intoxication. Copyright © 2016 Elsevier Inc. All rights reserved.

  18. Absorption of 308-nm excimer laser radiation by balanced salt solution, sodium hyaluronate, and human cadaver eyes

    Energy Technology Data Exchange (ETDEWEB)

    Keates, R.H.; Bloom, R.T.; Schneider, R.T.; Ren, Q.; Sohl, J.; Viscardi, J.J. (Univ. of California, Irvine (USA))

    1990-11-01

    Absorption of the excimer laser radiations of 193-nm argon fluorine and 308-nm xenon chloride in balanced salt solution, sodium hyaluronate, and human cadaver eyes was measured. The absorption of these materials as considerably different for the two wavelengths; we found that 308-nm light experienced much less absorption than the 193-nm light. The extinction coefficient (k) for 308 nm was k = 0.19/cm for balanced salt solution and k = 0.22/cm for sodium hyaluronate. In contrast to this, the extinction coefficient for 193 nm was k = 140/cm for balanced salt solution and k = 540/cm for sodium hyaluronate. Two 1-day-old human phakic cadaver eyes showed complete absorption with both wavelengths. Using aphakic eyes, incomplete absorption was noted at the posterior pole with 308 nm and complete absorption was noted with 193 nm. The extinction in the anterior part of aphakic eyes (the first 6 mm) was 4.2/cm for 308 nm, meaning that the intensity of the light is reduced by a factor of 10 after traveling the first 5.5 mm. However, we observed that the material in the eye fluoresces, meaning the 308 nm is transformed into other (longer) wavelengths that travel through the total eye with minimal absorption. Conclusions drawn from this experiment are that the use of the 308-nm wavelength may have undesirable side effects, while the use of the 193-nm wavelength should be consistent with ophthalmic use on both the cornea and the lens.

  19. Single amino acid residue changes in subsite -1 of levansucrase from Zymomonas mobilis 10232 strongly influence the enzyme activities and products.

    Science.gov (United States)

    Li, Shuying; Yan, Yongliang; Zhou, Zhengfu; Yu, Haiying; Zhan, Yuhua; Zhang, Wei; Chen, Ming; Lu, Wei; Ping, Shuzhen; Lin, Min

    2011-04-01

    The -1 subsite of bacterial fructansucrases (FSs) (levansucrases and inulosucrases) plays an important role in the substrate recognition, binding and catalysis. Three residues (for example W47, W118 and R193, Zymomonas mobilis levansucrase numbering) at the -1 subsite are completely conserved among FSs. Site-directed mutational analysis showed that the substitutions of the three strictly conserved amino acid residues, W47N, W47H, W118N, W118H, R193K and R193H, significantly decreased enzyme activities and synthesis rates of levan, while the size of the synthesized oligosaccharides had been influenced. These experimental results, combined with 3D structure modeling, lead to our proposal that a single amino acid residue change in subsite -1 of levansucrase can influence change to the size and polarity of the sucrose binding pocket with a concomitant change to substrate binding and catalysis, and thus having an overall influence on the enzyme activities and products.

  20. Dicty_cDB: SLB158 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB158 (Link to dictyBase) - - - Contig-U16455-1 SLB158Z (Link... to Original site) - - SLB158Z 721 - - - - Show SLB158 Library SL (Link to library) Clone ID SLB158 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLB1-C/SLB158Q.Seq.d/ Representative seq. ID SLB15...8Z (Link to Original site) Representative DNA sequence >SLB158 (SLB158Q) /CSM/SL/SLB1-C/SLB158Q.Seq.d/ XXXXX... SLE193 (SLE193Q) /CSM/SL/SLE1-D/SLE193Q.Seq.d/ 1407 0.0 SLB795 (SLB795Q) /CSM/SL/SLB7-D/SLB795Q.Seq.d/ 1407 0.0 SLB249 (SLB

  1. Dicty_cDB: SLB140 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB140 (Link to dictyBase) - - - Contig-U16455-1 SLB140Z (Link... to Original site) - - SLB140Z 723 - - - - Show SLB140 Library SL (Link to library) Clone ID SLB140 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLB1-B/SLB140Q.Seq.d/ Representative seq. ID SLB14...0Z (Link to Original site) Representative DNA sequence >SLB140 (SLB140Q) /CSM/SL/SLB1-B/SLB140Q.Seq.d/ XXXXX...3 0.0 SLE193 (SLE193Q) /CSM/SL/SLE1-D/SLE193Q.Seq.d/ 1403 0.0 SLB795 (SLB795Q) /CSM/SL/SLB7-D/SLB795Q.Seq.d/ 1403 0.0 SLB249 (SLB

  2. Hybrid optical: electron-beam resists

    Science.gov (United States)

    Lennon, D. M.; Spector, S. J.; Fedynyshyn, T. H.; Lyszczarz, T. M.; Rothschild, M.; Thackeray, J.; Spear-Alfonso, K.

    2007-03-01

    Combining optical and electron beam exposures on the same wafer level is an attractive approach for extending the usefulness of current generation optical tools. This technique requires high-performance hybrid resists that perform equally well with optical and e-beam tools. In this paper Rohm and Haas EPIC TM 2340, a 193-nm chemically amplified photoresist, is used in a hybrid exposure role. The e-beam tool was used to pattern 45 nm half-pitch features and a 193- nm immersion stepper was used to pattern 60-nm half-pitch features in the same resist layer. The effects of processing parameters and delay times were investigated.

  3. Dicty_cDB: Contig-U02886-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ns: 0 Number of sequences better than 10.0: 0 length of query: 193 length of data...base: 5,674,871 effective HSP length: 15 effective length of query: 178 effective length of database: 5,571,... of Sequences: 102105510 Number of Hits to DB: 0 Number of sequences better than 10.0: 0 Length of query...: 193 Length of database: 101,790,757,118 Length adjustment: 23 Effective length of query...cessfully gapped: 0 Length of query: 64 Length of database: 1,051,180,864 Length

  4. Generalized Entropies and Legendre Duality

    Science.gov (United States)

    2012-04-22

    Level surfaces of non-degenerate functions in Rn+1, Geometriae Dedicata 50 (1994), 193-204. [3] S.Ivanov: On dual-projectively flat affine... Geometriae Dedicata 56 (1995), 177-184. [8] H.Shima, The geometry of Hessian Structures, World Sci.,(2007). [9] K.Uohashi, A.Ohara and T.Fujii: 1...surfaces of non-degenerate functions in Rn+1, Geometriae Dedicata 50 (1994), 193-204. [3] S. Ivanov, On dual-projectively flat affine connections, J. of

  5. EST Table: AV398785 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398785 NV060280 11/12/09 n.h 10/09/28 40 %/193 aa ref|XP_002005659.1| GI20589 [Drosophila mojav...ensis] gb|EDW09594.1| GI20589 [Drosophila mojavensis] 10/08/28 40 %/193 aa FBpp0169806|DmojGI2.../10 n.h 10/09/10 35 %/184 aa gi|189234823|ref|XP_001809803.1| PREDICTED: similar to AGAP010960-PA [Tribolium castaneum] AV398785 NV06 ...

  6. Quantitative Single-Particle Digital Autoradiography with α-Particle Emitters for Targeted Radionuclide Therapy using the iQID Camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W.; Frost, Sophia; Frayo, Shani; Kenoyer, Aimee L.; Santos, E. B.; Jones, Jon C.; Green, Damian J.; Hamlin, Donald K.; Wilbur, D. Scott; Fisher, Darrell R.; Orozco, Johnnie J.; Press, Oliver W.; Pagel, John M.; Sandmaier, B. M.

    2015-07-01

    Abstract Alpha emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm) causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with alpha emitters may inactivate targeted cells with minimal radiation damage to surrounding tissues. For accurate dosimetry in alpha-RIT, tools are needed to visualize and quantify the radioactivity distribution and absorbed dose to targeted and non-targeted cells, especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, iQID (ionizing-radiation Quantum Imaging Detector), for use in alpha-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection technology that images and identifies charged-particle and gamma-ray/X-ray emissions spatially and temporally on an event-by-event basis. It employs recent advances in CCD/CMOS cameras and computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, we evaluated this system’s characteristics for alpha particle imaging including measurements of spatial resolution and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 (211At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ~20 μm full width at half maximum (FWHM) and the alpha particle background was measured at a rate of (2.6 ± 0.5) × 10–4 cpm/cm2 (40 mm diameter detector area). Simultaneous imaging of multiple tissue sections was performed using a large-area iQID configuration (ø 11.5 cm

  7. Quantitative single-particle digital autoradiography with α-particle emitters for targeted radionuclide therapy using the iQID camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W., E-mail: brian.miller@pnnl.gov [Pacific Northwest National Laboratory, Richland, Washington 99354 and College of Optical Sciences, The University of Arizona, Tucson, Arizona 85719 (United States); Frost, Sofia H. L.; Frayo, Shani L.; Kenoyer, Aimee L.; Santos, Erlinda; Jones, Jon C.; Orozco, Johnnie J. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 (United States); Green, Damian J.; Press, Oliver W.; Pagel, John M.; Sandmaier, Brenda M. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 and Department of Medicine, University of Washington, Seattle, Washington 98195 (United States); Hamlin, Donald K.; Wilbur, D. Scott [Department of Radiation Oncology, University of Washington, Seattle, Washington 98195 (United States); Fisher, Darrell R. [Dade Moeller Health Group, Richland, Washington 99354 (United States)

    2015-07-15

    Purpose: Alpha-emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm), causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with α emitters may thus inactivate targeted cells with minimal radiation damage to surrounding tissues. Tools are needed to visualize and quantify the radioactivity distribution and absorbed doses to targeted and nontargeted cells for accurate dosimetry of all treatment regimens utilizing α particles, including RIT and others (e.g., Ra-223), especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, the ionizing-radiation quantum imaging detector (iQID) camera, for use in α-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection system that images and identifies charged-particle and gamma-ray/x-ray emissions spatially and temporally on an event-by-event basis. It employs CCD-CMOS cameras and high-performance computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, the authors evaluated its characteristics for α-particle imaging, including measurements of intrinsic detector spatial resolutions and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 ({sup 211}At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ∼20 μm full width at half maximum and the α-particle background was measured at a rate as low as (2.6 ± 0.5) × 10{sup −4} cpm/cm{sup 2} (40 mm diameter detector area

  8. α-Imaging Confirmed Efficient Targeting of CD₄₅-Positive Cells After ²¹¹At-Radioimmunotherapy for Hematopoietic Cell Transplantation

    Energy Technology Data Exchange (ETDEWEB)

    Frost, Sophia; Miller, Brian W.; Back, Tom; Santos, E. B.; Hamlin, Donald K.; Knoblaugh, E.; Frayo, Shani; Kenoyer, Aimee L.; Storb, Rainer; Press, O. W.; Wilbur, D. Scott; Pagel, John M.; Sandmaier, B. M.

    2015-09-03

    Alpha-radioimmunotherapy (α-RIT) targeting CD45 may substitute for total body irradiation in hematopoietic cell transplantation (HCT) preparative regimens for lymphoma. Our goal was to optimize the anti-CD45 monoclonal antibody (MAb; CA12.10C12) protein dose for astatine-²¹¹(²¹¹At)-RIT, extending the analysis to include intra-organ ²¹¹At activity distribution and α-imaging-based small-scale dosimetry, along with imunohistochemical staining. Methods: Eight normal dogs were injected with either 0.75 (n=5) or 1.00 mg/kg (n=3) of ²¹¹At-B10-CA12.10C12 (11.5–27.6 MBq/kg). Two were euthanized and necropsied 19–22 hours postinjection (p.i.), and six received autologous HCT three days after ²¹¹At-RIT, following lymph node and bone marrow biopsies at 2–4 and/or 19 hours p.i. Blood was sampled to study toxicity and clearance; CD45 targeting was evaluated by flow cytometry. ²¹¹At localization and small scale dosimetry were assessed using two α-imaging : α-camera and iQID. Results: Uptake of ²¹¹At was highest in spleen (0.31–0.61 %IA/g), lymph nodes (0.02–0.16 %IA/g), liver (0.11–0.12 %IA/g), and marrow (0.06–0.08 %IA/g). Lymphocytes in blood and marrow were efficiently targeted using either MAb dose. Lymph nodes remained unsaturated, but displayed targeted ²¹¹At localization in T lymphocyte-rich areas. Absorbed doses to blood, marrow, and lymph nodes were estimated at 3.9, 3.0, and 4.2 Gy/210 MBq, respectively. All transplanted dogs experienced transient hepatic toxicity. Liver enzyme levels were temporarily elevated in 5 of 6 dogs; 1 treated with 1.00 mg MAb/kg developed ascites and was euthanized 136 days after HCT. Conclusion: ²¹¹At-anti-CD45 RIT with 0.75 mg MAb/kg efficiently targeted blood and marrow without severe toxicity. Dosimetry calculations and observed radiation-induced effects indicated that sufficient ²¹¹At-B10-CA12.10C12 localization was achieved for efficient conditioning for HCT.

  9. The role of alpha therapy for local and systemic treatment of cancer

    Energy Technology Data Exchange (ETDEWEB)

    Allen, B.J. [St George Hospital, Kogarah, NSW (Australia)

    1998-03-01

    Major problems in the management of cancer relate to the inability to control some primary lesions, e.g. glioblastoma multiforme (GBM), and the inability to deal with metastatic cancer arising from malignant cancers such as melanoma, breast and other cancers. Binary alpha therapy using neutron capture in boron-10 offers the potential for improved prognosis for high grade brain tumours such as GBM and melanoma metastases to the brain. Metastatic cancer proceeds through a number of quite separate stages in the development of lethal disease, i e. cells in transit, preangiogenic lesions, subclinical and clinical lesions. Early stages offer the potential for control if targeted alpha therapy is applied. However, the dose must be localised to the cancer cell and this requirement rules out beta-emitting radionuclides, which are more suited for clinical lesions. Alpha-emitting radionuclides are the most appropriate toxins, as their efficacy depends on the linear energy transfer (LET) and range of the alpha particles. After matching the cancer stage, radiolabel and carrier, we find that {sup 149}Tb is the radionuclide of choice for systemic therapy in all aspects except production. The production of {sup 149}Tb in {mu}Ci (kBq) quantities has been achieved using the heavy ion reaction at the ANU tandem accelerator at Canberra and in multi-mCi (MBq) quantities using the spallation reaction in combination with on-line isotope separation technology of ISOLDE at CERN. Terbium is ideally suited for chelation to monoclonal antibodies to produce stable radio-immunoconjugates (RIC). Astatine-211 is a halide and has potential for the elimination of early stage melanoma metastases as At-MTB. However, the availability of the alpha generators {sup 228}Th-{sup 212}Bi and {sup 225}Ac-{sup 213}Bi facilitates the use of Bi-RIC in clinical trials for acute myeloid leukaemia and cystic glioma. Alpha therapy has the potential to control refractory cancers when treated at the minimum residual

  10. Systematics of Alpha-Radioactivity

    Energy Technology Data Exchange (ETDEWEB)

    Perlman, I.; Ghiorso, A.; Seaborg, G.T.

    1949-09-12

    Correlations of alpha-decay energies in terms of mass number and atomic number have been made for all of the alpha-emitting species now numbering over 100. For each element isotopes show increase in alpha-energy with decrease in mass number except in the region of 126 neutrons where there is an explainable reversal. This reversal has the effect of creating a region of relatively low alpha-energy and long half-life at low mass numbers for such elements as astatine, emanation, francium, and possibly higher elements as had been noted already for bismuth and polonium. Methods and examples of using alpha-decay data to define the energy surface in the heavy element region are discussed. The regularities in alpha-decay are used for predictions of nuclear properties including prediction of the beta-stable nuclides among the heavy elements. The half-life vs. energy correlations show that the even-even nuclides conform well with existing alpha-decay theory, but all nuclear types with odd nucleons show prohibited decay. The reason for this prohibition is not found in spin changes in the alpha-emission but in the assembly of the components of the alpha particle, and this theory is discussed further in terms of observations made on nuclides having two or more alpha-groups. Using most of the even-even nuclei to define 'normal nuclear radius' calculations are now able to show the shrinkage in the regions of lead and of 126 neutrons to amount to about 10%. The much greater change in 'effective radius' for bismuth isotopes can be dissociated into the effects of odd nucleons superimposed on the actual decrease in nuclear radius. The simple expression r = 1.48 A{sup 1/3} {center_dot} 10{sup -13} cm seems to fit the data for the even-even nuclei outside of the region of 126 neutrons better than more complex functions.

  11. Acute Stress Reactions in Couples after a Burn Event to Their Young Child

    NARCIS (Netherlands)

    Bakker, A.; Van Loey, N.E.; Van der Heijden, P.G.M.|info:eu-repo/dai/nl/073087998; Van Son, M.J.M.|info:eu-repo/dai/nl/068440340

    2012-01-01

    Objective This multicenter study examines acute stress reactions in couples following a burn event to their preschool child. Methods Participants were 182 mothers and 154 fathers, including 143 couples, of 193 children (0–4 years) with acute burns. Parents’ self-reported acute stress reactions and

  12. 78 FR 45964 - Notice of Intent To Repatriate Cultural Items: Monterey Museum of Art, Monterey, CA

    Science.gov (United States)

    2013-07-30

    ... cultural items listed in this notice meet the definition of objects of cultural patrimony. Lineal... definition of objects of cultural patrimony under 25 U.S.C. 3001. This notice is published as part of the... Monterey Museum of Art on November 20, 1978. The 193 objects of cultural patrimony are 42 harpoon or...

  13. Africa Development - Vol 37, No 2 (2012)

    African Journals Online (AJOL)

    RSE et justice sociale : le cas des multinationales pétrolières dans le Delta du Niger · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. H Lado, C Renouard, 167 – 193 ...

  14. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2017-10-17

    Oct 17, 2017 ... temperature modelling of Steam Distillation Pilot Plant (SDPP) division and interleaving were ... The nonlinear dynamic behaviour has been displayed by a broad application of the distillation column in chemical operations [1-2]. ..... Artificial Intelligence, 2016, 49:176-193. [15] Beheshti Z, Shamsuddin S M, ...

  15. Research Article Special Issue

    African Journals Online (AJOL)

    2017-10-05

    Oct 5, 2017 ... Pilot Plant. Three models' criterion were im. Descriptor Length (MDL) and Final Pre. NARX-based BPSO modelling. The result presented a slightly better model with ... nonlinearity behaviour of the real system such as distillation column has been a serious matter ..... Artificial Intelligence, 2016, 49:176-193.

  16. Bán, Zsófia and Turai, Hedvig, eds.: "Exposed Memories: Family Pictures in Private and Collective Memory"

    Directory of Open Access Journals (Sweden)

    Katalin Kádár Lynn

    2011-01-01

    Full Text Available Zsófia Bán and Hedvig Turai, eds. Exposed Memories: Family Pictures in Private and Collective Memory. AICA: International Association of Art Critics: Hungarian Section: Distributed by Central European University Press, 2010, 193 pp. Reviewed by Katalin Kádár Lynn, Senior Researcher, ELTE.

  17. Effectiveness of a Participatory Physical and Psychosocial Intervention to Balance the Demands and Resources of Industrial Workers

    DEFF Research Database (Denmark)

    Gupta, Nidhi; Wåhlin-Jacobsen, Christian Dyrlund; Abildgaard, Johan Simonsen

    2018-01-01

    Objectives: The aim of this study was to evaluate the effectiveness of a participatory physical and psychosocial workplace intervention (known as PIPPI) on work ability and recovery among industrial workers. Methods: Eligible workers were cluster-randomized into intervention (N=193) and control (N...... to be investigated using process evaluation data....

  18. Dirac's Conception of the Magnetic Monopole, and its Modern Avatars

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 12. Dirac's Conception of the Magnetic Monopole, and its Modern Avatars. Sunil Mukhi. Volume 10 Issue 12 December 2005 pp 193-202. Fulltext. Click here to view fulltext PDF. Permanent link:

  19. 47 CFR 90.309 - Tables and figures.

    Science.gov (United States)

    2010-10-01

    ... selection of powers that may be used for antenna heights ranging from 15 m (50 ft) to 152.5 m (500 ft) (AAT... Protection) Maximum Effective Radiated Power (ERP) 1 Distance in kilometers (miles): 2 Antenna height in... 80 75 193 (120) 175 150 125 105 90 80 70 60 55 50 1 The effective radiated power (ERP) and antenna...

  20. 2,6-Bis(4-methoxybenzylidenecyclohexanone

    Directory of Open Access Journals (Sweden)

    Deyun Liu

    2009-04-01

    Full Text Available In the title molecule, C22H22O3, the central cyclohexanone ring adopts an envelope conformation. The two outer aromatic rings form a dihedral angle of 19.3 (2°. The crystal packing exhibits weak intermolecular C—H...O hydrogen bonds.

  1. Cyclone hazard proneness of districts of India

    Indian Academy of Sciences (India)

    Council; Ministry of Housing & Urban Poverty Allevia- tion, Government of India. Dube S K, Poulose Jisme and Rao A D 2013 Numerical simulation of storm surge associated with severe cyclonic storm in the Bay of Bengal during 2008–2011; Monsoon. 64 193–202. Dvorak V F 1984 Tropical cyclone intensity analysis using.

  2. Brief communication

    Indian Academy of Sciences (India)

    2012-04-19

    Apr 19, 2012 ... diatoms, water moulds, etc. The organism is considered by many as capable of causing diarrhea, but a recent case control study of 99 individuals stool-positive for B. hominis. and 193 matched controls did not demonstrate pathogenicity based on the association with the development of gastrointestinal.

  3. Leader-member exchange and follower creativity : the moderating roles of leader and follower expectations for creativity

    NARCIS (Netherlands)

    Qu, Rujie; Janssen, Onne; Shi, Kan

    2017-01-01

    We examined leader and follower expectations for creativity as moderators in the relationship between leader-member exchange (LMX) and follower creativity. The results of a survey among 193 leader-follower dyads from two high-tech companies in mainland China show that LMX positively relates to

  4. red palm oil bean-stew improved serum vitamin a and haemoglobin ...

    African Journals Online (AJOL)

    22. Preet K and D Punia Proximate composition, phytic acid, polyphenols and digestibility (in-vitro) of four brown cowpea varieties. Int. J Food Sci.Nutr, 2000;. 51:189-193. 23. Madode YE, Houssou PA, Linnemann AR, Hounhouigan DJ, Nout MJR and. MAJS van Boekel Preparation, consumption and nutritional composition ...

  5. File list: InP.Liv.05.AllAg.Liver_tumor [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available InP.Liv.05.AllAg.Liver_tumor mm9 Input control Liver Liver tumor SRX1008194,SRX1008...193 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.Liv.05.AllAg.Liver_tumor.bed ...

  6. File list: InP.Liv.20.AllAg.Liver_tumor [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available InP.Liv.20.AllAg.Liver_tumor mm9 Input control Liver Liver tumor SRX1008194,SRX1008...193 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.Liv.20.AllAg.Liver_tumor.bed ...

  7. File list: InP.Liv.50.AllAg.Liver_tumor [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available InP.Liv.50.AllAg.Liver_tumor mm9 Input control Liver Liver tumor SRX1008194,SRX1008...193 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.Liv.50.AllAg.Liver_tumor.bed ...

  8. Developing and implementing assessment moderation procedures ...

    African Journals Online (AJOL)

    This paper is intended to help draw assessment moderation procedures to significantly minimize discrepancies between teachers in marking lab reports. It also helps students to develop their report writing skills. A population of 193 students taking two chemistry laboratory courses and a team of three instructors were used ...

  9. Herbal therapies used by hypertensive patients in Turkey | Bahar ...

    African Journals Online (AJOL)

    The purpose of this study was to determine herbal therapies used by the patients for regulation of blood pressure. This descriptive study was conducted in three districts of Izmir, Turkey. The study group included 193 patients with hypertension diagnosis who admitted to a primary care center and accepted to participate in ...

  10. Keyboarding Instruction at NABTE Institutions: Are We Teaching Techniques to Reduce CTD Incidence?

    Science.gov (United States)

    Blaszczynski, Carol; Joyce, Marguerite Shane

    1996-01-01

    Responses from 157 of 193 business teachers who teach keyboarding indicated that 78.7% were aware of cumulative trauma disorder and 22% had experienced it. Only 13% of classrooms were equipped with wrist rests. About 53% teach techniques to reduce incidence, but 20% did not know whether they taught preventive measures. (SK)

  11. Gray Zone Warfare: German and Russian Political Warfare, 1935-1939, and 2001

    Science.gov (United States)

    2017-06-09

    Irregular Warfare, Unconventional Warfare, Hybrid, and 107 John Chambers , Countering Gray-Zone...111 Chambers , 5. Diplomatic, Information, Military, and Economic variables refers to the U.S. Army analytical framework. 112 Dickey et al. 113...media under German control reported, “ bloody terror, unleashed mobs, massacre and looting,” with reports of widespread murder of Sudeten Germans.193

  12. Banerjee R Control of partial synchronization in chaotic oscillators ...

    Indian Academy of Sciences (India)

    see Laha U. 555. Bose Indrani. Early signatures of regime shifts in complex dynamical systems. 193. Cari˜nena José F. Generalized virial theorem for the Liénard- type systems. 373. Carmel Vigila Bai G M ... On symmetry groups of a 2D nonlinear diffu- sion equation with source. 543. Cross M C. Building better oscillators ...

  13. 75 FR 11986 - Public Comments for Multilateral Negotiations in the World Trade Organization on Expansion of the...

    Science.gov (United States)

    2010-03-12

    ..., specifically additions to the lists of pharmaceutical active ingredients; prefixes and suffixes that could be... from WHO lists 1-93.) Prefixes and suffixes that could be associated with the INNs in Table 1...). Comments pertaining to the additions to the list of prefixes or suffixes for salt, ester or hydrate forms...

  14. Systemic conditions among dental patients in Benin City, Nigeria ...

    African Journals Online (AJOL)

    Of the 199 (19.3%) patients on medications, anti-microbial drugs were the most commonly used (7.0%). Over 56% of the subjects had a medical condition. Drug allergy (26.6%), respiratory diseases (8.2%), arthritis (5.0%) and cardiovascular diseases (5.0%) were most frequently reported. The high frequency of medical ...

  15. PATTERNS OF SEVEN AND COMPLICATED MALARIA IN CHILDREN

    African Journals Online (AJOL)

    GB

    rate of Plasmodium development in the vector mosquitoes (3, 7-10). ... area as a result of changes in environmental factors is of paramount importance ..... and malaria in Nigeria. J Vector Borne Dis,. 2010 Dec;47(4):193-203. 9. Lieshout Mv, Kovats RS, Livermore MTJ, Martens. P. Climate change and malaria: analysis ofthe.

  16. Download this PDF file

    African Journals Online (AJOL)

    Dr Olaleye

    Res. Vol.15 (September 2012); 193 - 196. Research Paper. Estimation of Indoor Radon from Concrete Blocks Used In. Construction of Wall in Typical Nigerian Dwellings. Janet A. Ademola. Department of Physics, University of Ibadan, Ibadan, Nigeria. ABSTRACT. Radon gas is the most important source of natural radiation.

  17. Association of the GRM4 gene variants with juvenile myoclonic ...

    Indian Academy of Sciences (India)

    J. Genet. 93, 193–197. Table 1. Details of the SNPs, primers, PCR condition and the restriction enzymes used for genotyping. Annealing temperature (. ◦. C)/. SNP name/ extension time (s)/ Size. Restriction. Digested fragments. ID*. Location Allele Primer pairs for PCR (5 –3 ) no. of cycles. (bp) enzyme. (bp). SNP1. 5 UTR.

  18. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Volume 31 Issue 2 April 2008 pp 193-195 Nanomaterials. Mesoscale organization of CuO nanoslices: Formation of sphere · Jun Wang Shunxiao Zhang ... Volume 31 Issue 4 August 2008 pp 597-601 Nanomaterials. ZnO nanostructured microspheres and grown structures by thermal treatment · Jun Wang Shunxiao Zhang ...

  19. UNESCO's activities in ethics.

    NARCIS (Netherlands)

    Have, H.A.M.J. ten

    2010-01-01

    UNESCO is an intergovernmental organization with 193 Member States. It is concerned with a broad range of issues regarding education, science and culture. It is the only UN organisation with a mandate in science. Since 1993 it is addressing ethics of science and technology, with special emphasis on

  20. 78 FR 68373 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; 2013 Commercial Accountability...

    Science.gov (United States)

    2013-11-14

    ... measures (AMs) for the commercial sector for gag in the exclusive economic zone (EEZ) of the South Atlantic... annual catch limit (ACL). Therefore, NMFS closes the commercial sector for gag on November 13, 2013, for... Sec. 622.193(c)(1), NMFS is required to close the commercial sector for gag when the commercial ACL...

  1. Relationships among Preservice Primary Mathematics Teachers' Gender, Academic Success and Spatial Ability

    Science.gov (United States)

    Turgut, Melih; Yilmaz, Suha

    2012-01-01

    The aim of this work is to investigate relationships among pre-service primary mathematics teachers' gender, academic success and spatial ability. The study was conducted in Izmir with 193 pre-service primary mathematics teachers of Dokuz Eylul University. In the work, spatial ability test, which consists of two main sub-tests measuring spatial…

  2. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. A Yu Kwaretzkheli. Articles written in Pramana – Journal of Physics. Volume 68 Issue 2 February 2007 pp 193-199. On the transmutation of Am in a fast lead-cooled system · B P Kochurov V N Konev A Yu Kwaretzkheli · More Details Abstract Fulltext PDF. Characteristics of the ...

  3. Prevalence of mental disorders in a prison population in Durban ...

    African Journals Online (AJOL)

    Objective: The aim of this study was to determine the prevalence of serious mental disorders in a prison population in Durban, South Africa, one of the largest prisons in the Southern hemisphere. Method: 193 prisoners were interviewed using the Mini Neuro-psychiatric Interview, a screening questionnaire and a ...

  4. 77 FR 27065 - Agency Forms Undergoing Paperwork Reduction Act Review

    Science.gov (United States)

    2012-05-08

    ... average of 14 years earlier than nonsmokers. Moreover, cigarette smoking costs more than $193 billion; $97... Smoking Prevention and Tobacco Control Act (Tobacco Control Act) in 2009, the FDA is legally mandated to.... As novel tobacco products are introduced onto the market, the FDA must regularly monitor patterns of...

  5. AcEST: BP918640 [AcEST

    Lifescience Database Archive (English)

    Full Text Available transposon Ty5-1 protein YCL075W O... 33 0.74 sp|P06010|RCEM_RHOVI Reaction center protein M chain OS=Rhodo...8 RHVPQLKKSLIS 193 +VP L +LIS Sbjct: 134 SYVPDLPVNLIS 145 >sp|P06010|RCEM_RHOVI Reaction center protein M ch

  6. Relations of Work Identity, Family Identity, Situational Demands, and Sex with Employee Work Hours

    Science.gov (United States)

    Greenhaus, Jeffrey H.; Peng, Ann C.; Allen, Tammy D.

    2012-01-01

    This study examined relations of multiple indicators of work identity and family identity with the number of weekly hours worked by 193 married business professionals. We found that men generally worked long hours regardless of the situational demands to work long hours and the strength of their work and family identities. Women's work hours, on…

  7. 78 FR 25861 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; 2013 Commercial Accountability...

    Science.gov (United States)

    2013-05-03

    ... measures for the commercial sector for golden tilefish in the exclusive economic zone (EEZ) of the South.... Therefore, NMFS closes the commercial sector for golden tilefish in the South Atlantic EEZ on May 5, 2013...(a)(2). Under 50 CFR 622.193(a)(1), NMFS is required to close the commercial sector for golden...

  8. Debasheesh Parveen, Facebot

    Directory of Open Access Journals (Sweden)

    Eugenio Tisselli (University of Applied Arts

    2015-12-01

    Full Text Available http://dx.doi.org/10.5007/1807-9288.2015v11n2p193 The following letter was written by Debasheesh Parveen a “Facebot” (Facebook bot programmed by Eugenio Tisselli. Debasheesh Parveen appeared on Facebook on December 2009, and has been posting uninterruptedly since then.

  9. Return of the Balkans: Challenges to European Integration and U.S. Disengagement

    Science.gov (United States)

    2013-05-01

    web/20090426011014/www.eubusiness.com/news-eu/1229351535.73. 192. Ibid. 193. See Rosa Balfour and Corina Stratulat, “Enlargement to the Balkans: One...Rosa Balfour and Corina Stratulat, “The Democratic Transformation of the Balkans,” Brussels, Belgium: European Policy Center, Issue Paper, No. 66

  10. 76 FR 61566 - Significant New Use Rules on Certain Chemical Substances

    Science.gov (United States)

    2011-10-05

    ... Chemical names: (P-09-193) Phosphonic acid, P-[2-[bis(2- hydroxyethyl)amino]ethyl]-, bis(2-chloroethyl... Sec. 721.170(b)(4)(ii). Recommended testing: EPA has determined that the results of a fish acute... substance. Fish and daphnid testing should be performed using the flow-through method with measured...

  11. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. Sergio H Franchito. Articles written in Journal of Earth System Science. Volume 118 Issue 3 June 2009 pp 193-207. A diagnosis of rainfall over South America during 1997/98 El Niño and 1998/99 La Niña events: Comparison between TRMM PR and GPCP rainfall ...

  12. A Study of the Less-Developed-Countries Debt Crisis in Mexico and Subsequent Economic Policies

    Science.gov (United States)

    2012-09-01

    15 Lederman , Mahoney, and Serve´n, Lessons from NAFTA, 2. 16 Esquivel and Hernández-Trillo, “How Can Reforms Help Deliver Growth in Mexico?,” 193... Lederman , Daniel, William F. Mahoney, and Luis Serve´n. Lessons from NAFTA. World Bank and Stanford University Press, 2005. Lehoucq, Fabrice

  13. Supporting the Students Most in Need: Academic Self-Efficacy and Perceived Teacher Support in Relation to Within-Year Academic Growth

    Science.gov (United States)

    Mercer, Sterett H.; Nellis, Leah M.; Martinez, Rebecca S.; Kirk, Megan

    2011-01-01

    Academic self-efficacy and perceived teacher support in relation to academic skill growth across one academic year were examined in the study. Participants included 193 5th-grade students. Teachers collected curriculum-based measures (CBM) of reading and math on three occasions as part of routine academic benchmarks, and researchers collected…

  14. ORF Alignment: NC_006511 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006511 gi|56413338 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

  15. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62180303 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

  16. Table 1. List of SNPs within ESR1 gene that was positively ...

    Indian Academy of Sciences (India)

    karray

    Korean vegetarian men. Med Princ Pract. 19(3), 200-5. Kishi T., Ikeda M., Kitajima T., Yamanouchi Y., Kinoshita Y., Kawashima K., et al. 2009 A functional polymorphism in estrogen receptor alpha gene is associated with Japanese methamphetamine induced psychosis. Prog Neuropsychopharmacol Biol · Psychiatry. 33(5) ...

  17. Histone Methylation and Epigenetic Silencing in Breast Cancer

    Science.gov (United States)

    2011-02-01

    methylation of histone H1 or nucleosomal histone H3, Mol. Cell 14 (2004) 183–193. [64] C. Martin , R. Cao, Y. Zhang, Substrate preferences of the EZH2...101] N.A. Lobo , Y. Shimono, D. Qian, M.F. Clarke, The biology of cancer stem cells, Annu. Rev. Cell Dev. Biol. 23 (2007) 675–699. [102] J. Stingl, C

  18. Communication Technology: Pros and Cons of Constant Connection to Work

    Science.gov (United States)

    Diaz, Ismael; Chiaburu, Dan S.; Zimmerman, Ryan D.; Boswell, Wendy R.

    2012-01-01

    We examined the relationship between employees' attitudes related to communication technology (CT) flexibility, communication technology (CT) use, work-to-life conflict and work satisfaction. Based on data obtained from 193 employees, CT flexibility predicted more CT use. Further, CT use was associated not only with increased work satisfaction,…

  19. New data on “kerolite–pimelite” series and the colouring agent of Szklary chrysoprase, Poland

    Czech Academy of Sciences Publication Activity Database

    Čermáková, Zdeňka; Hradil, David; Bezdička, Petr; Hradilová, J.

    2017-01-01

    Roč. 44, č. 3 (2017), s. 193-202 ISSN 0342-1791 R&D Projects: GA ČR(CZ) GA14-22984S Institutional support: RVO:61388980 Keywords : Pimelite * Colourant * Interlayer water * Chrysoprase * X-ray diffraction * Thermal analysis Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.521, year: 2016

  20. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    More Details Fulltext PDF. pp 179-192. The Case of Missing Solar Neutrinos with their Split Personalities · S M Chitre · More Details Fulltext PDF. pp 193-202. Dirac's Conception of the Magnetic Monopole, and its Modern Avatars · Sunil Mukhi · More Details Fulltext PDF. pp 203-216. Magnetic Resonance Imaging: Window ...

  1. Resonance Special Issue - World Year of Physics -RE ...

    Indian Academy of Sciences (India)

    Amit Roy. 176. Ludwig Boltzmann and Entropy. Sriram Ramaswamy. 179 The Case of Missing Solar Neutrinos with their Split Personalities. S M Chitre. 193. Dirac's Conception of the Magnetic Monopole, and its Modern Avatars. Sunil Mukhi. 203. Magnetic Resonance Imaging: Window to a Watery World. Kavita Dorai. 217.

  2. 78 FR 22551 - Agency Forms Undergoing Paperwork Reduction Act Review

    Science.gov (United States)

    2013-04-16

    ... declined from 20.9% to 19.3%. Despite this decrease, smoking rates are still well above Healthy People 2020.... residents aged 18- 65. The sample frame will consist of a national random digit dial sample of telephone numbers from a frame of known cell phone exchanges. Respondents reached on their cell phones will be asked...

  3. 77 FR 35404 - Agency Forms Undergoing Paperwork Reduction Act Review

    Science.gov (United States)

    2012-06-13

    ... declined from 20.9% to 19.3%. Despite this decrease, smoking rates are still well above Healthy People 2010... 18- 65. The sample frame will consist of a national random digit dial sample of telephone numbers from a frame of known cell phone exchanges. Respondents reached on their cell phones will be asked to...

  4. Discharge instabilities in high-pressure fluorine based excimer laser gas mixtures

    NARCIS (Netherlands)

    Mathew, D.

    2007-01-01

    Fluorine based excimer lasers such as KrF, ArF and F2 are currently the most powerful sources available in the ultraviolet wavelength range, operating at 248 nm, at 193 nm and at 157 nm, respectively. They are thus of central importance for numerous applications in this range. At these short

  5. Comparative Assessment of Knowledge, Attitude and Practice of ...

    African Journals Online (AJOL)

    TNHJOURNALPH

    5.20. 0.193. 0.273. Table 4: Practice of Cervical Cancer Screening. Variable. Practice of. CxCancer. Screening. Yes. No. Reasons for. Non -performance. OfCxCancer. Screening. Fear of having a. Positive test. Result. Cost of service. Lack of money. Because of. Shyness. Not Aware of the. Screening centre. None availability.

  6. 21st Century Conceptions of Musical Ability

    Science.gov (United States)

    Hallam, Susan

    2010-01-01

    This study explored conceptions of musical ability using an inventory derived from previous qualitative research. Participants included 102 musicians, 95 educators, 132 adult amateur musicians, 60 adults who were not actively engaged in making music, 193 children actively engaged in making music in addition to their engagement with the school…

  7. AcEST: DK951302 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=Zea m... 75 3e-12 tr|A5ATK9|A5ATK9_VITVI Putative uncharacterized protein OS=Vitis... 75 3e-12 tr|B6TMJ7|B6TMJ...jct: 193 SESPNKIPEETGYGKYESSKTGLFVKINMDGVPIGRKVDLKACDSYEKLSYAVDDLFRGL 252 Query: 661 VS 666 +S Sbjct: 253 LS 254 >tr|B6TMJ7|B6TMJ

  8. Inimesel on raske muutuda, aga teistel on veel raskem neid muutusi märgata / Teeli Remmelg

    Index Scriptorium Estoniae

    Remmelg, Teeli

    2005-01-01

    Ilmunud ka: Delovõje Vedomosti : Upravlenije i Obutshenije 12. okt. lk. 6; Juhi ideelaegas. - Tallinn, 2006, lk. 190-193. Firmades 360 kraadi tagasiside meetodit rakendanud juhtide sõnul on teise inimese muutumise märkamine olulisemalt raskem kui endal muutuda. Kommenteerib Aira Tammemäe

  9. Evaluating Voltage Regulation Compliance of MIL-PRF-GCS600A (Army) for Vehicle On-Board Generators and Assessing Overall Vehicle Bus Compliance

    Science.gov (United States)

    2012-08-16

    Characterization • Back EMF Measurement and Characterization • Rotor Inertia • Spinning Losses (Iron Loss, Friction, Windage) – Spin Down Test...Speed (rpm) UNCLASSIFIED UNCLASSIFIED Electrical and Mechanical Response Estimation 16 August 2012 1.87 1.88 1.89 1.9 1.91 1.92 1.93 1.94 1.95

  10. Group Patient Education: Effectiveness of a Brief Intervention in People with Type 2 Diabetes Mellitus in Primary Health Care in Greece: A Clinically Controlled Trial

    Science.gov (United States)

    Merakou, K.; Knithaki, A.; Karageorgos, G.; Theodoridis, D.; Barbouni, A.

    2015-01-01

    This study aims to assess the impact of a brief patient group education intervention in people with type 2 diabetes mellitus. The sample, 193 people with type 2 diabetes mellitus who were patients at the diabetic clinic of a primary health care setting in Attica, was assigned to two groups, intervention (138 individuals) and control group (55…

  11. Earlier Debridement and Antibiotic Administration Decrease Infection

    Science.gov (United States)

    2010-01-01

    Discussion Gustilo and Anderson stated “[t]here is universal agree- ment that open fractures require emergency treatment including adequate debridement...polymethylmethacrylate beads and hip spacers in vivo. Acta Orthop. 80(2):193– 197, 2009. 10. Gustilo , R. B., Anderson, J. T. Prevention of infection

  12. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    This is the first report of extreme radioresistance in nitrogen-fixing Anabaena cultures. Volume 41 Issue 2 June 2016 pp 193-203 Article. In situ real-time evaluation of radiation-responsive promoters in the extremely radioresistant microbe Deinococcus radiodurans · Narasimha Anaganti Bhakti Basu Shree Kumar Apte.

  13. Speed Daemon: Experience-Based Mobile Robot Speed Scheduling

    Science.gov (United States)

    2014-10-01

    a wheeled mobile robot. Robotica , 20(2): 181–193, 2002. [7] O. Purwin and R. D‘Andrea. Trajectory generation and control for four wheeled...robot on an uneven surface. Robotica , 27(4):481–498, 2009. [9] S. Thrun, M. Montemerlo, H. Dahlkamp, D. Stavens, A. Aron, J. Diebel, P. Fong, J. Gale

  14. Case report

    African Journals Online (AJOL)

    abp

    2015-01-05

    Jan 5, 2015 ... a complication of pituitary adenoma: Clinical cases of British endocrine society. Endocr. Abstr. 2010;21:193. PubMed | Google Scholar. Tableau 1: les cas de méningites bactériennes dans un contexte d'adénome hypophysaire survenant en dehors de tout traitement dans la littérature. Titre de l'article.

  15. MSmetrix: accurate untrained method for longitudinal lesion segmentation

    OpenAIRE

    Jain, Saurabh; Sima, Diana; Maertens, Anke; Van Huffel, Sabine; Maes, Frederik; Smeets, Dirk

    2015-01-01

    Jain S., Sima D.M., Maertens A., Van Huffel S., Maes F., Smeets D., ''MSmetrix: accurate untrained method for longitudinal lesion segmentation'', Multiple sclerosis journal, vol. 21 (S11), pp. 193-194, 2015 (31th congress of the European Committee for Treatment and Reseach in Multiple Sclerosis (ECTRIMS), October 7-10, 2015, Barcelona, Spain).

  16. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 193 ... Vol 2, No 1 (1999), Effects of Accel and Carbaryl on Apple Tree Nutrition and Fruit Yield, Abstract. George Ouma, Frank Matta. Vol 5, No 1 (2003), Effects of Ethephon on the Growth, Yield and Yield Components of Beans (Phaseolus vulgaris L.) Abstract. TM Ngatia, SI Shibairo, VE Emongor, JW Kimenju.

  17. Pressure effect on rate of production of glucose-equivalent in plant ...

    Indian Academy of Sciences (India)

    Administrator

    Plant Physiol. 94 1728; (h) Salvucci M E and Crafts-. Brandner S J 2004 Physiol. Planta 120 179; 2004. Physiol. Planta 122 513; 2004 Plant, Cell and Envi- ronment 34 1460; (i) Gross L J, Kirschbaum M U F and Pearcy R W 1991 Plant, Cell and Environment. 14 881; (j) Farquhar G D 1979 Arch. Biochem. Bio- phys. 193 456 ...

  18. Commentary: Analysing phenotypic variation: when old-fashioned ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 27; Issue 3. Commentary: Analysing phenotypic variation: when old-fashioned means up-to-date. Vincent Debat Jean R David. Volume 27 Issue 3 June 2002 pp 191-193. Fulltext. Click here to view fulltext PDF. Permanent link:

  19. Criterion 1: Conservation of biological diversity - Indicator 8: The number of forest dependent species that occupy a small portion of their former range

    Science.gov (United States)

    Curtis H. Flather; Carolyn Hull Sieg; Michael S. Knowles; Jason McNees

    2003-01-01

    This indicator measures the portion of a species' historical distribution that is currently occupied as a surrogate measure of genetic diversity. Based on data for 1,642 terrestrial animals associated with forests, most species (88 percent) were found to fully occupy their historic range - at least as measured by coarse state-level occurrence patterns. Of the 193...

  20. Curbing Digital Distractions in the Classroom

    Science.gov (United States)

    Seemiller, Corey

    2017-01-01

    Whether banking, communicating, watching television, or shopping, people can now do nearly anything on their personal digital devices. This digital access even extends to the college classroom where students use their personal devices for a multitude of non-class related purposes. Findings from a survey of 193 college undergraduates found that…

  1. Page 1 Dynamic behaviour of the Timoshenko beam finite elements ...

    Indian Academy of Sciences (India)

    Dynamic behaviour of the Timoshenko beam finite elements 193. For quadratic interpolation of both w and @x, the element matrices are of the order 6 × 6 for pure bending case. Interdependent interpolation element (IIE): For this case, the stiffness matrix and load. Vector are given in (25) [and the same as in (74)]. The mass ...

  2. A Model of Emotion Management for U.S. Army Leaders

    Science.gov (United States)

    2010-12-01

    Rauch and G. F. Carr (Eds.), Semiotics around the world: Synthesis in diversity (pp.191-193). Ekman, P. (1999). Basic emotions. In T. Dalgeish and...Taylor, C. (1985). Human agency and language . Philosophical papers (Vol. 1). Cambridge, UK: Cambridge University Press. Taylor, S. E. (1991

  3. Effect of Personality Types of Extension Personnel on their Job ...

    African Journals Online (AJOL)

    ... of extension personnel of 0.411 at 0.01level of significance, with more of the extension personnel with ESFJ (Extroverted feeling with sensing) (29.82%) personality type followed by ISFJ (Introverted sensing with feeling) (19.3%) and ENFJ (Extroverted feeling with intuiting) (12.28), ENFP (Extroverted intuiting with feeling), ...

  4. A Result on the Computational Complexity of Heuristic Estimates for the A Algorithm.

    Science.gov (United States)

    1983-01-01

    alla Teoria doi Problemi." i i 4 a..... . - 22 - P__ e£jnjs of AICA 1980, Bari, Italy, 177-193 (in Italian). [HNRaph68] Hart, Peter A., Nils J. Nilsson...Risoluzione Automatics dei Prob- lemi." Al. fjjuena.A March 1975 (in Italian). [VaitSO] Vsitorta, Marco. "Un Contributo als Teoria dells Risoluzione dei

  5. Genome-Wide Association Study with Sequence Variants Identifies Candidate Genes for Mastitis Resistance in Dairy Cattle

    DEFF Research Database (Denmark)

    Sahana, Goutam; Guldbrandtsen, Bernt; Bendixen, Christian

    in the six QTL regions were imputed in 5,193 genotyped bulls using Beagle v3.3. After imputation and quality control there were on average 4,600 markers/Mbp. Association analyses with imputed sequence data were repeated for the targeted regions. Functional annotations of the variants were done using Variant...

  6. Custodial Grandmother-Grandfather Dyads: Pathways among Marital Distress, Grandparent Dysphoria, Parenting Practice, and Grandchild Adjustment

    Science.gov (United States)

    Smith, Gregory C.; Hancock, Gregory R.

    2010-01-01

    An adaptation of the Family Stress Model was examined using structural equation modeling with data from 193 custodial grandmother-grandfather dyads. The model's measurement and structural components were largely invariant by grandparent gender. For grandmothers and grandfathers alike, the effects of their psychological and marital distress on…

  7. Preoperative CT-based nomogram for predicting overall survival in women with non-endometrioid carcinomas of the uterine corpus

    NARCIS (Netherlands)

    Lakhman, Y.; Yakar, D.; Goldman, D.A.; Katz, S.S.; Vargas, H.A.; Micc\\`o, , Maura; Zheng, J.; Moskowitz, C.S.; Soslow, R.A.; Hricak, H.; Abu-Rustum, N.R.; Sala, E.

    2015-01-01

    To develop a preoperative CT-based nomogram for predicting overall survival (OS) in patients with non-endometrioid carcinomas of the uterine corpus.Waiving informed consent, the institutional review board approved this HIPAA-compliant, retrospective study of 193 women with histopathologically proven

  8. Síndrome de alienación parental en los procesos de divorcio de la pareja /

    OpenAIRE

    Pérez Agüero, María Cristina

    2011-01-01

     tesis que para obtener el grado de Doctor en Psicología, presenta María Cristina Pérez Agüero ; asesor Patricia Andrade Palos. 193 páginas : diagramas. Doctorado en Psicología UNAM, Facultad de Psicología, 2011

  9. TABLE OF CONTENTS TABLE OF CONTENTS

    African Journals Online (AJOL)

    eobe

    S. O. Otuagoma,. E. A. Ogujor and. P. A. Kuale. 184. Hybrid Modulation Scheme for Cascaded H-Bridge Inverter. Cells. C. I. Odeh 193. Impact of Queuing on Call Completion Rate in GSM Networks. M. A. Nkop, K. M. Udofia,. M. Umoren. 203. Cloud Computing in Nigeria: The Cloud Ecosystem Perspective. F. M. Dahunsi and.

  10. CAN PROSTATE CANCER BE PREDICTED IN BPH PATIENTS WITH

    African Journals Online (AJOL)

    Objective To define a predictor of prostate cancer in BPH patients with an inter- mediate PSA (4.1-10 ng/ml) and a negative initial sextant biopsy. Patients and Methods During 1999, 193 BPH patients with an intermediate PSA (4.1-10 ng/ml) underwent TRUS and sextant bi- opsy. The patients whose initial biopsies.

  11. Racing in the Marathon or Traveling to a Mysterious Place: Prospective Primary Teachers' Conceptions of Experienced and Ideal Learning

    Science.gov (United States)

    Saban, Ahmet; Koçbeker-Eid, Beyhan Nazli; Saban, Aslihan

    2014-01-01

    In this study, Turkish primary teacher candidates' experienced and ideal conceptions of learning were examined through metaphors. The participants of this phenomenological study included 193 sophomores taking the "Principles and Methods of Teaching" course at Ahmet Kelesoglu Education Faculty, Necmettin Erbakan University, in the fall of…

  12. Measurement of the relative branching ratio of $D^+ \\to \\pi^- \\pi^+ \\pi^+$ to $D^+ \\to K^- \\pi^+ \\pi^+$

    Energy Technology Data Exchange (ETDEWEB)

    Kravchenko, Natasa [Brandeis Univ., Waltham, MA (United States)

    2008-05-01

    We present a measurement of the relative branching ratio of the Cabibbo-suppressed D+ meson decay into three charged pions using 193 pb-1 of data collected by CDF II detector at Fermilab's Tevatron.

  13. Transnational Strategies for the Promotion of Physical Activity and Active Aging: The World Health Organization Model of Consensus Building in International Public Health

    Science.gov (United States)

    Chodzko-Zajko, Wojtek; Schwingel, Andiara

    2009-01-01

    In this paper we focus our attention on an examination of the four-step process adopted by the World Health Organization (WHO) in its systematic campaign to promote physically active lifestyles by older adults across the 193 WHO member states. The four steps adopted by the WHO include (1) Building Consensus Among Professionals; (2) Educating the…

  14. Explaining the performance of Chinese equity funds

    NARCIS (Netherlands)

    Huang, Xiaohong; Shi, Qiqiang

    2013-01-01

    This paper examines the determinants of Chinese equity fund performance measured by market benchmark adjusted returns and risk adjusted return (Jensen’s Alpha). The sample covers 193 equity funds from January 2006 to December 2011, including both bear (2008 and 2011) and bull (2006, 2007, 2009, and

  15. Association of light-to-moderate alcohol drinking in pregnancy with preterm birth and birth weight

    DEFF Research Database (Denmark)

    Strandberg-Larsen, Katrine; Poulsen, Gry; Bech, Bodil Hammer

    2017-01-01

    Women who drink light-to-moderately during pregnancy have been observed to have lower risk of unfavourable pregnancy outcomes than abstainers. This has been suggested to be a result of bias. In a pooled sample, including 193 747 live-born singletons from nine European cohorts, we examined the ass...

  16. Communication Ethics in the Communication Curriculum: United States, Canada, and Puerto Rico

    Science.gov (United States)

    Swenson-Lepper, Tammy; Leavitt, Michelle A.; Hoffer, Melba; Charron, Lori N.; Ballard, Robert L.; Bell McManus, Leeanne M.; Holba, Annette M.; Jovanovic, Spoma; Tompkins, Paula S.

    2015-01-01

    This study investigated the status of communication ethics pedagogy at colleges and universities in the United States, Canada, and Puerto Rico. Data were collected from 193 institutions that responded to an online survey. Results showed an increase in communication ethics courses compared with 19 years ago, with 51% now offering a required or…

  17. Dicty_cDB: Contig-U16424-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 19K01_F.ab1 adult sheep fracture callus 7d ... 40 0.72 3 ( CU654057 ) ovine foetal ovary tissues (Prophase I...sbb001f193d17f0 Sorghum methylation filtered lib... 34 0.70 2 ( DY496661 ) sh2P00

  18. Modular Synthesis of 5-Substituted Furan-2-yl C-2'-Deoxyribonucleosides and Biaryl Covalent Base-pair Analogues

    Czech Academy of Sciences Publication Activity Database

    Bárta, Jan; Slavětínská, Lenka; Klepetářová, Blanka; Hocek, Michal

    -, č. 28 (2010), s. 5432-5443 ISSN 1434-193X R&D Projects: GA MŠk LC512; GA AV ČR IAA400550902 Institutional research plan: CEZ:AV0Z40550506 Keywords : C-nucleosides * furans * C-glycosidation * cross-coupling reactions Subject RIV: CC - Organic Chemistry Impact factor: 3.206, year: 2010

  19. : tous les projets | Page 637 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Date de début : 31 mars 2006. End Date: 17 mars 2009. Sujet: VIOLENCE, CONFLICTS, GENDER ROLES, LEADERSHIP, EMPOWERMENT, WOMEN. Région: India, Central Asia, Far East Asia, South Asia. Programme: Gouvernance et justice. Financement total : CA$ 193,100.00. Négociation de la participation citoyenne ...

  20. Defense Acquisition Research Journal. Volume 24, Number 1, Issue 80, January 2017

    Science.gov (United States)

    2017-01-01

    2001). Managing people in agile organisations . In A. Gunasekaran (Ed.), Agile Manufacturing: The 21st. Century Competitive Strategy (pp. 193–202...Drive consensus  Rushing to meet milestones  Combine programs to get one aircraft  Meet multi-Services’ missions and operat- ing environments...Weight Requirements Dierent Services’ Operating Environments Services’ Changing Requirements Driving Consensus Forces Concessions Increased Weight

  1. The use of Raman spectroscopy for the monitoring of changes in the glass structure of the thin layers caused by ion implantation

    Czech Academy of Sciences Publication Activity Database

    Nekvindová, P.; Švecová, B.; Staněk, S.; Vytykačová, S.; Macková, Anna; Malinský, Petr; Machovič, V.; Špirková, J.

    2015-01-01

    Roč. 59, č. 3 (2015), s. 187-193 ISSN 0862-5468 R&D Projects: GA ČR(CZ) GBP108/12/G108; GA MŠk LM2011019 Institutional support: RVO:61389005 Keywords : glasses * nano particles * Raman spectroscopy * ion implantation Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.485, year: 2015

  2. A study of the behaviour of copper in different types of silicate glasses implanted with Cu+ and O+ ions

    Czech Academy of Sciences Publication Activity Database

    Švecová, B.; Vařák, P.; Vytykačová, S.; Nekvindová, P.; Macková, Anna; Malinský, Petr; Bottger, R.

    2017-01-01

    Roč. 406, SEP (2017), s. 193-198 ISSN 0168-583X R&D Projects: GA MŠk LM2015056; GA ČR GA15-01602S Institutional support: RVO:61389005 Keywords : silicate glasses * ion implantation * copper Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.109, year: 2016

  3. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 193 ... Vol 10 (2012), Assessment of Mini-Livestock Farming in Peri-Urban Areas of Southwestern Nigeria: Implication for Policy Formulation, Food Security and Poverty Alleviation, Abstract. SI Ogunjimi ... Vol 3 (2004), CYBER LIVESTOCK COMMUNICATION IN RURAL INDIA: A STRATEGIC MODEL, Abstract.

  4. 31 CFR 356.23 - How are the auction results announced?

    Science.gov (United States)

    2010-07-01

    ...) FISCAL SERVICE, DEPARTMENT OF THE TREASURY BUREAU OF THE PUBLIC DEBT SALE AND ISSUE OF MARKETABLE BOOK-ENTRY TREASURY BILLS, NOTES, AND BONDS (DEPARTMENT OF THE TREASURY CIRCULAR, PUBLIC DEBT SERIES NO. 1-93... to, the public; (6) The amounts of bids tendered and accepted from the Federal Reserve Banks for...

  5. 31 CFR 356.4 - What are the book-entry systems in which auctioned Treasury securities may be issued?

    Science.gov (United States)

    2010-07-01

    ... PUBLIC DEBT SALE AND ISSUE OF MARKETABLE BOOK-ENTRY TREASURY BILLS, NOTES, AND BONDS (DEPARTMENT OF THE TREASURY CIRCULAR, PUBLIC DEBT SERIES NO. 1-93) General Information § 356.4 What are the book-entry systems... eligible to be held in the receiving system. See Department of the Treasury Circular, Public Debt Series No...

  6. 31 CFR 356.11 - How are bids submitted in an auction?

    Science.gov (United States)

    2010-07-01

    ...) FISCAL SERVICE, DEPARTMENT OF THE TREASURY BUREAU OF THE PUBLIC DEBT SALE AND ISSUE OF MARKETABLE BOOK-ENTRY TREASURY BILLS, NOTES, AND BONDS (DEPARTMENT OF THE TREASURY CIRCULAR, PUBLIC DEBT SERIES NO. 1-93... the Bureau of the Public Debt and provide the requested information. We have the option of accepting...

  7. 31 CFR 356.33 - Does the Treasury have any discretion in the auction process?

    Science.gov (United States)

    2010-07-01

    ... Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY BUREAU OF THE PUBLIC DEBT SALE... CIRCULAR, PUBLIC DEBT SERIES NO. 1-93) Miscellaneous Provisions § 356.33 Does the Treasury have any... provide a public notice if we change any auction provision, term, or condition. (c) We reserve the right...

  8. 31 CFR 356.30 - When does the Treasury pay principal and interest on securities?

    Science.gov (United States)

    2010-07-01

    ... Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY BUREAU OF THE PUBLIC DEBT SALE... CIRCULAR, PUBLIC DEBT SERIES NO. 1-93) Miscellaneous Provisions § 356.30 When does the Treasury pay... it under its terms, which include providing appropriate public notice. (b) Treasury inflation...

  9. Discrete element simulation of internal stress in SiCp/aluminum ...

    African Journals Online (AJOL)

    2002-07-22

    Jul 22, 2002 ... 11, pp. 1339-1345. Liu B., Liu L. R., Liu X. J. 2013, Effects of carbon nanotubes on crystallization in amorphous Ni-P electroplating coating, Surface. Engineering, Vol. 29, No. 3, pp. 190-193. Liu B., Liu L. 2013, Interfaces between carbon nanotubes and nickel nanoparticles in carbon nanotubes, Functional ...

  10. Photochemical degradation of dissolved organic matter reduces the availability of phosphorus for aquatic primary producers

    Czech Academy of Sciences Publication Activity Database

    Porcal, Petr; Kopáček, Jiří

    2018-01-01

    Roč. 193, FEB (2018), s. 1018-1026 ISSN 0045-6535 R&D Projects: GA ČR GA15-09721S Institutional support: RVO:60077344 Keywords : photochemistry * phosphorus * dissolved organic matter * aluminum * iron Subject RIV: DA - Hydrology ; Limnology OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 4.208, year: 2016

  11. Dicty_cDB: Contig-U15444-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 193 7e-48 CP001323_925( CP001323 |pid:none) Micromonas sp. RCC299 chromosome... 192 2e-47 AY924997_1( AY924997 |pid:none) Jakob...ome... 155 2e-36 AY925006_1( AY925006 |pid:none) Jakoba libera Rpl7A gene, partial ... 144 7e-33 ( Q29375 )

  12. Truncation method for operators with disconnected essential spectrum

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    Indian Acad. Sci. (Math. Sci.) Vol. 112, No. 1, February 2002, pp. 189–193. © Printed in India. Truncation method for operators with disconnected essential spectrum. M N N NAMBOODIRI ... a finite truncation at the nth level of T and hence can be regarded as an n × n complex matrix. It has been proved [2] that lim n→∞.

  13. Yusufoglu et al., Afr J Tradit Complement Altern Med. (2014) 11(3 ...

    African Journals Online (AJOL)

    cadewumi

    29. Lowry, O.H., Rosebrough, N.J., Farr, A.L., and Randall, R.J. (1951). Protein Measurement with the Folin Phenol Reagent. J. Biol. Chem. 193: 265-275. 30. Alqasoumi, S. (2010). Carbon tetrachloride-induced hepatotoxicity: Protective effect of 'Rocket' Eruca sativa L. in rats. Am. J. Chin. Med., 38: 75-88. PMID: 20128046;.

  14. The Effects of Opinion Leaders and Change Messages on Organization Member Change Attitudes: A Field Experiment

    Science.gov (United States)

    2010-03-01

    resistance, organizational commitment and change goal achievement. Journal of Change Management , 4(3): 193-215. Lynch, P., Eisenberger, R. & Armeli...Schraeder, M. (2007). Organizational change content, process and context: A simultaneous analysis of employee reactions. Journal of Change Management , 7

  15. Untitled

    African Journals Online (AJOL)

    Official and Tentative Methods of the American Oil. Chemists' Society, (1979) Vol. 1 AOCS,. Champaign,1L. -. Prasad B.,»Shina, NR (1981); Balance sheet of soil phosphorus and potassium as influenced by intensive cropping and fertilizer use. Soil and. Plants 60: 187 —— 193. Sticker, O. (1970); Thevesidc, a new lridoid.

  16. 78 FR 70231 - National Oil and Hazardous Substances Pollution Contingency Plan; National Priorities List...

    Science.gov (United States)

    2013-11-25

    ..., Chicago, IL 60604, (312) 886-4746, [email protected] . SUPPLEMENTARY INFORMATION: Table of Contents... monitoring of groundwater. During the drafting of the feasibility study (FS), the PRPs requested that the....O. 12580, 52 FR 2923; 3 CFR, 1987 Comp., p. 193. Appendix B-- 0 2. Table 1 of Appendix B to part 300...

  17. Midway Atoll Site P19 12/5/2002 1-2M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Midway Atoll, site P19 (28.193 N, 177.401 W), between 1 and 2 meters along a permanent transect.

  18. A Physicist Who Never Lost Her Humanity

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 22; Issue 3. Lise Meitner (1878–1968): A Physicist Who Never Lost Her Humanity. Vandana Nanal. Article-in-a-Box Volume 22 Issue 3 March 2017 pp 193-197. Fulltext. Click here to view fulltext PDF. Permanent link:

  19. ORIGINAL ARTICLES

    African Journals Online (AJOL)

    ORIGINAL ARTICLES detectable cause of curable 'essential' hypertension. JAMA 1965; 193: 100-106. 7. Hiramatsu K~ Yamada T, Yukimura Y, et al. A screening test to identify aldosterone-producing adenoma by measuring plasma renin activity. Results in hypertensive patients. Arch Intern. Med 1981; 141' 1589-1593. 8.

  20. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 22; Issue 3. Issue front cover thumbnail Issue back cover thumbnail. Volume 22, Issue 3. March 2017, pages 191-333. pp 191-192 Editorial. Editorial · More Details Abstract Fulltext PDF. pp 193-197 Article-in-a-Box. Lise Meitner (1878–1968): A Physicist ...