WorldWideScience

Sample records for astatine 192

  1. Organic chemistry of astatine

    International Nuclear Information System (INIS)

    The paper surveys the investigations on the chemical behaviour of astatine in organic systems and deals with the preparation and identification of its organic compounds. A discussion is given on some of the physico-chemical properties of these compounds determined by extrapolation techniques as well as by direct measurement. The biomedical importance of 211At-labelled compounds is briefly referred to. (authors)

  2. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  3. Astatine-211: production and availability.

    Science.gov (United States)

    Zalutsky, Michael R; Pruszynski, Marek

    2011-07-01

    The 7.2-h half life radiohalogen (211)At offers many potential advantages for targeted α-particle therapy; however, its use for this purpose is constrained by its limited availability. Astatine-211 can be produced in reasonable yield from natural bismuth targets via the (209)Bi(α,2n)(211)At nuclear reaction utilizing straightforward methods. There is some debate as to the best incident α-particle energy for maximizing 211At production while minimizing production of (210)At, which is problematic because of its 138.4-day half life α-particle emitting daughter, (210)Po. The intrinsic cost for producing (211)At is reasonably modest and comparable to that of commercially available (123)I. The major impediment to (211)At availability is attributed to the need for a medium energy α-particle beam for its production. On the other hand, there are about 30 cyclotrons in the world that have the beam characteristics required for (211)At production. PMID:22201707

  4. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211At species, 211At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  5. Dosimetrical considerations in astatine-211 radioimmunotherapy

    International Nuclear Information System (INIS)

    Several dosimetrical quantities have been suggested for use in alpha-particle dosimetry. To evaluate the expected biological effect when using these quantities, a Monte Carlo program was set to register the single-event distribution of both specific energy and alpha-particle track length to a cell nucleus (r=5.6 μm). Distributions were acquired for both 'bound' (simulating the effect of 211At-labelled antibodies bound to antigens on cell surfaces (r=7.0 μm)) as well as 'non-bound' (simulating 211At-labelled antibodies that have not bound to a cell) astatine-211. From these distributions, various theoretical cell survival curves were established for 3 different dosimetrical quantities, i.e. specific energy, number of alpha-particle hits and total track length. The survival curves for all quantities are presented for the corresponding mean absorbed dose in order to facilitate comparisons of the expected effects of using the 3 different quantities for both distributions of 211At decays. The theoretical survival curves presented here could, combined with experiments using 'bound' and 'non-bound' 211At in a single-cell suspension, reveal which dosimetrical quantity is most suitable for 211 At-radioimmunotherapy. (author)

  6. Discovery of the astatine, radon, francium, and radium isotopes

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  7. Extraction of astatine isotopes for development of radiopharmaceuticals using a 211Rn-211At generator

    International Nuclear Information System (INIS)

    In order to utilize a 211At isotope, a promising α-emitter for radionuclide therapy, the chemical properties of astatine isotopes are studied. We have examined wet chemistry methods through the distribution ratios of astatine in liquid-liquid extraction. The astatine isotopes have been found to be well extracted into DIPE and MIBK. We observed that the distribution ratio of astatine isotopes increases with concentrations of HCl greater than 3 M, while it decreases with the HCl concentration less than 2 M. The results will be useful for development of the 211Rn-211At generator. (author)

  8. Astatine-211-Labeled Targeted Radiotherapeutics: An Update

    International Nuclear Information System (INIS)

    The heavy halogen 211At was first proposed for use in α-particle targeted radiotherapy more than 30 years ago and continues to be one of the most promising radionuclides for this purpose. Although its 7.2-h half life is not ideal for intravenously administered whole antibodies, it is compatible with the pharmacokinetics of antibody fragments, peptides, aptamers and organic molecules. Its diverse chemistry allows its incorporation into a wide array of targeting vehicles, relying on its chemical similarity to iodine to provide a useful point of departure. On the other hand, the relatively low carbon-astatine bond strength is challenging. In common with the other α-emitters being discussed at this symposium, lack of reliable availability is one of the biggest hurdles in the use of 211At for targeted radiotherapy. However, in the case of 211At, it is not a question of production cost or availability of target material, because 211At can be produced in reasonable yield from natural bismuth targets. Rather, the difficulty is the lack of cyclotrons equipped with the medium energy α-particle beams required for its production. If the infrastructure for producing 211At is to be improved to the stage where 211At-labeled radiopharmaceuticals can have a meaningful impact, several developments must occur. First, the ability to produce clinically relevant levels of 211At that can be shipped to remote locations in chemically tractable form must be demonstrated. Approaches under consideration include compensating for radiolysis-mediated effects and the consideration of alternative chemistries. Second, strategies for compensating for heterogeneities in dose deposition must be developed, hopefully in a way that is compatible with approval for human use. And third, it is essential that more clinical trials be performed with 211At-labeled therapeutics, particularly in settings of minimum residual disease where the radiobiological advantages of α-particles can be best exploited. Our

  9. Scrutinizing "Invisible" astatine: A challenge for modern density functionals.

    Science.gov (United States)

    Sergentu, Dumitru-Claudiu; David, Grégoire; Montavon, Gilles; Maurice, Rémi; Galland, Nicolas

    2016-06-01

    The main-group 6p elements did not receive much attention in the development of recent density functionals. In many cases it is still difficult to choose among the modern ones a relevant functional for various applications. Here, we illustrate the case of astatine species (At, Z = 85) and we report the first, and quite complete, benchmark study on several properties concerning such species. Insights on geometries, transition energies and thermodynamic properties of a set of 19 astatine species, for which reference experimental or theoretical data has been reported, are obtained with relativistic (two-component) density functional theory calculations. An extensive set of widely used functionals is employed. The hybrid meta-generalized gradient approximation (meta-GGA) PW6B95 functional is overall the best choice. It is worth noting that the range-separated HSE06 functional as well as the old and very popular B3LYP and PBE0 hybrid-GGAs appear to perform quite well too. Moreover, we found that astatine chemistry in solution can accurately be predicted using implicit solvent models, provided that specific parameters are used to build At cavities. © 2016 Wiley Periodicals, Inc. PMID:27059181

  10. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  11. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates.

    Science.gov (United States)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Svedhem, Sofia; Lindegren, Sture

    2016-03-16

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single cancer cells. A promising radioactive nuclide for this type of therapy is astatine-211. Astatine-211 attached to tumor-specific antibodies as carrier molecules is a system currently under investigation for use in targeted alpha therapy. In the common radiolabeling procedure, astatine is coupled to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies. PMID:26791409

  12. Astatine-211: production, injection into monoclonal antibodies radiological effect, possible application to cancer treatment

    International Nuclear Information System (INIS)

    Methods developed in the Laboratory of Nuclear Problems, JINR, for producing astatine-211 and injecting it into monoclonal antibodies are described. The use of its diethylene triamine penta-acetic acid complex is shown to be the most effective method of injecting astatine into a biomolecules. The biological effect of the α-particles emitted from the astatine-211 is investigated using Chinese hamster fibroblasts and Ehrlich carcinoma cells. It is established that the mitotic activity depression, number of degenerating cells, number of cells with chromosome aberrations, and cellular surviving fraction depend on the concentration of the radionuclide in the medium 'in vitro'. The RBE of α-particles in comparison with 60Co γ-rays is 3. Injection of astatine-211 absorbed on tellurium particles into mice with ascitic tumors resulted in prolongation of their life or elimination of the tumors. (author). 39 refs, 7 figs

  13. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    OpenAIRE

    Rothe, S.; A. N. Andreyev; Antalic, S; Borschevsky, A.; Capponi, L.; Cocolios, T.E.; Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the io...

  14. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    Science.gov (United States)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-07-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and physical properties for use in targeted therapies for cancer. Due to the very short range of the emitted α-particles, this therapy is particularly suited to treating occult, disseminated cancers. Astatine is not intrinsically tumour-specific; therefore, it requires an appropriate tumour-specific targeting vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method that combines dry distillation of astatine-211 and a synthesis module for producing radiopharmaceuticals into a process platform. This platform will standardize production of astatinated radiopharmaceuticals, and hence, it will facilitate large clinical studies focused on this promising, but chemically challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies.

  15. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-01-01

    vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method......To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  16. Study of Astatine (III) reactions with O, S and N ligands in solution

    International Nuclear Information System (INIS)

    Full text of publication follows. Astatine (At, Z=85: [Xe]4f145d106s26p5) belongs to the halogen group and is located below iodine in the periodic table. One of its isotopes (211At) appears promising as a therapeutic agent in nuclear medicine (Ref.1) owing to the energy of the alpha particles emitted during the disintegration of its nucleus and its short physical half-life (7.2 h). Since there are no stable isotopes of astatine, the chemistry of this element remains poorly understood. Generally, At is supposed to behave as a halogen (Ref.2) but it has been shown recently in our group that astatine presents a metallic behaviour in aqueous solution: it notably exists as At+ and AtO+ species under the oxidation states +I and +III (Ref.3). At the present time, the number of studies dealing with the complexation properties of the cationic forms of astatine remains limited (Ref.4), owing to its low availability. In this work, we have investigated the reactions of AtO+ species with different hetero-atomic (N, S, O) model ligands. A combined approach based on experimental and theoretical studies has been used (Ref.5). On account of the difficulties of experimental investigations of astatine species, the reactivity of AtO+ was explored using a competition method founded on astatine distributions between two distinct phases. Furthermore, for each AtO+/ ligand complex, the nature of the species formed and the associated thermodynamic constants were determined by computational modeling (DFT calculations). In this framework, an original computational methodology was developed to take into account the specificities of astatine, notably the associated relativistic effects. The computed equilibrium constants have been confronted with the experimental results. This comparison demonstrates an outstanding coherence between experience and theory. Furthermore, the analysis of the results shows a key role of solvent effects on astatine chemistry. Lastly, a specific reactivity for the

  17. Standardization of 192Ir

    International Nuclear Information System (INIS)

    Two 192Ir solutions were standardized by NPL and CBNM within the framework of EUROMET project no. 219. The 4 πβ-γ-coincidence method was used for these measurements, a 4πCsI(Tl) detector for gamma-ray spectrometry, and a NaI(Tl) well counter for 4π-gamma integral counting. The uncertainty of the result was 0.3%, corresponding to one standard deviation. Traceability was established to BIPM for the 192Ir activity measurements. (orig.)

  18. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments (209At, 210At, 211At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  19. Comment: 192 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available Grey heron Ardea cinerea Ardea_cinerea_L.png 192.png Takeru Nakazato (Database Center for Life Science...zato (Database Center for Life Science) nakazato 2009/11/04 17:28:11 2010/01/14 20:04:35 ...

  20. Astatine-211 Pathway from Radiochemistry to Clinical Investigation

    International Nuclear Information System (INIS)

    Particularly in clinical settings where tumour burden is low and cancers are located in close proximity to essential normal tissue structures, α-particle emitting radionuclides can offer significant advantages for targeted radionuclide therapy. One of the first alpha emitters to be evaluated for this purpose is the 7.2-h half-life radiohalogen Astatine-211 (211At). From a commercialization-potential perspective 211At, is less appealing than the longer half-life alpha particle emitters Radium-223, Actinium-225 and Thorium-227, which have become the focus of many laboratories. However, if methods for providing a better supply of 211At could be developed, this alpha emitter would be the radionuclide of choice for many potential therapeutic applications. With regard to the production of 211At, this can be readily be accomplished by bombarding natural bismuth targets with 28−29.5 MeV alpha particles via the 209Bi(α,2n)211At reaction. The goal is to utilize an alpha particle beam energy that provides the required balance for maximizing 211At production while minimizing creation of 210At, which is problematic because of its 138.4-day half life alpha-particle emitting daughter, 210Po. For most intended clinical applications, alpha particle beam energy of about 29 MeV offers the best compromise between maximizing yield and providing 211At with sufficient radionuclidic purity for clinical use. Clinically relevant levels of 211At have been produced at several institutions using both internal and external cyclotron targets

  1. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  2. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  3. Labelling prospects of astatine-211 with immunoglobulins (IgG): some general considerations

    International Nuclear Information System (INIS)

    The tumour therapeutic potential of the short lived alpha emitting radiohalogen 211At has been already been well recognised in the field of radioimmuno therapy. There is no evidence as such to show that astatine itself is a tumour seeking isotope. Therefore it has to be tagged to tumour seeking compound such as a drug or a protein preferably an antibody (IgG). In this communication, the labelling parameters which are required to be investigated for obtaining a stable product which could be useful as radioimmuno therapeutic agent, are described. (author). 6 refs

  4. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron anity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photodetachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral linewidth of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in o-line tests by the clear observation of the photodetachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148 [1].

  5. Extraction of 211At-astatine from hydrochloric acid solutions by means of TOPO, TBP, and triphenylphosphine

    International Nuclear Information System (INIS)

    The extraction behaviour of astatine was studied under defined conditions from hydrochloride acid solutions (cHCl>0.1 M or 1 and 2M). Therefore other effects like adsorption, reduction or hydrolysis can be excluded. The present work describes the extraction with tri- n- octylphosphinoxide (TOPO), tri- n-butylphosphate (TBP) and tri-phenylphosphine in chloroform. (orig.)

  6. No-carrier-added astatination of N-succinimidyl-3-(tri-n-butylstannyl) benzoate (ATE) via electrophilic destannylation

    International Nuclear Information System (INIS)

    The no-carrier-added synthesis of N-succinimidyl 3-[211At]astato-benzoate from N-succinimidyl 3-(tri-n-butylstannyl)benzoate (ATE) is described. The nature of the solvent in which the 211At was isolated from the target was an important factor influencing both the radiochemical yields and the nature of the incorporated astatine activity. (orig.)

  7. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    211At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At- to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At- anions, but first of all because of the kinetic inertness of low spin rhodium(III) d6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh3+. The experiments related to optimization of the reaction conditions were performed with the 131I, basing on a chemical similarity of I- to At-. The experiments with 211At were then carried out under the conditions found optimal for I-. The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211At-Rh(16-S4-diol) complex

  8. Standardization of sup 192 Ir

    Energy Technology Data Exchange (ETDEWEB)

    Reher, D.F.G.; Roost, E. de; Sibbens, G.; Denecke, B.; Altzitzoglou, T.; Ballaux, C. (CEC-JRC Central Bureau for Nuclear Measurements, Geel (Belgium)); Woods, M.J. (National Physical Lab., Teddington (United Kingdom)); Funck, E. (Physikalisch-Technische Bundesanstalt, Braunschweig (Germany))

    1992-02-01

    Two {sup 192}Ir solutions were standardized by NPL and CBNM within the framework of EUROMET project no. 219. The 4 {pi}{beta}-{gamma}-coincidence method was used for these measurements, a 4{pi}CsI(Tl) detector for gamma-ray spectrometry, and a NaI(Tl) well counter for 4{pi}-gamma integral counting. The uncertainty of the result was 0.3%, corresponding to one standard deviation. Traceability was established to BIPM for the {sup 192}Ir activity measurements. (orig.).

  9. 49 CFR 192.225 - Welding procedures.

    Science.gov (United States)

    2010-10-01

    ... qualified under section 5 of API 1104 (incorporated by reference, see § 192.7) or section IX of the ASME... § 192.7) to produce welds meeting the requirements of this subpart. The quality of the test welds...

  10. 49 CFR 192.325 - Underground clearance.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Underground clearance. 192.325 Section 192.325... Lines and Mains § 192.325 Underground clearance. (a) Each transmission line must be installed with at least 12 inches (305 millimeters) of clearance from any other underground structure not associated...

  11. 49 CFR 192.55 - Steel pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Steel pipe. 192.55 Section 192.55 Transportation... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Materials § 192.55 Steel pipe. (a) New steel pipe is... in accordance with paragraph (c) or (d) of this section. (b) Used steel pipe is qualified for...

  12. 49 CFR 192.59 - Plastic pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Plastic pipe. 192.59 Section 192.59 Transportation... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Materials § 192.59 Plastic pipe. (a) New plastic pipe... specification; and (2) It is resistant to chemicals with which contact may be anticipated. (b) Used plastic...

  13. 32 CFR 192.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Policy. 192.4 Section 192.4 National Defense... OPPORTUNITY IN OFF-BASE HOUSING § 192.4 Policy. It is DoD policy that under DoD Directive 1350.2 1 the..., 5285 Port Royal Road, Springfield, VA 22161. (a) National Housing Policy. Federal law...

  14. 49 CFR 192.749 - Vault maintenance.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Vault maintenance. 192.749 Section 192.749 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Maintenance § 192.749 Vault maintenance. (a) Each...

  15. 49 CFR 192.16 - Customer notification.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Customer notification. 192.16 Section 192.16... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS General § 192.16 Customer notification. (a) This section applies to each operator of a service line who does not maintain the customer's buried piping...

  16. 40 CFR 61.192 - Standard.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Standard. 61.192 Section 61.192... EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS National Emission Standards for Radon Emissions From Department of Energy Facilities § 61.192 Standard. No source at a Department of Energy facility shall...

  17. 40 CFR 192.12 - Standards.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Standards. 192.12 Section 192.12... AND ENVIRONMENTAL PROTECTION STANDARDS FOR URANIUM AND THORIUM MILL TAILINGS Standards for Cleanup of... Sites § 192.12 Standards. Remedial actions shall be conducted so as to provide reasonable assurance...

  18. 40 CFR 192.02 - Standards.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Standards. 192.02 Section 192.02... AND ENVIRONMENTAL PROTECTION STANDARDS FOR URANIUM AND THORIUM MILL TAILINGS Standards for the Control of Residual Radioactive Materials from Inactive Uranium Processing Sites § 192.02 Standards....

  19. 32 CFR 192.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 192.5 Section 192.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS EQUAL OPPORTUNITY IN OFF-BASE HOUSING § 192.5 Responsibilities. The Secretaries of the...

  20. 22 CFR 192.21 - Applicable benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Applicable benefits. 192.21 Section 192.21... Soldiers' and Sailors' Civil Relief Act to Captive Situations § 192.21 Applicable benefits. (a) Eligible persons are entitled to the benefits provided by the Soldiers' and Sailors' Civil Relief Act of 1940 (50...

  1. 22 CFR 192.11 - Applicable benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Applicable benefits. 192.11 Section 192.11 Foreign Relations DEPARTMENT OF STATE HOSTAGE RELIEF VICTIMS OF TERRORISM COMPENSATION Payment of Salary and Other Benefits for Captive Situations § 192.11 Applicable benefits. (a) Captives are entitled...

  2. 22 CFR 192.31 - Applicable benefits.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Applicable benefits. 192.31 Section 192.31 Foreign Relations DEPARTMENT OF STATE HOSTAGE RELIEF VICTIMS OF TERRORISM COMPENSATION Medical Benefits for Captive Situations § 192.31 Applicable benefits. A person eligible for benefits under this...

  3. 49 CFR 192.616 - Public awareness.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Public awareness. 192.616 Section 192.616... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Operations § 192.616 Public awareness. (a) Except for... meter or petroleum gas system is not required to develop a public awareness program as prescribed...

  4. 40 CFR 192.04 - Corrective action.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Corrective action. 192.04 Section 192... Corrective action. If the groundwater concentration limits established for disposal sites under provisions of § 192.02(c) are found or projected to be exceeded, a corrective action program shall be placed...

  5. 22 CFR 192.51 - Death benefit.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Death benefit. 192.51 Section 192.51 Foreign... or Death § 192.51 Death benefit. (a) The Secretary of State or Agency Head may provide for payment, by the employing agency, of a death benefit to the surviving dependents of any eligible...

  6. Unexpected Behavior of the Heaviest Halogen Astatine in the Nucleophilic Substitution of Aryliodonium Salts.

    Science.gov (United States)

    Guérard, François; Lee, Yong-Sok; Baidoo, Kwamena; Gestin, Jean-François; Brechbiel, Martin W

    2016-08-22

    Aryliodonium salts have become precursors of choice for the synthesis of (18) F-labeled tracers for nuclear imaging. However, little is known on the reactivity of these compounds with heavy halides, that is, radioiodide and astatide, at the radiotracer scale. In the first comparative study of radiohalogenation of aryliodonium salts with (125) I(-) and (211) At(-) , initial experiments on a model compound highlight the higher reactivity of astatide compared to iodide, which could not be anticipated from the trends previously observed within the halogen series. Kinetic studies indicate a significant difference in activation energy (Ea =23.5 and 17.1 kcal mol(-1) with (125) I(-) and (211) At(-) , respectively). Quantum chemical calculations suggest that astatination occurs via the monomeric form of an iodonium complex whereas iodination occurs via a heterodimeric iodonium intermediate. The good to excellent regioselectivity of halogenation and high yields achieved with diversely substituted aryliodonium salts indicate that this class of compounds is a promising alternative to the stannane chemistry currently used for heavy radiohalogen labeling of tracers in nuclear medicine. PMID:27305065

  7. 49 CFR 192.281 - Plastic pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Plastic pipe. 192.281 Section 192.281... Plastic pipe. (a) General. A plastic pipe joint that is joined by solvent cement, adhesive, or heat fusion may not be disturbed until it has properly set. Plastic pipe may not be joined by a threaded joint...

  8. 49 CFR 192.279 - Copper pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Copper pipe. 192.279 Section 192.279... Copper pipe. Copper pipe may not be threaded except that copper pipe used for joining screw fittings or... heavier wall pipe listed in Table C1 of ASME/ANSI B16.5....

  9. 10 CFR 431.192 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... that— (1) Has an input voltage of 600 volts or less; (2) Is air-cooled; and (3) Does not use oil as a... 10 Energy 3 2010-01-01 2010-01-01 false Definitions. 431.192 Section 431.192 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION ENERGY EFFICIENCY PROGRAM FOR CERTAIN COMMERCIAL AND INDUSTRIAL...

  10. 49 CFR 192.185 - Vaults: Accessibility.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Vaults: Accessibility. 192.185 Section 192.185 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY...: Accessibility. Each vault must be located in an accessible location and, so far as practical, away from:...

  11. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  12. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  13. 40 CFR 192.32 - Standards.

    Science.gov (United States)

    2010-07-01

    ... pursuant to 40 CFR 192.32(a)(3), the licensee shall conduct appropriate monitoring and analysis of the... limiting releases of radon-222 to a level not exceeding 20 pCi/m2−s as required by 40 CFR 192.32(b)(1)(ii). This monitoring shall be conducted using the procedures described in 40 CFR part 61, Appendix B,...

  14. 49 CFR 192.287 - Plastic pipe: Inspection of joints.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Plastic pipe: Inspection of joints. 192.287... Than by Welding § 192.287 Plastic pipe: Inspection of joints. No person may carry out the inspection of joints in plastic pipes required by §§ 192.273(c) and 192.285(b) unless that person has been qualified...

  15. 49 CFR 192.121 - Design of plastic pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Design of plastic pipe. 192.121 Section 192.121... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Pipe Design § 192.121 Design of plastic pipe. Subject to the limitations of § 192.123, the design pressure for plastic pipe is determined by either of...

  16. Dicty_cDB: SSI192 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI192 (Link to dictyBase) - - - Contig-U16397-1 SSI192Z (Link... to Original site) - - SSI192Z 616 - - - - Show SSI192 Library SS (Link to library) Clone ID SSI192 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSI1-D/SSI192Q.Seq.d/ Representative seq. ID SSI19...2Z (Link to Original site) Representative DNA sequence >SSI192 (SSI192Q) /CSM/SS/SSI1-D/SSI192Q.Seq.d/ XXXXX...kkkkkkkkk Translated Amino Acid sequence (All Frames) Frame A: ---iq*i*ywcnh*rlc*hycrfrdfirewcstwssiccn*cfp*

  17. Sealed 192 Ir sources for industrial radiography

    International Nuclear Information System (INIS)

    This work presents the results obtained by the Post-Irradiation Examination Laboratory (LEPI) of INR Pitesti in production and selling of sealed 192 Ir sources for industrial radiography. The sealed 192 Ir sources are obtained by encapsulating iridium disks in stainless steel capsules by TIG welding. The iridium disks have the characteristics: - radionuclidic purity, at least 95% Ir; - density, at least 12 g/cm3; - height, 0.5 mm; - diameter, 3 mm. Tests for radioactive tightness of the capsules containing the 192 Ir sources are done by immersing the sealed source in water at 323 K temperature for 4 h and measuring the radioactivity of immersion water samples. The source is accepted as tightly enclosed if the water activity is less than 0.2 kBq (5 nCi). Six types of sealed 192 Ir sources are produced with maximum activity 4.4 TBq (120 Ci); 2.310 TBq (70 Ci); 1.155 TBq (35 Ci); 0.555 TBq (15 Ci); 0.185 TBq (5 Ci) and 0.037 TBq (1 Ci), with focal spots varying between 3 x 3 mm and 0.5 x 0.5 mm. The technological flux is described. In the period 1993-2000 LEPI has produced 350 sealed 192 Ir sources for industrial radiography with a total activity of 518 TBq (14,000 Ci) which were delivered to about 100 users of national industry

  18. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  19. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  20. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  1. Quasiparticle excitations in superdeformed {sup 192}Hg

    Energy Technology Data Exchange (ETDEWEB)

    Lauritsen, T.; Carpenter, M.P.; Janssens, R.V.F. [and others

    1995-08-01

    The nucleus {sup 192}Hg plays a pivotal role for superdeformation in the mass 190 region, since calculations of single-particle levels show large shell-gaps for the superdeformed (SD) shape at N = 112 and Z = 80. As a result, {sup 192}Hg is referred to as the doubly magic SD nucleus for the A = 190 region. In previous studies, only one superdeformed band was observed in this nucleus, and this fact was cited as indirect evidence that large shell gaps do indeed exist at the proposed particle numbers.

  2. 49 CFR 572.192 - Head assembly.

    Science.gov (United States)

    2010-10-01

    ... CFR 572.112(a). (c) Performance criteria. (1) When the head assembly is dropped from either the right...) and a set of three (3) accelerometers in conformance with specifications in 49 CFR 572.200(d) and... 49 Transportation 7 2010-10-01 2010-10-01 false Head assembly. 572.192 Section...

  3. 27 CFR 20.192 - Manufacturing record.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Manufacturing record. 20... and Users of Specially Denatured Spirits Operations by Users § 20.192 Manufacturing record. For each manufacturing process in which specially denatured spirits are used, the user shall record: (a) Quantity...

  4. 49 CFR 192.191 - Design pressure of plastic fittings.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Design pressure of plastic fittings. 192.191... Components § 192.191 Design pressure of plastic fittings. (a) Thermosetting fittings for plastic pipe must conform to ASTM D 2517, (incorporated by reference, see § 192.7). (b) Thermoplastic fittings for...

  5. 49 CFR 192.375 - Service lines: Plastic.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Service lines: Plastic. 192.375 Section 192.375... § 192.375 Service lines: Plastic. (a) Each plastic service line outside a building must be installed... terminate above ground level and outside the building, if— (i) The above ground level part of the...

  6. 49 CFR 192.193 - Valve installation in plastic pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Valve installation in plastic pipe. 192.193 Section 192.193 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND... Components § 192.193 Valve installation in plastic pipe. Each valve installed in plastic pipe must...

  7. 49 CFR 192.311 - Repair of plastic pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Repair of plastic pipe. 192.311 Section 192.311... Lines and Mains § 192.311 Repair of plastic pipe. Each imperfection or damage that would impair the serviceability of plastic pipe must be repaired or removed....

  8. 49 CFR 192.105 - Design formula for steel pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Design formula for steel pipe. 192.105 Section 192... NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Pipe Design § 192.105 Design formula for steel pipe. (a) The design pressure for steel pipe is determined in accordance with the...

  9. 49 CFR 192.321 - Installation of plastic pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Installation of plastic pipe. 192.321 Section 192... Transmission Lines and Mains § 192.321 Installation of plastic pipe. (a) Plastic pipe must be installed below ground level except as provided by paragraphs (g) and (h) of this section. (b) Plastic pipe that...

  10. 49 CFR 192.309 - Repair of steel pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Repair of steel pipe. 192.309 Section 192.309... Lines and Mains § 192.309 Repair of steel pipe. (a) Each imperfection or damage that impairs the serviceability of a length of steel pipe must be repaired or removed. If a repair is made by grinding,...

  11. 49 CFR 192.125 - Design of copper pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Design of copper pipe. 192.125 Section 192.125... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Pipe Design § 192.125 Design of copper pipe. (a) Copper pipe used in mains must have a minimum wall thickness of 0.065 inches (1.65 millimeters) and must...

  12. 49 CFR 192.371 - Service lines: Steel.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Service lines: Steel. 192.371 Section 192.371 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... § 192.371 Service lines: Steel. Each steel service line to be operated at less than 100 p.s.i. (689...

  13. 49 CFR 192.313 - Bends and elbows.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Bends and elbows. 192.313 Section 192.313... Lines and Mains § 192.313 Bends and elbows. (a) Each field bend in steel pipe, other than a wrinkle bend... tested either before or after the bending process. (c) Wrought-steel welding elbows and...

  14. 49 CFR 192.11 - Petroleum gas systems.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Petroleum gas systems. 192.11 Section 192.11... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS General § 192.11 Petroleum gas systems. (a) Each plant that supplies petroleum gas by pipeline to a natural gas distribution system must meet the...

  15. 49 CFR 192.377 - Service lines: Copper.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Service lines: Copper. 192.377 Section 192.377 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... § 192.377 Service lines: Copper. Each copper service line installed within a building must be...

  16. 49 CFR 192.751 - Prevention of accidental ignition.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Prevention of accidental ignition. 192.751 Section 192.751 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS... NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Maintenance § 192.751 Prevention...

  17. 49 CFR 192.235 - Preparation for welding.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Preparation for welding. 192.235 Section 192.235... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Welding of Steel in Pipelines § 192.235 Preparation for welding. Before beginning any welding, the welding surfaces must be clean and free of any material...

  18. 49 CFR 192.629 - Purging of pipelines.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Purging of pipelines. 192.629 Section 192.629... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Operations § 192.629 Purging of pipelines. (a) When a pipeline is being purged of air by use of gas, the gas must be released into one end of the line in...

  19. Study of transition probabilities in 192Pt

    International Nuclear Information System (INIS)

    The nucleus 192Pt is Coulomb excited with 370 MeV 84Kr projectiles. Levels up to spin 8+ (10+) in the ground band and up to 6+ in the γ-band are observed. The B(E2) values implied by the observed yields are compared with predictions of different nuclear models. Particular attention is paid to the ground band transition rates and the rotation-alignment model

  20. 22 CFR 192.52 - Disability benefits.

    Science.gov (United States)

    2010-04-01

    .... 8107 and 20 CFR 10.304. The Director General of the Foreign Service of State or the Agency Head, may at... members of the body specified in 5 U.S.C. 8107 and in 20 CFR 10.304. The provisions of 20 CFR part 10... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Disability benefits. 192.52 Section...

  1. Stability and in vivo behavior of Rh[16aneS4-diol]211At complex: A potential precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Introduction: The heavy halogen 211At is of great interest for targeted radiotherapy because it decays by the emission of short-range, high-energy α-particles. However, many astatine compounds that have been synthesized are unstable in vivo, providing motivation for seeking other 211At labeling strategies. One relatively unexplored approach is to utilize prosthetic groups based on astatinated rhodium (III) complex stabilized with a tetrathioether macrocyclic ligand – Rh[16aneS4-diol]211At. The purpose of the current study was to evaluate the in vitro and in vivo stability of this complex in comparison to its iodine analog – Rh[16aneS4-diol]131I. Methods: Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I complexes were synthesized and purified by HPLC. The stability of both complexes was evaluated in vitro by incubation in phosphate-buffered saline (PBS) and human serum at different temperatures. The in vivo behavior of the two radiohalogenated complexes was assessed by a paired-label biodistribution study in normal Balb/c mice. Results: Both complexes were synthesized in high yield and purity. Almost no degradation was observed for Rh[16aneS4-diol]131I in PBS over a 72 h incubation. The astatinated analog exhibited good stability in PBS over 14 h. A slow decline in the percentage of intact complex was observed for both tracers in human serum. In the biodistribution study, retention of 211At in most tissues was higher than that of 131I at all time points, especially in spleen and lungs. Renal clearance of Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I predominated, with 84.1 ± 2.3% and 94.6 ± 0.9% of injected dose excreted via the urine at 4 h. Conclusions: The Rh[16aneS4-diol]211At complex might be useful for constructing prosthetic groups for the astatination of biomolecules and further studies are planned to evaluate this possibility

  2. Quasiparticle excitations in superdeformed 192Hg

    International Nuclear Information System (INIS)

    For the first time, two excited superdeformed (SD) bands have been observed in the double closed shell superdeformed nucleus 192Hg. One of the SD bands exhibits a pronounced peak in the dynamic moment of inertia which is interpreted as a crossing between two excited SD configurations involving the N=7 intruder and the [512]5/2 orbitals. This is only the second occurrence of such a crossing in a SD nucleus around A=190. The second excited SD band has near identical transition energies to an excited SD band in 191Hg

  3. 49 CFR 192.315 - Wrinkle bends in steel pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Wrinkle bends in steel pipe. 192.315 Section 192... Transmission Lines and Mains § 192.315 Wrinkle bends in steel pipe. (a) A wrinkle bend may not be made on steel pipe to be operated at a pressure that produces a hoop stress of 30 percent, or more, of SMYS. (b)...

  4. Dicty_cDB: VHK192 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available yldektkiskisrgaiagivvgcvvavsligsiafyyhhknkkvnlff*klk*nl tirffit Frame B: kfqfkknkgkntpklnk*e*k*niy*yiytyyyfvy*rsiaksialivvle...ces producing significant alignments: (bits) Value AC117075_64( AC117075 |pid:none) Dictyostelium di...ive seq. ID VHK192P (Link to Original site) Representative DNA sequence >VHK192 (VHK192Q) /CSM/VH/VHK1-D/VHK...tkhgicdndsgnckcdtqtkgltceesrlliesldsinskg gtiniigyfgnttslltikigesqcknikvfnettlkcdigegkgihnitiidddlsfta inkfq...wfycfllssqk*kg*sfllktkikfn h*vfyy Homology vs CSM-cDNA Score E Sequences producing significant alignment

  5. Qualification tests for 192Ir sealed sources

    International Nuclear Information System (INIS)

    This paper describes the results of qualification tests for 192Ir sealed sources, available in Testing and Nuclear Expertise Laboratory of National Institute for Physics and Nuclear Engineering 'Horia Hulubei' (I.F.I.N.-HH), Romania. These sources had to be produced in I.F.I.N.-HH and were tested in order to obtain the authorization from The National Commission for Nuclear Activities Control (CNCAN). The sources are used for gammagraphy procedures or in gammadefectoscopy equipments. Tests, measurement methods and equipments used, comply with CNCAN, AIEA and International Quality Standards and regulations. The qualification tests are: 1. Radiological tests and measurements: dose equivalent rate at 1 m; tightness; dose equivalent rate at the surface of the transport and storage container; external unfixed contamination of the container surface. 2. Mechanical and climatic tests: thermal shock; external pressure; mechanic shock; vibrations; boring; thermal conditions for storage and transportation. Passing all tests, it was obtained the Radiological Security Authorization for producing the 192Ir sealed sources. Now IFIN-HH can meet many demands for this sealed sources, as the only manufacturer in Romania

  6. 49 CFR 192.921 - How is the baseline assessment to be conducted?

    Science.gov (United States)

    2010-10-01

    ..., the requirements specified in §§ 192.925, 192.927 or 192.929; (4) Other technology that an operator... § 192.937 and § 192.939. (f) Newly identified areas. When an operator identifies a new high consequence... identified high consequence area within ten (10) years from the date the area is identified. (g)...

  7. 49 CFR 192.477 - Internal corrosion control: Monitoring.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Internal corrosion control: Monitoring. 192.477... Control § 192.477 Internal corrosion control: Monitoring. If corrosive gas is being transported, coupons... internal corrosion. Each coupon or other means of monitoring internal corrosion must be checked two...

  8. 49 CFR 192.475 - Internal corrosion control: General.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Internal corrosion control: General. 192.475... Control § 192.475 Internal corrosion control: General. (a) Corrosive gas may not be transported by... taken to minimize internal corrosion. (b) Whenever any pipe is removed from a pipeline for any...

  9. 49 CFR 192.163 - Compressor stations: Design and construction.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Compressor stations: Design and construction. 192... Pipeline Components § 192.163 Compressor stations: Design and construction. (a) Location of compressor building. Except for a compressor building on a platform located offshore or in inland navigable...

  10. 49 CFR 192.173 - Compressor stations: Ventilation.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Compressor stations: Ventilation. 192.173 Section 192.173 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS....173 Compressor stations: Ventilation. Each compressor station building must be ventilated to...

  11. 49 CFR 192.167 - Compressor stations: Emergency shutdown.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Compressor stations: Emergency shutdown. 192.167... Components § 192.167 Compressor stations: Emergency shutdown. (a) Except for unattended field compressor stations of 1,000 horsepower (746 kilowatts) or less, each compressor station must have an...

  12. 49 CFR 192.165 - Compressor stations: Liquid removal.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Compressor stations: Liquid removal. 192.165... Components § 192.165 Compressor stations: Liquid removal. (a) Where entrained vapors in gas may liquefy under the anticipated pressure and temperature conditions, the compressor must be protected against...

  13. 49 CFR 192.283 - Plastic pipe: Qualifying joining procedures.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Plastic pipe: Qualifying joining procedures. 192... Materials Other Than by Welding § 192.283 Plastic pipe: Qualifying joining procedures. (a) Heat fusion... for making plastic pipe joints by a heat fusion, solvent cement, or adhesive method, the...

  14. 49 CFR 192.513 - Test requirements for plastic pipelines.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Test requirements for plastic pipelines. 192.513 Section 192.513 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND... Test requirements for plastic pipelines. (a) Each segment of a plastic pipeline must be tested...

  15. 49 CFR 192.123 - Design limitations for plastic pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Design limitations for plastic pipe. 192.123... TRANSPORTATION OF NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Pipe Design § 192.123 Design limitations for plastic pipe. (a) Except as provided in paragraph (e) and paragraph (f) of...

  16. 49 CFR 192.277 - Ductile iron pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Ductile iron pipe. 192.277 Section 192.277 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... Ductile iron pipe. (a) Ductile iron pipe may not be joined by threaded joints. (b) Ductile iron pipe...

  17. 49 CFR 192.275 - Cast iron pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Cast iron pipe. 192.275 Section 192.275... Cast iron pipe. (a) Each caulked bell and spigot joint in cast iron pipe must be sealed with mechanical leak clamps. (b) Each mechanical joint in cast iron pipe must have a gasket made of a...

  18. 49 CFR 192.241 - Inspection and test of welds.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Inspection and test of welds. 192.241 Section 192....241 Inspection and test of welds. (a) Visual inspection of welding must be conducted by an individual... nondestructively tested or visually inspected is determined according to the standards in Section 9 of API...

  19. 49 CFR 192.479 - Atmospheric corrosion control: General.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Atmospheric corrosion control: General. 192.479 Section 192.479 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY TRANSPORTATION OF NATURAL AND OTHER GAS BY...

  20. 49 CFR 192.481 - Atmospheric corrosion control: Monitoring.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Atmospheric corrosion control: Monitoring. 192.481 Section 192.481 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY TRANSPORTATION OF NATURAL AND OTHER GAS...

  1. 21 CFR 211.192 - Production record review.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Production record review. 211.192 Section 211.192... Production record review. All drug product production and control records, including those for packaging and... established, approved written procedures before a batch is released or distributed. Any...

  2. 49 CFR 192.353 - Customer meters and regulators: Location.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Customer meters and regulators: Location. 192.353... TRANSPORTATION OF NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Customer Meters, Service Regulators, and Service Lines § 192.353 Customer meters and regulators: Location. (a) Each meter and...

  3. 49 CFR 192.357 - Customer meters and regulators: Installation.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Customer meters and regulators: Installation. 192... SAFETY TRANSPORTATION OF NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Customer Meters, Service Regulators, and Service Lines § 192.357 Customer meters and regulators: Installation....

  4. 7 CFR 3015.192 - Institutions of higher education.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Institutions of higher education. 3015.192 Section....192 Institutions of higher education. (a) OMB Circular No. A-21, including any amendments to the... activities conducted by institutions of higher education (other than for-profit institutions). (b)...

  5. g bosons and the third 4+ state in 192Os

    International Nuclear Information System (INIS)

    Reduced matrix elements for excitation of the first three 4+ states in 192Os have been measured using inelastic scattering of 135 MeV polarized protons. These data, as well as the known quadrupole properties of 192Os, are best described if the third 4+ state is interpreted as a g-boson intruder state

  6. 49 CFR 192.747 - Valve maintenance: Distribution systems.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Valve maintenance: Distribution systems. 192.747... TRANSPORTATION OF NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Maintenance § 192.747 Valve maintenance: Distribution systems. (a) Each valve, the use of which may be necessary for the safe operation...

  7. 49 CFR 192.231 - Protection from weather.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Protection from weather. 192.231 Section 192.231 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... weather. The welding operation must be protected from weather conditions that would impair the quality...

  8. Dicty_cDB: SFL192 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFL192 (Link to dictyBase) - - - Contig-U16243-1 SFL192P (Link to Original ... .. 253 6e-72 X75329_1( X75329 |pid:none) M.indica (Manila ) THMF5 mRNA for 3-ket... 251 2e-71 S57792( S57792 ...

  9. Iridium-192 sources production for brachytherapy use

    International Nuclear Information System (INIS)

    The incidence of cancer increases every year in Brazil and turns out to be one of the most important causes of mortality. Some of the patients are treated with brachytherapy, a form of lesion treatment which is based on the insertion of sources into tumors, in this particular case, activated iridium wires. During this process, the ionizing radiation efficiently destroys the malignant cells. These iridium wires have a nucleus made out of an iridium-platinum alloy 20-30/70-80 of 0,1 mm in diameter either coated by platinum or encased in a platinum tube. The technique consists in irradiating the wire in the reactor neutron flux in order to produce iridium-192. The linear activity goes from 1 mCi/cm to 4 mCi/cm and the basic characteristic, which is required, is the homogeneity of the activation along the wire. It should not present a dispersion exceeding 5% on a wire measuring 50 cm in length, 0.5 mm or 0.3 mm in diameter. Several experiments were carried out in order to define the activation parameters. Wires from different origins were analyzed. It was concluded that United States of America and France wires were found to be perfectly adequate for brachytherapy purposes and have therefore been sent to specialized hospitals and successfully applied to cancer patients. Considering that the major purpose of this work is to make this product more accessible in Brazil, at a cost reflecting the Brazilian reality, the IPEN is promoting the preparation of iridium-192 sources to be used in brachytherapy, on a national level. (author)

  10. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D., Scott

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  11. Dicty_cDB: VHE192 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TTATGTCAATTT TCAATGCTAAAATT Length of 3' end seq. 734 Connected seq. ID VHE192P Connected seq. >VHE192P.Seq ...GAAGTTTATGCTCATTCAAATGCTGCTAAAAATTTATTATGTCAA TTTTCAATGCTAAAATT Length of connected seq. 1327 Full length Seq ID - Full length Seq. - Length of full length seq. - ... ...lqcllvkfmliqmllkiyyvnf qc*n Frame B: tkriny*snftisskrsf*nk*f*ismftfnnnlihwfkcnihyshaillnpnwldvngc lsywfngnw**lys*nffkesis*fnywnn... for stear... 303 9e-81 AY576801_1( AY576801 |pid:none) Hortaea werneckii putative delta-9.....VH (Link to library) VHE192 (Link to dictyBase) - - - Contig-U15470-1 | Contig-U159

  12. Preclinical Study for Application of Fabricated High Activity Ir-192

    International Nuclear Information System (INIS)

    This study was performed to evaluate the feasibility and safety of high activity Ir-192 sources manufactured by KAERI(Korea Atomic Energy Research Institute) for application to present equipment such as various applicators inserted to patients and PLATO(Nucletron, Netherland) of treatment planning system and to evaluate safety and accuracy of Ir-192 as practical clinic use through in vitro dosimetry of Ir-192. We confirmed the physical and radiobiological safety of KAERI sources to use practical. KAERI sources are applicable to commercial high dose rate brachytherapy machine safely. Then those can be substituted for the imported sources such as sources made by Nucletron, Gammamed and exported to the foreign country

  13. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    International Nuclear Information System (INIS)

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET α-emitter astatine-211 (211At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 (123I), 340-fold for technetium-99m pertechnetate (99mTcO4-) and 60-fold for 211At. Cellular 211At accumulation was found to be dependent on extracellular Na+ ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and 99mTcO4- uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated 211At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and 211At were rapidly (apparent t1/2 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times (123I), 25 times (99mTcO4-) and 10 times (211At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of 123I and 211At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for 123I, 5.2 h for 211At) and preliminary dosimetric calculations indicate high tumour absorbed doses (3.5 Gy/MBqtumour for 131I and 50.3 Gy/MBqtumour for 211At). In

  14. 40 CFR Appendix I to Part 192 - Listed Constituents

    Science.gov (United States)

    2010-07-01

    ... PROGRAMS HEALTH AND ENVIRONMENTAL PROTECTION STANDARDS FOR URANIUM AND THORIUM MILL TAILINGS Pt. 192, App...-chloro-) Chromium and compounds, N.O.S. Chrysene Citrus red No. 2 (2-Naphthalenol, 1- -) Coal...

  15. Low dose rate Ir-192 interstitial brachytherapy for prostate cancer

    Energy Technology Data Exchange (ETDEWEB)

    Oki, Yosuke; Dokiya, Takushi; Yorozu, Atsunori; Suzuki, Takayuki; Saito, Shiro; Monma, Tetsuo; Ohki, Takahiro [National Tokyo Medical Center (Japan); Murai, Masaru; Kubo, Atsushi

    2000-04-01

    From December 1997 through January 1999, fifteen prostatic cancer patients were treated with low dose rate Ir-192 interstitial brachytherapy using TRUS and perineal template guidance without external radiotherapy. Up to now, as no apparent side effects were found, the safety of this treatment is suggested. In the future, in order to treat prostatic cancer patients with interstitial brachytherapy using I-125 or Pd-103, more investigation for this low dose rate Ir-192 interstitial brachytherapy is needed. (author)

  16. Calibration of 192Ir high-dose-rate afterloading systems

    International Nuclear Information System (INIS)

    A method is described for calibration of 192Ir high-dose-rate (HDR) brachytherapy afterloading systems. Since NIST does not offer calibration of ionization chambers with the gamma-ray spectrum of iridium-192, an interpolation procedure is employed, using calibrations above (137Cs, 662 keV) and below (250 kVcp, 146-keV x rays) the exposure-weighted average 192Ir energy of 397 keV. The same total wall + cap thickness must be used for both calibrations, and for the 192Ir measurements. A wall + cap thickness of 0.3 g/cm2 is recommended to assure charged particle equilibrium and to exclude secondary electrons emitted from the source encapsulation. Procedures are described for determining the corrections for source-chamber distance and room scatter during the source calibration in inverse-square-law geometry. A new well-type ionization chamber has been designed specifically for convenient routine use with the HDR afterloading system. It can be calibrated by means of a previously calibrated 192Ir source, and offers a simple means for verifying the decay rate and for calibrating 192Ir replacement sources

  17. 49 CFR 192.619 - Maximum allowable operating pressure: Steel or plastic pipelines.

    Science.gov (United States)

    2010-10-01

    ...: For Federal Register citations affecting § 192.619, see the List of CFR Sections Affected, which... plastic pipelines. 192.619 Section 192.619 Transportation Other Regulations Relating to Transportation... Operations § 192.619 Maximum allowable operating pressure: Steel or plastic pipelines. (a) No person...

  18. 41 CFR 102-192.130 - What are your general responsibilities as an agency mail manager?

    Science.gov (United States)

    2010-07-01

    ... responsibilities as an agency mail manager? 102-192.130 Section 102-192.130 Public Contracts and Property... ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT Agency Mail Manager Requirements § 102-192.130 What are your general responsibilities as an agency mail manager? In addition to carrying out the responsibilities in Subparts B, C,...

  19. 41 CFR 102-192.135 - Must we have a mail center manager at our facility?

    Science.gov (United States)

    2010-07-01

    ... center manager at our facility? 102-192.135 Section 102-192.135 Public Contracts and Property Management... PROGRAMS 192-MAIL MANAGEMENT Mail Center Manager Requirements § 102-192.135 Must we have a mail center manager at our facility? Yes, every facility that has more than two full time people dedicated...

  20. 41 CFR 102-192.120 - Must we have an agency mail manager?

    Science.gov (United States)

    2010-07-01

    ... mail manager? 102-192.120 Section 102-192.120 Public Contracts and Property Management Federal Property... MANAGEMENT Agency Mail Manager Requirements § 102-192.120 Must we have an agency mail manager? Yes, every Federal agency as defined in § 102-192.35 must have an agency mail manager. Agencies that are not...

  1. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    Energy Technology Data Exchange (ETDEWEB)

    Petrich, T.; Helmeke, H.-J.; Meyer, G.J.; Knapp, W.H.; Poetter, E. [Department of Nuclear Medicine, Medizinische Hochschule Hannover (Germany)

    2002-07-01

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET {alpha}-emitter astatine-211 ({sup 211}At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 ({sup 123}I), 340-fold for technetium-99m pertechnetate ({sup 99m}TcO{sub 4}{sup -}) and 60-fold for {sup 211}At. Cellular {sup 211}At accumulation was found to be dependent on extracellular Na{sup +} ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and {sup 99m}TcO{sub 4}{sup -} uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated {sup 211}At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and {sup 211}At were rapidly (apparent t{sub 1/2} 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times ({sup 123}I), 25 times ({sup 99m}TcO{sub 4}{sup -}) and 10 times ({sup 211}At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of {sup 123}I and {sup 211}At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for {sup 123}I, 5.2 h for {sup 211}At) and

  2. Dicty_cDB: VFN192 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ficant alignments: (bits) Value N ( L16578 ) Dictyostelium discoideum HIV1 TAT-binding protein...ce GIFLIFNFFIYIHKYLFLFLFFL*fsnitisnynlvliv*ylffffxk--- Translated Amino Acid sequence (All Frames) ...VF (Link to library) VFN192 (Link to dictyBase) - - - Contig-U15589-1 - (Link to Original site...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15589-1 Original site URL http://dictycdb.b...iol.tsukuba.ac.jp/CSM/VF/VFN1-D/VFN192Q.Seq.d/ Representative seq. ID - (Link to Original site) Represen

  3. Cost effective method of manual afterloading 192Ir brachytherapy

    International Nuclear Information System (INIS)

    Full text: In radiotherapy, brachytherapy mode of treatment has equal importance like the external beam radiotherapy. In our hospital we have manual afterloading 137Cs kit supplied by BRIT for intracavitary treatment of carcinoma cervix and vaginal cases. In July 1999, we also started afterloading 192Ir brachytherapy. For a hospital like ours, where funds are minimal, it is impossible to procure remote afterloading brachytherapy unit, which is very costly. So we have developed the cost-effective 192Ir manual brachytherapy and so far we have done 60 cases which include intraluminal and interstitial cases

  4. 49 CFR 192.736 - Compressor stations: Gas detection.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Compressor stations: Gas detection. 192.736... Compressor stations: Gas detection. (a) Not later than September 16, 1996, each compressor building in a compressor station must have a fixed gas detection and alarm system, unless the building is— (1)...

  5. 49 CFR 192.169 - Compressor stations: Pressure limiting devices.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Compressor stations: Pressure limiting devices... Pipeline Components § 192.169 Compressor stations: Pressure limiting devices. (a) Each compressor station... compressor station must extend to a location where the gas may be discharged without hazard....

  6. 49 CFR 192.171 - Compressor stations: Additional safety equipment.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Compressor stations: Additional safety equipment... Pipeline Components § 192.171 Compressor stations: Additional safety equipment. (a) Each compressor station... operation may not be affected by the emergency shutdown system. (b) Each compressor station prime...

  7. 49 CFR 192.625 - Odorization of gas.

    Science.gov (United States)

    2010-10-01

    ... combustible gas in a distribution line must contain a natural odorant or be odorized so that at a... parts by weight. (e) Equipment for odorization must introduce the odorant without wide variations in the... 49 Transportation 3 2010-10-01 2010-10-01 false Odorization of gas. 192.625 Section...

  8. 49 CFR Appendix B to Part 192 - Qualification of Pipe

    Science.gov (United States)

    2010-10-01

    ... appendix B of part 192, see the List of CFR Sections Affected, which appears in the Finding Aids section of... Pipe I. Listed Pipe Specifications API 5L—Steel pipe, “API Specification for Line Pipe” (incorporated..., at least one test weld must be made for each 100 lengths of pipe. On pipe 4 inches (102...

  9. 49 CFR 192.227 - Qualification of welders.

    Science.gov (United States)

    2010-10-01

    ... accordance with section 6 of API 1104 (incorporated by reference, see § 192.7) or section IX of the ASME... produces a hoop stress of less than 20 percent of SMYS by performing an acceptable test weld, for the process to be used, under the test set forth in section I of Appendix C of this part. Each welder who...

  10. 49 CFR 192.65 - Transportation of pipe.

    Science.gov (United States)

    2010-10-01

    ... railroad unless: (1) The transportation is performed in accordance with API Recommended Practice 5L1... shorter time period permitted under Subpart J of this Part, the test pressure must be maintained for at... performed in accordance with API Recommended Practice 5LW (incorporated by reference, see § 192.7)....

  11. 31 CFR 103.192 - Special measures against VEF Bank.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Special measures against VEF Bank... Law Enforcement Access to Foreign Bank Records § 103.192 Special measures against VEF Bank. (a....175(d)(1)(ii). (2) Covered financial institution includes: (i) An insured bank (as defined in...

  12. Dose determination in breast tumor in brachytherapy using Iridium-192

    International Nuclear Information System (INIS)

    Thermoluminescent dosimetry studies in vivo and in vitro aiming to determing radiation dose in the breast tumor, in brachytherapy using Iridium-192 was done. The correlation between radiation doses in tumor and external surface of the breast was investigated for correcting the time interval of radiation source implantation. (author)

  13. 49 CFR 192.359 - Customer meter installations: Operating pressure.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Customer meter installations: Operating pressure... SAFETY TRANSPORTATION OF NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Customer Meters, Service Regulators, and Service Lines § 192.359 Customer meter installations: Operating...

  14. 49 CFR 192.461 - External corrosion control: Protective coating.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false External corrosion control: Protective coating... for Corrosion Control § 192.461 External corrosion control: Protective coating. (a) Each external protective coating, whether conductive or insulating, applied for the purpose of external corrosion...

  15. 27 CFR 479.192 - Commerce in firearms and ammunition.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Commerce in firearms and..., AND CERTAIN OTHER FIREARMS Other Laws Applicable § 479.192 Commerce in firearms and ammunition. For provisions relating to commerce in firearms and ammunition, including the movement of destructive...

  16. 49 CFR 192.153 - Components fabricated by welding.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Components fabricated by welding. 192.153 Section....153 Components fabricated by welding. (a) Except for branch connections and assemblies of standard... welding, whose strength cannot be determined, must be established in accordance with paragraph UG-101...

  17. 49 CFR 192.189 - Vaults: Drainage and waterproofing.

    Science.gov (United States)

    2010-10-01

    ... Components § 192.189 Vaults: Drainage and waterproofing. (a) Each vault must be designed so as to minimize the entrance of water. (b) A vault containing gas piping may not be connected by means of a drain connection to any other underground structure. (c) Electrical equipment in vaults must conform to...

  18. 49 CFR 192.183 - Vaults: Structural design requirements.

    Science.gov (United States)

    2010-10-01

    ... vault or pit structure, provision must be made to prevent the passage of gases or liquids through the... Components § 192.183 Vaults: Structural design requirements. (a) Each underground vault or pit for valves... so that all of the equipment required in the vault or pit can be properly installed, operated,...

  19. Development of the iridium software for quality control of iridium-192 activated wires

    International Nuclear Information System (INIS)

    In order to improve quality control of Iridium-192 wires produced by IPEN, an automatic system prototype for the measurement of Iridium-192 activated wire was developed. This work shows the development of the Iridium software for such system

  20. Traceable calibration of a reference well chamber at HDR 192Ir energy

    International Nuclear Information System (INIS)

    With the increasing use of the remote afterloading HDR 192Ir equipment in the country, an urgent need was felt to establish a Standard for the HDR 192Ir source. The objective of the programme was to offer traceable calibration to all the hospital well chambers, at HDR 192Ir energy

  1. 49 CFR 192.909 - How can an operator change its integrity management program?

    Science.gov (United States)

    2010-10-01

    ... Transmission Pipeline Integrity Management § 192.909 How can an operator change its integrity management... 49 Transportation 3 2010-10-01 2010-10-01 false How can an operator change its integrity management program? 192.909 Section 192.909 Transportation Other Regulations Relating to...

  2. 41 CFR 102-192.5 - What does this part cover?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What does this part cover? 102-192.5 Section 102-192.5 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION ADMINISTRATIVE PROGRAMS 192-MAIL...

  3. 49 CFR 192.743 - Pressure limiting and regulating stations: Capacity of relief devices.

    Science.gov (United States)

    2010-10-01

    ...: Capacity of relief devices. 192.743 Section 192.743 Transportation Other Regulations Relating to... STANDARDS Maintenance § 192.743 Pressure limiting and regulating stations: Capacity of relief devices. (a) Pressure relief devices at pressure limiting stations and pressure regulating stations must have...

  4. 49 CFR 192.369 - Service lines: Connections to cast iron or ductile iron mains.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Service lines: Connections to cast iron or ductile iron mains. 192.369 Section 192.369 Transportation Other Regulations Relating to Transportation... Customer Meters, Service Regulators, and Service Lines § 192.369 Service lines: Connections to cast iron...

  5. 27 CFR 25.192 - Removal of sour or damaged beer.

    Science.gov (United States)

    2010-04-01

    ... beer. 25.192 Section 25.192 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Removals Without Payment of Tax Removal of Beer Unfit for Beverage Use § 25.192 Removal of sour or damaged beer. (a) Containers. The brewer shall remove sour...

  6. High dose rate 192Ir calibration: Indonesia experiences

    International Nuclear Information System (INIS)

    Indonesia with a population of more than 200 Million people which spread on about 5000 islands, up to now only has 23 radiotherapy centers and some not active anymore. As mention by Parkin et al that Cervix/Utery and breast cancer are the most estimated numbers of new cases of cancers in women for developing countries, stomach and lung cancers in men. Indonesia as a developing country is likely similar to other developing countries on numbers of new cases of cancers in women. But quite different in men, in Indonesia the most common cancers are nasopharynx and thyroid cancers. The use of lr-192 sources in high dose-rate (HDR) remotely afterloaded brachytherapy treatments have greatly increased in recent years and variety of such sources are commercially available. Nine radiotherapy centers in Indonesia installed Nucletron microSelectron HDR remote afterloader. Based on the data of CiptoMangunkusurno Hospital, Jakarta that the most common cancers are the cervix, breast, nasopharynx and thyroid cancers which of percentage are about 31%, 25 %, 13%, and 6 % respectively. It means that the use of HDR 192Ir brachytherapy has to be an effective tool in the treatments. Two methods have been studied and applied to calibrate HDR 192Ir brachytherapy in Indonesia, especially for Nucletron microSelectron HDR 192lr remote afterloader brachytherapy. Calibration of HDR 192Ir brachytherapy source has been done by Cavity lonization Chamber and with Well Type lonization Chamber. First, 0.6 cc of NE Farmer type dosimeter that was calibrated to 60Co and 250 kV of x-rays in air kerma was used in this experiment. Position of measurement (detector and source) at the center of the room and about 1 meter from the floor. Eight variation of distances from 10 cm to 40 cms have been carried out measurement as recommended by IAEA-TECDOC-1079. Correction have been given for scatters, non-uniformity, and attenuation. To solve the problem of scatter correction factor was used Matlab programming. A

  7. Dicty_cDB: CHN192 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 DR181209 |DR181209.1 RTMNUT1_37_B06.g2_A029 Roots minus micronutrients Pinus taeda cDNA clone RTMNUT1_37_B...70206 |pid:none) Aspergillus niger contig An09c017... 188 1e-46 AM920436_1609( AM920436 |pid:none) Penicillium chrysogenu...... 187 2e-46 EF030553_1( EF030553 |pid:none) Cricetulus griseus DNA helicase (E... 182...0 m2 : 0.00 mNt: 0.00 m3a: 0.00 m3b: 0.00 m_ : 1.00 44.0 %: cytoplasmic 40.0 %: nuclear 12.0 %: mitochondria...CH (Link to library) CHN192 (Link to dictyBase) - - - Contig-U11403-1 CHN192P (Link to Ori

  8. Traceable calibration of hospital 192Ir HDR sources

    International Nuclear Information System (INIS)

    A HDR 1000 PLUS well type ionization chamber, procured from Standard Imaging, USA, and maintained by medical Physics and Safety Section (MPSS), Bhabha Atomic Research Centre (BARC), India, as a reference well chamber 1 (RWCH1), was traceably calibrated against the primary standard established by Radiological Standards Laboratory (RSL), BARC for 192Ir HDR source, in terms of air kerma strength (AKS). An indigenously developed well-type ionization chamber, reference well chamber 2 (RWCH2) and electrometer system, fabricated by CD High Tech (CDHT) Instruments Private Ltd., Bangalore, India, was in turn calibrated against RWCH1. The CDHT system (i.e. RWCH2 and CDHT electrometer system) was taken to several hospitals, in different regions of the country, to check the calibration status of 192Ir HDR sources. The result of this calibration audit work is reported here. (author)

  9. A projector of iridium 192 wires: motivations and preliminary studies

    International Nuclear Information System (INIS)

    Though the majority of procedures involved in curietherapy with Iridium 192 wires cause very few problems concerning radiation protection, this is not true in all cases: in elderly of debilitated patients, young children, or when using special techniques (curietherapy for prostate of bladder cancers for example). In these cases, the need for frequent treatment exposes the therapists to increased doses. The projector of Iridium 192 wires was conceived in order to reduce this irradiated hazard. A simple manipulation places the radioactive wires in a lead container during treatment, and then replaces them in the right position after therapy. This apparatus appears to offer the possibility of: an almost total protection of the therapists, and thus an opportunity for enlarging the indications for curietherapy; an improved quality of treatment to the patient during the application

  10. The air-kerma rate constant of 192Ir.

    Science.gov (United States)

    Ninković, M M; Raiĉevìć, J J

    1993-01-01

    The air-kerma rate constant gamma delta (and its precursors), as one of the basic radiation characteristics of 192Ir, was determined by many authors. Analysis of accessible data on this quantity led us to the conclusion that published data strongly disagree. That is the reason we calculated this quantity on the basis of our and many other authors' gamma-ray spectral data and the latest data for mass energy-transfer coefficients for air. In this way, a value was obtained for gamma delta of 30.0 +/- 0.9 a Gy m2 s-1 Bq-1 for an unshielded 192Ir source and 27.8 +/- 0.9 a Gy m2s -1Bq-1 for a standard packaged radioactive source taking into account attenuation of gamma rays in the platinum source wall. PMID:8416220

  11. A Secure Hash Function MD-192 With Modified Message Expansion

    OpenAIRE

    Harshvardhan Tiwari; Dr. Krishna Asawa

    2010-01-01

    Cryptographic hash functions play a central role in cryptography. Hash functions were introduced in cryptology to provide message integrity and authentication. MD5, SHA1 and RIPEMD are among the most commonly used message digest algorithm. Recently proposed attacks on well known and widely used hash functions motivate a design of new stronger hash function. In this paper a new approach is presented that produces 192 bit message digest and uses a modified message expansion mechanism which gene...

  12. Radiation effects of iridium-192 implants in the cat brain

    International Nuclear Information System (INIS)

    The radiation effects of 192Ir permanent implants into the cat brain were studied with respect to morphological changes, blood flow, brain water and electrolytes. 192Ir wires (10 animals) and non-radioactive silver wires (5 control animals) were placed stereotactically into the left internal capsule. Activity of 192Ir was 0.31 mCi, the accumulated dose at 5 mm distance was 3060 rad after 21 days and 4680 rad after 35 days, respectively. None of the animals presented a neurological deficit, and the EEG recording was without significant changes. Histological damage which could be attributed to the radiation was not observed. Serum proteins, however, were detected immunohistochemically in reactive astrocytes (3 x), in macrophages (2 x) and as diffuse perivascular accumulation. Brain water in the white matter near the implantation site increased from 68.6 to 73.2%, corresponding to a volume increase of about 17%. There was no change in the grey matter or the opposite hemisphere. Cerebral blood flow decreased slightly but there was no relationship with the development of edema. The findings suggest that low dose rate topical irradiation of the brain produces primarily membrane-dependent changes, resulting in local brain edema. (orig.)

  13. 41 CFR 102-192.125 - What is the appropriate managerial level for an agency mail manager?

    Science.gov (United States)

    2010-07-01

    ... managerial level for an agency mail manager? 102-192.125 Section 102-192.125 Public Contracts and Property... ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT Agency Mail Manager Requirements § 102-192.125 What is the appropriate managerial level for an agency mail manager? The agency mail manager should be at a...

  14. 41 CFR 102-192.140 - What are your general responsibilities as a Federal mail center manager?

    Science.gov (United States)

    2010-07-01

    ... responsibilities as a Federal mail center manager? 102-192.140 Section 102-192.140 Public Contracts and Property... ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT Mail Center Manager Requirements § 102-192.140 What are your general responsibilities as a Federal mail center manager? A Federal mail center manager should— (a) Implement policies...

  15. Durable donor engraftment after radioimmunotherapy using α-emitter astatine-211-labeled anti-CD45 antibody for conditioning in allogeneic hematopoietic cell transplantation.

    Science.gov (United States)

    Chen, Yun; Kornblit, Brian; Hamlin, Donald K; Sale, George E; Santos, Erlinda B; Wilbur, D Scott; Storer, Barry E; Storb, Rainer; Sandmaier, Brenda M

    2012-02-01

    To reduce toxicity associated with external γ-beam radiation, we investigated radioimmunotherapy with an anti-CD45 mAb labeled with the α-emitter, astatine-211 ((211)At), as a conditioning regimen in dog leukocyte antigen-identical hematopoietic cell transplantation (HCT). Dose-finding studies in 6 dogs treated with 100 to 618 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) without HCT rescue demonstrated dose-dependent myelosuppression with subsequent autologous recovery, and transient liver toxicity in dogs treated with (211)At doses less than or equal to 405 μCi/kg. Higher doses of (211)At induced clinical liver failure. Subsequently, 8 dogs were conditioned with 155 to 625 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) before HCT with dog leukocyte antigen-identical bone marrow followed by a short course of cyclosporine and mycophenolate mofetil immunosuppression. Neutropenia (1-146 cells/μL), lymphopenia (0-270 cells/μL), and thrombocytopenia (1500-6560 platelets/μL) with prompt recovery was observed. Seven dogs had long-term donor mononuclear cell chimerism (19%-58%), whereas 1 dog treated with the lowest (211)At dose (155 μCi/kg) had low donor mononuclear cell chimerism (5%). At the end of follow-up (18-53 weeks), only transient liver toxicity and no renal toxicity had been observed. In conclusion, conditioning with (211)At-labeled anti-CD45 mAb is safe and efficacious and provides a platform for future clinical trials of nonmyeloablative transplantation with radioimmunotherapy-based conditioning. PMID:22134165

  16. Dosimetric characterization of interstitial radiotherapy sources: application to iridium 192

    International Nuclear Information System (INIS)

    192Ir interstitial radiotherapy sources have been characterized in terms of normal kerma-rate in air ksub(n), with an air-filled graphite cavity chamber of known volume, thus leading to primary standards. The distribution of absorbed dose in water has been studied, at different depths in a phantom, with an intracavitary chamber and with lithium fluoride thermoluminescent dosemeters. These two experimental investigations, complemented with the establishment of a rigorous formalism, made it possible to determine the transmission function phi(d) in water, which is used in calculation codes for interstitial therapy. The values thus obtained are then compared to these previously published

  17. New results on the superdeformed band in 192Hg

    International Nuclear Information System (INIS)

    New results on the 192Hg superdeformed band have been obtained with EUROGAM. The experiment has been performed with the 160Gd(36S, 4n) reaction at 159 MeV. Above 800 keV the γ-ray energies differ from the previously published ones. Thus the rise of the dynamical moment of inertia F(2) above hω = 0.4 MeV is no longer observed. This is in better agreement with recent cranked Hartree-Fock-Bogoliubov calculations. (orig.)

  18. A Secure Hash Function MD-192 With Modified Message Expansion

    CERN Document Server

    Tiwari, Harshvardhan

    2010-01-01

    Cryptographic hash functions play a central role in cryptography. Hash functions were introduced in cryptology to provide message integrity and authentication. MD5, SHA1 and RIPEMD are among the most commonly used message digest algorithm. Recently proposed attacks on well known and widely used hash functions motivate a design of new stronger hash function. In this paper a new approach is presented that produces 192 bit message digest and uses a modified message expansion mechanism which generates more bit difference in each working variable to make the algorithm more secure. This hash function is collision resistant and assures a good compression and preimage resistance.

  19. Recovery of Ir-192 sources during emergency situations

    International Nuclear Information System (INIS)

    During operations for the carrying out of services through the utilization of Ir-192 radio sources in radiographic tests of equipment, emergency situations may occur due to various causes and which bring radiologic accidents with doses exceeding the maximum alloewd. This work has the purpose to submit and analyze the major types of radiological accidents and its consequences for the installations and the procedures for the recuperation of sources during such situations. Another aspect to be mentioned shall be the interruption of services - such as production - and which is to be the lowest possible during the emergency. (author)

  20. Iridium 192 dosimetric study by Monte-Carlo method

    International Nuclear Information System (INIS)

    The Monte-Carlo method was applied to a dosimetry of iridium192 in water and in air; an iridium-platinum alloy seed, enveloped by a platinum can, is used as source. The radioactive decay of this nuclide and the transport of emitted particles from the seed-source in the can and in the irradiated medium are simulated successively. The photons energy spectra outside the source, as well as dose distributions, are given. Phi(d) function is calculated and our results with various experimental values are compared

  1. Simulation of dose distribution for iridium-192 brachytherapy source type-H01 using MCNPX

    International Nuclear Information System (INIS)

    Dosimetric data for a brachytherapy source should be known before it used for clinical treatment. Iridium-192 source type H01 was manufactured by PRR-BATAN aimed to brachytherapy is not yet known its dosimetric data. Radial dose function and anisotropic dose distribution are some primary keys in brachytherapy source. Dose distribution for Iridium-192 source type H01 was obtained from the dose calculation formalism recommended in the AAPM TG-43U1 report using MCNPX 2.6.0 Monte Carlo simulation code. To know the effect of cavity on Iridium-192 type H01 caused by manufacturing process, also calculated on Iridium-192 type H01 if without cavity. The result of calculation of radial dose function and anisotropic dose distribution for Iridium-192 source type H01 were compared with another model of Iridium-192 source

  2. Simulation of dose distribution for iridium-192 brachytherapy source type-H01 using MCNPX

    Energy Technology Data Exchange (ETDEWEB)

    Purwaningsih, Anik [Center for development of nuclear informatics, National Nuclear Energy Agency, PUSPIPTEK, Serpong, Banten 15310 (Indonesia)

    2014-09-30

    Dosimetric data for a brachytherapy source should be known before it used for clinical treatment. Iridium-192 source type H01 was manufactured by PRR-BATAN aimed to brachytherapy is not yet known its dosimetric data. Radial dose function and anisotropic dose distribution are some primary keys in brachytherapy source. Dose distribution for Iridium-192 source type H01 was obtained from the dose calculation formalism recommended in the AAPM TG-43U1 report using MCNPX 2.6.0 Monte Carlo simulation code. To know the effect of cavity on Iridium-192 type H01 caused by manufacturing process, also calculated on Iridium-192 type H01 if without cavity. The result of calculation of radial dose function and anisotropic dose distribution for Iridium-192 source type H01 were compared with another model of Iridium-192 source.

  3. Cep192 controls the balance of centrosome and non-centrosomal microtubules during interphase.

    Directory of Open Access Journals (Sweden)

    Brian P O'Rourke

    Full Text Available Cep192 is a centrosomal protein that contributes to the formation and function of the mitotic spindle in mammalian cells. Cep192's mitotic activities stem largely from its role in the recruitment to the centrosome of numerous additional proteins such as gamma-tubulin and Pericentrin. Here, we examine Cep192's function in interphase cells. Our data indicate that, as in mitosis, Cep192 stimulates the nucleation of centrosomal microtubules thereby regulating the morphology of interphase microtubule arrays. Interestingly, however, cells lacking Cep192 remain capable of generating normal levels of MTs as the loss of centrosomal microtubules is augmented by MT nucleation from other sites, most notably the Golgi apparatus. The depletion of Cep192 results in a significant decrease in the level of centrosome-associated gamma-tubulin, likely explaining its impact on centrosome microtubule nucleation. However, in stark contrast to mitosis, Cep192 appears to maintain an antagonistic relationship with Pericentrin at interphase centrosomes. Interphase cells depleted of Cep192 display significantly higher levels of centrosome-associated Pericentrin while overexpression of Cep192 reduces the levels of centrosomal Pericentrin. Conversely, depletion of Pericentrin results in elevated levels of centrosomal Cep192 and enhances microtubule nucleation at centrosomes, at least during interphase. Finally, we show that depletion of Cep192 negatively impacts cell motility and alters normal cell polarization. Our current working hypothesis is that the microtubule nucleating capacity of the interphase centrosome is determined by an antagonistic balance of Cep192, which promotes nucleation, and Pericentrin, which inhibits nucleation. This in turn determines the relative abundance of centrosomal and non-centrosomal microtubules that tune cell movement and shape.

  4. The production of Iridium-192 (192-Ir) sealed source by Nuclear Malaysia for non-destruction testing (NDT)

    International Nuclear Information System (INIS)

    Malaysian Nuclear Agency (Nuclear Malaysia) has been engaged in the production of a few radioisotopes that can be used in agriculture, medicine, industries and further more to be used in other applications, such as teaching, training and calibration. These radioisotopes are produced by using our TRIGA MARK II research reactor which provides a maximum neutron flux at the central thimble irradiation position about 10E12 ncm-2s-1. The achievable quantity of radioactivity of radioisotope produced by this reactor is relatively low for most of the applications due to limitation of neutron flux available. This limitation is seen to exist for quiet some time until a higher neutron flux is available in the future. In addition to this, our reactor is approaching toward the end of their operational performance. In order to sustain Nuclear Malaysia active involvement in radioisotope production and considering the current production facilities available, other possible mode of radioisotope production are developed. In line with this, a joint venture project between Nuclear Malaysia and a NDT company in Malaysia has been established to produce the Ir-192 Sealed Source. The project consists of technology transfer from Korean Atomic Energy Agency Research Institute (KAERI) /Ho Jin Industry Ltd. to Nuclear Malaysia. Series of production equipment are installed in our 10 cm thickness lead (Pb) shielded box known as hot-cell. The irradiated double encapsulated Ir-192 disc imported from KAERI will undergo final assembly. Decay sources from Gamma Projector is removed, cut and stored in a waste container. Steps of production include source changing, cutting, cramping, dimension test and Go/No Go testing. The Atomic Energy Licensing Board (AELB) has issued the above production facility for manufacturing of Ir-192 pigtail for Gamma Projector types Tech-ops. (Author)

  5. Qualification tests for {sup 192}Ir sealed sources

    Energy Technology Data Exchange (ETDEWEB)

    Iancso, Georgeta, E-mail: georgetaiancso@yahoo.com; Iliescu, Elena, E-mail: georgetaiancso@yahoo.com; Iancu, Rodica, E-mail: georgetaiancso@yahoo.com [National Institute of R and D for Physics and Nuclear Engineering Horia Hulubei, Magurele (Romania)

    2013-12-16

    This paper describes the results of qualification tests for {sup 192}Ir sealed sources, available in Testing and Nuclear Expertise Laboratory of National Institute for Physics and Nuclear Engineering 'Horia Hulubei' (I.F.I.N.-HH), Romania. These sources had to be produced in I.F.I.N.-HH and were tested in order to obtain the authorization from The National Commission for Nuclear Activities Control (CNCAN). The sources are used for gammagraphy procedures or in gammadefectoscopy equipments. Tests, measurement methods and equipments used, comply with CNCAN, AIEA and International Quality Standards and regulations. The qualification tests are: 1. Radiological tests and measurements: dose equivalent rate at 1 m; tightness; dose equivalent rate at the surface of the transport and storage container; external unfixed contamination of the container surface. 2. Mechanical and climatic tests: thermal shock; external pressure; mechanic shock; vibrations; boring; thermal conditions for storage and transportation. Passing all tests, it was obtained the Radiological Security Authorization for producing the {sup 192}Ir sealed sources. Now IFIN-HH can meet many demands for this sealed sources, as the only manufacturer in Romania.

  6. Iridium-192 implants in the treatment of tonsillar region malignancies

    International Nuclear Information System (INIS)

    A total of 127 patients with histologically proved diagnosis of carcinoma of the tonsillar region and soft palate were treated over the past ten years utilizing interstitial iridium-192 implants. Eighty patients were treated for primary tumors and 47 patients for either recurrent or persistent tumors after definitive irradiation and/or surgery. All patients with primary tumors were treated by a combination of external megavoltage irradiation and interstitial iridium-192 implants, whereas patients with recurrent tumors were treated by interstitial implants alone. In the primary group, 95% of patients with T1 and T2 lesions and 79% with T3 and T4 lesions achieved complete local tumor control. The three-year absolute disease-free survival rate was 72%. Seventy-five percent local tumor control was obtained in patients with recurrent disease, with two-year absolute disease-free survival of 42%. Treatment-related complications such as soft-tissue necrosis or osteoradionecrosis occurred in 6% of patients in the primary group and 23% in recurrent group. This treatment regimen offers an excellent locoregional control with no significant functional or esthetic impairment. Most patients with primary lesions who fail this regimen can be salvaged by surgery or reirradiation using interstitial implants

  7. 49 CFR 192.107 - Yield strength (S) for steel pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Yield strength (S) for steel pipe. 192.107 Section... NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Pipe Design § 192.107 Yield strength (S) for steel pipe. (a) For pipe that is manufactured in accordance with a specification listed...

  8. 49 CFR 192.111 - Design factor (F) for steel pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Design factor (F) for steel pipe. 192.111 Section... NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Pipe Design § 192.111 Design factor (F) for steel pipe. (a) Except as otherwise provided in paragraphs (b), (c), and (d) of this section,...

  9. 49 CFR 192.113 - Longitudinal joint factor (E) for steel pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Longitudinal joint factor (E) for steel pipe. 192... SAFETY TRANSPORTATION OF NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Pipe Design § 192.113 Longitudinal joint factor (E) for steel pipe. The longitudinal joint factor to be used in...

  10. 49 CFR 192.109 - Nominal wall thickness (t) for steel pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Nominal wall thickness (t) for steel pipe. 192.109... TRANSPORTATION OF NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Pipe Design § 192.109 Nominal wall thickness (t) for steel pipe. (a) If the nominal wall thickness for steel pipe is not...

  11. 49 CFR 192.373 - Service lines: Cast iron and ductile iron.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Service lines: Cast iron and ductile iron. 192.373... Regulators, and Service Lines § 192.373 Service lines: Cast iron and ductile iron. (a) Cast or ductile iron... cast iron pipe or ductile iron pipe is installed for use as a service line, the part of the...

  12. 41 CFR 102-192.145 - Which program levels should have a mail manager?

    Science.gov (United States)

    2010-07-01

    ... should have a mail manager? 102-192.145 Section 102-192.145 Public Contracts and Property Management... have a mail manager? Every program level within a Federal agency that generates a significant quantity of outgoing mail should have its own mail manager. Each agency must decide which programs will have...

  13. Primary standardization of the HDR 192Ir source in terms of air kerma strength

    International Nuclear Information System (INIS)

    Establishing a primary standard of AKS at the Standards Laboratory and offering traceable calibration to all the hospitals that make use of HDR 192Ir, in brachytherapy is important. With this objective, the primary standardization of the HDR 192Ir source was undertaken. Details of the work are presented

  14. 19 CFR 192.14 - Electronic information for outward cargo required in advance of departure.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Electronic information for outward cargo required in advance of departure. 192.14 Section 192.14 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) EXPORT CONTROL Filing of Export Information Through the Automated Export...

  15. 49 CFR 192.115 - Temperature derating factor (T) for steel pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Temperature derating factor (T) for steel pipe... § 192.115 Temperature derating factor (T) for steel pipe. The temperature derating factor to be used in the design formula in § 192.105 is determined as follows: Gas temperature in degrees...

  16. Genome Sequence of Bacillus cereus Phage vB_BceS-MY192

    OpenAIRE

    Yang, Yong; Zhan, Li; Chen, Jiancai; Zhang, Yunyi; Sun, Yi; Yang, Zhangnv; Jiang, Liping; Zhu, Hanping; Zhang, Yanjun; Lu, Yiyu; Mei, Lingling

    2016-01-01

    Bacillus cereus is an opportunistic foodborne pathogen. The phage vB_BceS-MY192 was isolated from B. cereus 192 in a cooked rice sample. The temperate phage belongs to the Siphoviridae family, Caudovirales order. Here we announce the phage genome sequence and its annotation, which may expand the understanding of B. cereus siphophages.

  17. Genome Sequence of Bacillus cereus Phage vB_BceS-MY192.

    Science.gov (United States)

    Yang, Yong; Zhan, Li; Chen, Jiancai; Zhang, Yunyi; Sun, Yi; Yang, Zhangnv; Jiang, Liping; Zhu, Hanping; Zhang, Yanjun; Lu, Yiyu; Mei, Lingling

    2016-01-01

    ITALIC! Bacillus cereusis an opportunistic foodborne pathogen. The phage vB_BceS-MY192 was isolated from ITALIC! B. cereus192 in a cooked rice sample. The temperate phage belongs to the ITALIC! Siphoviridaefamily, ITALIC! Caudoviralesorder. Here we announce the phage genome sequence and its annotation, which may expand the understanding of ITALIC! B. cereussiphophages. PMID:27103733

  18. Lifetimes of an excited superdeformed band in {sup 192}Hg

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, I.; Blumenthal, D.; Carpenter, M.P. [and others

    1995-08-01

    An excited superdeformed band was identified in {sup 192}Hg and the lifetimes of its levels measured with the Doppler-shift attenuation method from data taken with the Eurogam spectrometer. The band is proposed to be based on the two-quasineutron (v[642]3/2 [512]5/2) configuration, which after a band crossing, becomes the (v[642]3/2 [752]5/2) configuration. The transition quadrupole moment Q{sub t} of the excited band is the same as that of the yrast SD band, within experimental errors. This suggests that the deformation of the SD minimum is robust with respect to quasiparticle excitation, despite the occupation of the deformation-driving v[752]5/2 level (from the j{sub 15/2} shell) after the band crossing.

  19. 192Ir high dose rate (HDR) interstitial brain implant: optimisation

    International Nuclear Information System (INIS)

    The new modality of stepping source dosimetry system (SSDs) illustrates a remarkable improvement in attaining the uniform and homogeneous dose distribution within the target volume. The technique enables the physicist to correct for a certain amount of misplacement or curvature of implant geometry. The short course of brachytherapy provides good palliation in terms of functional improvements with low and acceptable toxicity in high-grade glioma. With continual refinements of the technique, brachytherapy performed by a skilled brachytherapy team offers an opportunity to improve patient survival and quality of life. Since 1997, micro selectron HDR 192Ir treatments are done including gynecological, oesophageal, breast, surface mould, soft tissue sarcoma (STS) and brain in our hospital. In this paper, procedure of interstitial brain implant in glioma as implant technique, simulation and treatment planning will be discussed

  20. Influence of the 192Ir source decay on biological effect

    International Nuclear Information System (INIS)

    Biological effect of the 192Ir high activity source on LA795 tumor of mice and HCT-8 cells have been investigated when decay of the source power from 340.4 GBq to 81.4 GBq no marked difference was found between the two cell survival curves of HCT-8 cells and both of them compared with that of the X-ray irradiation the value of relative biological effect (0.1 survival) was 0.43. On the experiment of tumor LA795 of mice, when the source power was 293.3 GBq and 96.2 GBq, no different biological effect can be seen between the two series of figures. The relative biological effect was 0.55-0.60 (tumor growth delay) comparing with those of X-ray irradiation

  1. 15 CFR 19.2 - Why has the Commerce Department issuing these regulations and what do they cover?

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Why has the Commerce Department issuing these regulations and what do they cover? 19.2 Section 19.2 Commerce and Foreign Trade Office of the Secretary of Commerce COMMERCE DEBT COLLECTION General Provisions § 19.2 Why has the...

  2. Water equivalent phantom materials for 192Ir brachytherapy

    Science.gov (United States)

    Schoenfeld, Andreas A.; Harder, Dietrich; Poppe, Björn; Chofor, Ndimofor

    2015-12-01

    Several solid phantom materials have been tested regarding their suitability as water substitutes for dosimetric measurements in brachytherapy with 192Ir as a typical high energy photon emitter. The radial variations of the spectral photon fluence, of the total, primary and scattered photon fluence and of the absorbed dose to water in the transversal plane of the tested cylindrical phantoms surrounding a centric and coaxially arranged Varian GammaMed afterloading 192Ir brachytherapy source were Monte-Carlo simulated in EGSnrc. The degree of water equivalence of a phantom material was evaluated by comparing the radial dose-to-water profile in the phantom material with that in water. The phantom size was varied over a large range since it influences the dose contribution by scattered photons with energies diminished by single and multiple Compton scattering. Phantom axis distances up to 10 cm were considered as clinically relevant. Scattered photons with energies reaching down into the 25 keV region dominate the photon fluence at source distances exceeding 3.5 cm. The tested phantom materials showed significant differences in the degree of water equivalence. In phantoms with radii up to 10 cm, RW1, RW3, Solid Water, HE Solid Water, Virtual Water, Plastic Water DT, and Plastic Water LR phantoms show excellent water equivalence with dose deviations from a water phantom not exceeding 0.8%, while Original Plastic Water (as of 2015), Plastic Water (1995), Blue Water, polyethylene, and polystyrene show deviations up to 2.6%. For larger phantom radii up to 30 cm, the deviations for RW1, RW3, Solid Water, HE Solid Water, Virtual Water, Plastic Water DT, and Plastic Water LR remain below 1.4%, while Original Plastic Water (as of 2015), Plastic Water (1995), Blue Water, polyethylene, and polystyrene produce deviations up to 8.1%. PMMA plays a separate role, with deviations up to 4.3% for radii not exceeding 10 cm, but below 1% for radii up to 30 cm. As suggested by

  3. Water equivalent phantom materials for (192)Ir brachytherapy.

    Science.gov (United States)

    Schoenfeld, Andreas A; Harder, Dietrich; Poppe, Björn; Chofor, Ndimofor

    2015-12-21

    Several solid phantom materials have been tested regarding their suitability as water substitutes for dosimetric measurements in brachytherapy with (192)Ir as a typical high energy photon emitter. The radial variations of the spectral photon fluence, of the total, primary and scattered photon fluence and of the absorbed dose to water in the transversal plane of the tested cylindrical phantoms surrounding a centric and coaxially arranged Varian GammaMed afterloading (192)Ir brachytherapy source were Monte-Carlo simulated in EGSnrc. The degree of water equivalence of a phantom material was evaluated by comparing the radial dose-to-water profile in the phantom material with that in water. The phantom size was varied over a large range since it influences the dose contribution by scattered photons with energies diminished by single and multiple Compton scattering. Phantom axis distances up to 10 cm were considered as clinically relevant. Scattered photons with energies reaching down into the 25 keV region dominate the photon fluence at source distances exceeding 3.5 cm.The tested phantom materials showed significant differences in the degree of water equivalence. In phantoms with radii up to 10 cm, RW1, RW3, Solid Water, HE Solid Water, Virtual Water, Plastic Water DT, and Plastic Water LR phantoms show excellent water equivalence with dose deviations from a water phantom not exceeding 0.8%, while Original Plastic Water (as of 2015), Plastic Water (1995), Blue Water, polyethylene, and polystyrene show deviations up to 2.6%. For larger phantom radii up to 30 cm, the deviations for RW1, RW3, Solid Water, HE Solid Water, Virtual Water, Plastic Water DT, and Plastic Water LR remain below 1.4%, while Original Plastic Water (as of 2015), Plastic Water (1995), Blue Water, polyethylene, and polystyrene produce deviations up to 8.1%. PMMA plays a separate role, with deviations up to 4.3% for radii not exceeding 10 cm, but below 1% for radii up to 30 cm.As suggested

  4. The period structure and stability of the pulsating white dwarf L 19-2

    International Nuclear Information System (INIS)

    Observations made in 1983-85 confirm the earlier detection of a slight inequality in the splitting of the frequency triplet near 192s of the pulsating DA white dwarf L 19-2. If interpreted as second-order splitting of rotationally-perturbed non-radial g-mode pulsations, the measured value, 2.0 x 10-6 mHz, is in rough agreement with outdated theoretical calculations which should be repeated with more realistic white dwarf models. The new observations are also used to set an upper limit on the rate of period change of the 192s oscillation. (author)

  5. OER and RBE for 125I and 192Ir at low dose rate on mammalian cells

    International Nuclear Information System (INIS)

    The oxygen enhancement ratio (OER) for 125I and 192Ir as well as the relative biological effectiveness (RBE) at low dose rates (40-80 cGy h-1) were determined for B16 melanoma cells in culture. The OER was found to be 2.1±0.03 for 125I and 2.7±0.04 for 192Ir. The RBE for 125I relative to 192Ir was determined as 1.8±0.03 under aerated conditions and as 2.4±0.03 under hypoxia. 18 refs.; 5 figs.; 1 table

  6. Dosimetry of iridium-192 sources used in brachytherapy; Dosimetria de fontes de iridio-192 utilizadas em braquiterapia

    Energy Technology Data Exchange (ETDEWEB)

    Henn, Keli Cristina

    1999-09-01

    The use of high dose rate brachytherapy (HDR) has been increasing in recent years, due to several advantages relative to conventional low dose rate brachytherapy, such as: shorter treatment times, the ability to fractionate treatment (and thus perform many treatments on an outpatient basis) and reduced worker exposures. Most HDR equipment uses small, high activity {sup 192} Ir sources, which are introduced into the patient using a remote system. The dose distribution around these sources is strongly dependent on the size and shape of the active volume and on the encapsulation of the source. The objective of this work is to compare two methods of calibrating sources of {sup 192} Ir, mamely, measurements in air with an ionization thimble chamber or with a well-type ionization chamber. In addition, we measured the anisotropy of the sources and made comparisons with values supplied by the manufacturer, since this factor is taken into account in the planning system algorithm when dose distributions are calculated. The dose was also evaluated at points of clinical interest (i.e. in the rectum and bladder) and compared to values obtained with the Nucletron PLATO-BPS planning system. The use of lead for rectal protection was evaluated in a cylindrical applicator, aiming the further development of a gynecological applicator. The results of the calibration of seven sources showed that the uncertainty in the calibration in a 'jig' system is smaller than 1%, compared to the value supplied by the source manufacturer. The differences between the results obtained with the well-type ionization camera and the 'jig' system were around 2%. The anisotropy showed good agreement with the values supplied by the manufacturer. The results show that the anisotropy factors, in air and water, are approximately constant and equal to 1.0, for angles between 70 deg and 150 deg. For angles smaller than 70 deg the anisotropy factor in water is larger than in air. Results are

  7. A manual afterloading technique for the treatment of patients with bronchial carcinoma using iridium-192 wire

    International Nuclear Information System (INIS)

    A manual afterloading technique using iridium-192 wire is described for the palliative treatment of patients with bronchial or oesophageal lesions, where the purchase of expensive remote afterloading equipment is not immediately possible. (UK)

  8. 49 CFR 192.177 - Additional provisions for bottle-type holders.

    Science.gov (United States)

    2010-10-01

    ... (31) (2) Designed using the design factors set forth in § 192.111; and (3) Buried with a minimum cover... attached to the small diameter portion of the bottle end closure for cathodic protection if a...

  9. Development on Monte Carlo methodology with scatter correction factor of afterloading 192 Ir source

    International Nuclear Information System (INIS)

    Objective: To facilitate activity measurement by using the thimble ionization chamber in hospitals, to obtain air kerma scatter correction factor of medical afterloading of 192Ir source by developing an available and convenient calculation method. Methods: According to International Atomic Energy Agency (IAEA) 1079 Report to calculate the scatter correction factor of 192Ir source, to measure air kerma of 192Ir source with and without lead shield using thimble ionization chamber. Simulation measurement conditions were used to calculate scatter correction factor of 192Ir source and comparison was made between experimental results and literature records. At the same time, the different ionization chamber models were simulated at different room sizes to obtain scattering correction factor of 192 Ir source. Results: Comparison was made between the simulation scatter correction factors of 192Ir source and experiment by the shadow shield, and the relative deviation was 0.8%. The deviation of the 192Ir activity calculated according to the simulated scatter correction factor and measured by well type ionization chamber was 2.4%. By comparison between the calculated results by using two kinds of spherical ionization chamber and those ones deduced by IAEA 1079 Report,the relative deviations ranged within 0.3%-0.4%. Five different types of thimble ionization chamber and different room sizes were simulated and calculated by MC simulation, with the relative deviation within 3%. Conclusions: Monte Carlo simulation method for calculating afterloading 192Ir source's scatter correction factor is feasible, and this method is convenient for use in the thimble chamber for brachytherapy QA work in the hospital. (authors)

  10. Air kerma strength calibration of 0.6 cc Farmer chamber for 192Ir HDR source

    International Nuclear Information System (INIS)

    One of the methods adopted by hospitals for the calibration of the HDR 192Ir source, in terms of Air Kerma Strength (AKS) is to use 0.6cc chamber at short source to chamber distances for measuring the air kerma rate at the chamber position and then compute the AKS using the appropriate correction factors. However, the 0.6 cc Farmer type chambers purchased by the users for the calibration of the HDR 192Ir source, are not generally provided with an HDR 192Ir calibration factor. With the result, many hospitals that have purchased the Farmer type chamber for the calibration of 192Ir HDR sources, use the 60Co calibration factor for this purpose. The use of 60Co calibration factor for the 192Ir HDR source would unnecessarily increase the uncertainty of the measured AKS. Again, because of the low chamber sensitivity, hospitals often use, source to chamber distances as small as a few cm for calibrating the 192Ir HDR source. In the absence of a rigid source-chamber positioning system, this can lead to several percent errors in AKS determination. Also, hospitals often don't take into account corrections for the room scatter or the fluence non-uniformity across the chamber, which further increase the uncertainty of the measured AKS

  11. Radiation control in the intensive care unit for high intensity iridium-192 brain implants

    International Nuclear Information System (INIS)

    A bedside lead cubicle was designed to minimize the radiation exposure of intensive care unit staff during routine interstitial brain irradiation by removable, high intensity iridium-192. The cubicle shields the patient without restricting intensive care routines. The design specifications were confirmed by exposure measurements around the shield with an implanted anthropomorphic phantom simulating the patient situation. The cubicle reduces the exposure rate around an implant patient by as much as 90%, with the exposure level not exceeding 0.1 mR/hour/mg of radium-equivalent 192Ir. Evaluation of data accumulated for the past 3 years has shown that the exposure levels of individual attending nurses are 0.12 to 0.36 mR/mg of radium-equivalent 192Ir per 12-hour shift. The corresponding range for entire nursing teams varies between 0.18 and 0.26. A radiation control index (exposure per mg of radium-equivalent 192Ir per nurse-hour) is thus defined for individual nurses and nursing teams; this index is a significant guide to the planning of nurse rotations for brain implant patients with various 192Ir loads. The bedside shield reduces exposure from 192Ir implants by a factor of about 20, as expected, and the exposure from the lower energy radioisotope iodine-125 is barely detectable

  12. Spins of superdeformed band in {sup 192}Hg

    Energy Technology Data Exchange (ETDEWEB)

    Lauritsen, T.; Khoo, T.L.; Henry, R.G. [and others

    1995-08-01

    Determination of the spins of SD states is the most important challenge in the study of superdeformation. Knowledge of the spin will provide crucial information on SD bands, in particular on the fascinating phenomenon of bands with identical energies and moments of inertia. Angular distribution coefficients of the {gamma}rays decaying out of the {sup 192}Hg SD band were determined using Eurogam data. These coefficients, as well as the spectral shape and multiplicity of the spectrum, are compared with the results of calculations, thereby providing a check on these calculations. From the measured decay multiplicity and the calculated average spin removed per photon (0.3 h), we deduce the average spin {bar I}{sub decay} removed by the {gamma} rays connecting SD and normal states. The spin I{sub SD} of the SD band from which the decay occurs is given by I{sub SD} = {bar I} decay + {bar I} ND, where {bar I} ND is the average spin removed by the normal yrast states. The state from which the major decay out of the SD band occurs is found to have spin 9.5 {plus_minus} 0.8 h. Since angular momentum is (quantized), this leads to a spin assignment of 9 or 10 h. The latter value is favored since the yrast band in the SD well must have only even spin values. This constitutes the first deduction of spin from data in the mass 150 and 190 regions. The spin of 10 h agrees with the spin which is inferred from a model, using the observed moment of inertia (Im){sup (2)}{omega}.

  13. Microwave hyperthermia radiosensitized iridium-192 for recurrent brain malignancy

    International Nuclear Information System (INIS)

    Twenty-one patients whose solitary detectable biopsy proven recurrent brain malignancies produced Central Nervous System (CNS) symptoms warranting further intervention received 60-minute 43 degrees C (180 degree-minute) interstitial 2450 MHz microwave hyperthermia fractions. All received brain teletherapy prior to recurrence. The first 15 received no brachytherapy and served as a toxicity pilot. All 15 enjoyed neurologic improvement, 12 symptomatic improvement, and 12 objective response as mass reduction and/or tumor necrosis. The next 6 patients were selected with more favorable Karnofsky performance status, no known active malignancy elsewhere, and received afterloading Ir-192 interstitial implantation juxtaposed to radiosensitizing hyperthermia. Volume dose varied from 1000 to 2245 rad, and dose rate from 40 to 100 rad/hr. Dose selected varied as a function of pre-recurrence teletherapy dose, general condition, histologic type, and volume. Neurosurgical debulking, if technically indicated through no additional aperture or trauma, was permitted if consistent with preservation of neurological function. Six enjoyed neurologic improvement, symptom reduction, and objective tumor response; three remain alive, and one experienced transient improvement. Complications, histologic subtypes, autopsy findings, stereotactic approach, thermal monitoring methods and CT follow-up of objective response are presented along with computer dosimetry and isotherm chart. Our microtraumatic universal catheter technique for CT guided stereotactic biopsy, aspiration, decompression, thermal sensory loop, thermalization antennae, and brachytherapy without multiple trauma nor changing catheters is stressed. The rationale for combined modes peculiar to the CNS will be outlined.2+ Proposal for incorporating controlled-release ARA-C chemotherapy polymer micro-rods into the interstitial format will be offered

  14. High beta and electron dose from 192Ir: implications for 'gamma' intravascular brachytherapy

    International Nuclear Information System (INIS)

    Purpose: Trains of multiple 192Ir seeds are used in many clinical trials for intravascular brachytherapy. 192Ir source is commonly considered as a gamma emitter, despite the understanding that this radionuclide also emits a wide range of electron and beta energies, with a similar range of energy. The high dose from betas and electrons in the submillimeter range due to unsealed ends of seed sources should be precisely quantified to fully understand the backdrop for complications associated with 192Ir coronary artery brachytherapy. Methods and Materials: Monte Carlo simulations (MCNP4C code) were performed for a model 5-seed 192Ir train used in SCRIPPS, GAMMA, and the Washington Radiation for In-Stent Restenosis (WRIST) randomized clinical trials. A stack of radiochromic films was also used to measure the dose distributions for an actual 6-seed train. Results: In the submillimeter range very close to the source, Monte Carlo results show that betas and electrons deposit a higher dose than 192Ir photons (gamma and X-rays) over the interseed gap. A high luminal dose from the combined effects of betas, electrons, and photons emitted from 192Ir can be deposited, particularly between seeds. When prescribing 15 Gy at 2 mm, the combined dose can be as high as 160 Gy at 0.5 mm. Different peak doses near the interseed gaps were noted, which may be due to variability of seed-end surfaces and nonuniformity of seed activity within a real multiseed train. Dose-volume histograms (DVH) of lumen surfaces were evaluated for an eccentric seed train. The DVH parameters indicating the extent of hot spots in the lumen wall, DV10, DV5, DV2, and DV1 (dose received by 10, 5, 2, 1% respectively of the total lumen surface), can be as high as 55, 76, 81, and 155 Gy for a lumen with 3-mm diameter, and 75, 80, 110, and 158 Gy for a narrow 2-mm lumen. Conclusion: 192Ir multiple seed trains used in the SCRIPPS, GAMMA, and WRIST trials can deposit a very high dose to the luminal wall. A particularly

  15. Treatment of cultured glioma cells with the EGFR-TKI gefitinib (''Iressa'', ZD1839) increases the uptake of astatinated EGF despite the absence of gefitinib-mediated growth inhibition

    International Nuclear Information System (INIS)

    The EGFR-TKI (epidermal growth factor receptor tyrosine kinase inhibitor) gefitinib (''Iressa'', ZD1839), a reversible growth inhibitor of EGFR-expressing tumour cells, has been shown to enhance the antitumour effect of ionising radiation, and also to increase the uptake of radioiodinated EGF. Thus, combination of gefitinib treatment and radionuclide targeting is an interesting option for therapy of brain tumours that are difficult to treat with conventional methods. The aim of this study was to evaluate how pre-treatment with gefitinib affects binding of astatinated EGF (211At-EGF) to cultured glioma U343 cells, which express high levels of EGFR. The growth of U343 cells in the presence of gefitinib was investigated, and it was found that gefitinib does not significantly inhibit the growth of these cells. Nevertheless, the uptake of 211At-EGF in U343 cells was markedly increased (up to 3.5 times) in cells pre-treated with gefitinib (1 μM). This indicates that a combination of gefitinib treatment and radionuclide targeting to EGFR might be a useful therapeutic modality, even for patients who do not respond to treatment with gefitinib alone. (orig.)

  16. Comparative observations on intersitial treatment of lower lip carcinoma with radium226 and iridium192

    International Nuclear Information System (INIS)

    Three methods of interstitial radiotherapy of lower lip carcinoma were compared. The material included 155 patients treated with radium by the method of vertical application of Ra226 needles, 445 patients with treatment by the method of transverse application of Ra226 needles and 35 patients treated by the after-loading with iridium192. As comparative criteria the authors accepted: the frequency of recurrences, the duration of radiation-induced reaction, the frequency of necrosis and the cosmetic effect after treatment. In Ra226 treatment after vertical application recurrences developed in 6 out of 155 patients (4%), after translowing iridium192 application no recurrences of neoplasm were observed in any out of 35 cases. Immediate post-radiation reactions lasted on the average 5.8; 6.4; and 7.7 weeks with these 3 methods respectively. Necrosis developed in 6 out of 155 cases (4%) after vertical application, in 23 out of 445 cases (5.2%) after transverse application and in 4 out of 35 cases (11%) after iridium192 application. The best cosmetic effects were obtained with iridium192 with 34.6% of very good results, 65.4% of good results and 0% of scars. The method of interstitial treatment with iridium192 by the after-loading technique provides a better protection of personnel against irradiation as compared with other methods of radium226 treatment. (author)

  17. Comparison of two different methods to determine the air kerma calibration factor (NK) for 192Ir

    International Nuclear Information System (INIS)

    In brachytherapy, encapsulated radioactive Low Dose Rate (LDR) and High Dose Rate (HDR) sources are used to deliver a dose to tissue near the source. One of the nuclides used in LDR as well as in HDR brachytherapy sources is 192Ir. In document IAEA-TECDOC-1079, Calibration of Brachytherapy Sources, recommendations on standardized procedures for the calibration of brachytherapy sources at SSDLs and hospitals are given. One of these recommendations is the use of an ionisation chamber with an air-kerma calibration factor for 192lr sources. The problem to derive a calibration factor for 192Ir is that the most important part of the spectrum of an 192lr brachytherapy source falls in an energy gap between the standards for x-rays and the standards for gamma-rays established at primary laboratories. It is therefore unavoidable to obtain the air kerma calibration for the ionisation chamber using an indirect method. The method recommended by IAEA for the determination of the air-kerma calibration factors is based on a technique developed by Goetsch et al. In the Netherlands a different method is recommended. This method is based on a weighting procedure of the 192Ir energy spectrum over the response curve of an ionisation chamber and differs with the procedure recommended by IAEA for a NE2561 ionisation chamber by about 0.9 %

  18. Serum Cytokeratin 19 Fragment, CK19-2G2, as a Newly Identified Biomarker for Lung Cancer

    OpenAIRE

    Gao, Jia; Lv, Fang; Li, Jia; Wu, Zongyong; Qi, Jun

    2014-01-01

    Background CK19-2G2, a new fragment of cytokeratin 19, is a potential tumor marker for diagnosing lung cancer. The preoperative level of serum CK19-2G2 has been demonstrated to be associated with tumor metastasis and survival of breast cancer patients. This study investigated the postoperative dynamic changes in serum CK19-2G2 levels and its clinical significance in lung cancer patients. Materials and Methods Preoperative serum CK19-2G2 levels were measured in 630 lung cancer patients and wer...

  19. Evaluation and test of 192Ir air kerma strength for afterloading systems

    International Nuclear Information System (INIS)

    Objective: To study the method of measuring air kerma strength of afterloading units with 192Ir source by using well type ionization chamber. Methods: The air kerma strength of 30 afterloading units with 192Ir source was measured using 2000A electrometer and 1000 plus well type ionization chamber, and apparent activity of the source was calculated with the air kerma strength and apparent activity conversion factor. The measured activity of the source was compared with the original value of the source provided by the manufacturer, and the relevant deviation should be within ±5%. Results: The air kerma strength of afterloading units with 192Ir sources was tested. The relevant deviation of the measured activity and the original value was within -0.1%-4.4%. Conclusions: The measurement method with a well type ionization chamber is convenient and highly accurate which can be used for the test of quality control in hospitals. (authors)

  20. Safety of 125iodine and 192iridium implants to the canine carotid artery: preliminary report

    International Nuclear Information System (INIS)

    Thirty-nine healthy dogs underwent a simulated radical neck dissection followed by implantation of either 125Iodine or 192Iridium in various dose regimes randomized prospectively from 3,000 to 30,000 rad. Bilateral selective carotid angiography was performed immediately postoperatively and at six months and one year. No significant effects occurred to the animals who received 15,000 rad 125I or 6,000 rad 192Ir. In the higher dosed animals the 125I treated group fared better than the 192Ir treated group, probably due to the lower dose rate delivery. All surviving animals will be maintained an additional year to determine the late effects of brachytherapy irradiation to the carotid artery

  1. Development of automatic system for reducing of occupational exposure dose in Ir-192 radiography

    Energy Technology Data Exchange (ETDEWEB)

    Joo, G. T.; Song, J. H.; Shin, J. S.; Kim, D. E. [Korea Industrial Testing Company, Seoul (Korea, Republic of)

    2003-07-01

    Using Ir-192 gamma source for radiography, it is difficult to reduce occupational exposure and to do quantitative quality control because radiographic test is almost hand-operated and is not improved for a long time in domestic. In this study, a controller with BLDC motor of 24V, 200W which has output of 54 kgf{center_dot}cm and one-chip microprocessor which can control of speed, position and exposure time of Ir-192 gamma source, a remote controller with RF module and a automatic radiation alarm monitor device have been developed. The developed system is predicted that the unit can be in many practical applications with benefits in economical advantage. Also, occupational exposure will be reduced because of remote controller of developed automatic system for Ir-192 radiographic test.

  2. Development of automatic system for reducing of occupational exposure dose in Ir-192 radiography

    International Nuclear Information System (INIS)

    Using Ir-192 gamma source for radiography, it is difficult to reduce occupational exposure and to do quantitative quality control because radiographic test is almost hand-operated and is not improved for a long time in domestic. In this study, a controller with BLDC motor of 24V, 200W which has output of 54 kgf·cm and one-chip microprocessor which can control of speed, position and exposure time of Ir-192 gamma source, a remote controller with RF module and a automatic radiation alarm monitor device have been developed. The developed system is predicted that the unit can be in many practical applications with benefits in economical advantage. Also, occupational exposure will be reduced because of remote controller of developed automatic system for Ir-192 radiographic test

  3. Comparison of 60Cobalt and 192Iridium sources in high dose rate afterloading brachytherapy

    International Nuclear Information System (INIS)

    Purpose: 60Co sources with dimensions identical to those of 192Ir have recently been made available in clinical brachytherapy. A longer half time reduces demands on logistics and quality assurance and perhaps costs. Material and Methods: Comparison of the physical properties of 60Co and 192Ir with regard to brachytherapy. Results: Required activities for the same air kerma rate are lower by a factor of 2.8 for 60Co. Differential absorption in tissues of different densities can be neglected. Monte Carlo calculations demonstrate that integral dose due to radial dose fall off is higher for 192Ir in comparison to 60Co within the first 22 cm from the source (normalization at 1 cm). At larger distances this relationship is reversed. Conclusion: Clinical examples for intracavitary and interstitial applications however, show practically identical dose distributions in the treatment volume. (orig.)

  4. Down-regulation of miR-192-5p protects from oxidative stress-induced acute liver injury.

    Science.gov (United States)

    Roy, Sanchari; Benz, Fabian; Alder, Jan; Bantel, Heike; Janssen, Joern; Vucur, Mihael; Gautheron, Jeremie; Schneider, Anne; Schüller, Florian; Loosen, Sven; Luedde, Mark; Koch, Alexander; Tacke, Frank; Luedde, Tom; Trautwein, Christian; Roderburg, Christoph

    2016-07-01

    miR-192-5p has gained increasing relevance in various diseases, however, its function in acute liver injury is currently unknown. We analysed miR-192-5p serum levels and hepatic miR-192-5p expression in mice after hepatic ischaemia and reperfusion (I/R) as well as in toxic liver injury. On a functional level, miRNA levels were analysed in the different hepatic cell-compartments and in the context of tumour necrosis factor (TNF)-dependent liver cell death. We detected increased serum levels of miR-192-5p after hepatic I/R- and carbon tetrachloride (CCl4)-induced liver injury. miR-192-5p levels correlated with the degree of liver damage and the presence of hepatic cell death detected by TUNEL stainings (terminal deoxynucleotidyltransferase-mediated dUTP biotin nick-end labelling stainings). Moreover, expression of miR-192-5p was increased in a hypoxia/reoxygenation (H/R) model of in vitro hepatocyte injury, supporting that the passive release of miR-192-5p represents a surrogate for hepatocyte death in liver injury. In critically ill patients, miR-192-5p levels were elevated selectively in patients with liver injury and closely correlated with the presence of hepatic injury. In contrast with up-regulated miR-192-5p in the serum, we detected a down-regulation of miR-192-5p in both injured mouse and human livers. Deregulation of miR-192-5p in livers was dependent on stimulation with TNF. Functional experiments confirmed a protective effect of down-regulation of miR-192-5p in hepatocytes, suggesting a role of miR-192-5p in limiting liver injury. Finally, we identified Zeb2, an important regulator of cell death, as a potential target gene mediating the function of miR-192-5p Our data suggest that miR-192-5p is involved in the regulation of liver cell death during acute liver injury and might represent a potent marker of hepatic injury. PMID:27129188

  5. Evaluation of a lithium formate EPR dosimetry system for dose measurements around Ir-192 brachytherapy sources

    OpenAIRE

    Antonovic, Laura; Gustafsson, Håkan; Alm Carlsson, Gudrun; Carlsson Tedgren, Åsa

    2009-01-01

    A dosimetry system using lithium formate monohydrate (HCO2Li center dot H2O) as detector material and electron paramagnetic resonance (EPR) spectroscopy for readout has been used to measure absorbed dose distributions around clinical Ir-192 sources. Cylindrical tablets with diameter of 4.5 mm, height of 4.8 mm, and density of 1.26 g/cm(3) were manufactured. Homogeneity test and calibration of the dosimeters were performed in a 6 MV photon beam. Ir-192 irradiations were performed in a PMMA pha...

  6. Lifetime measurements of yrast and excited superdeformed bands in 192,193Hg

    International Nuclear Information System (INIS)

    Quadrupole moments of the six known superdeformed (SD) bands of 193Hg and the yrast SD band of 192Hg have been determined by a Doppler-shift-attenuation-method measurement utilizing the gammasphere array. The quadrupole moments of all 193Hg SD bands were found to be similar, suggesting the active single-particle orbitals in the mass-190 region exhibit only small shape-driving effects. Additionally, there is evidence for an unexpected difference in the quadrupole moments of SD bands in 192Hg and 193Hg. copyright 1998 The American Physical Society

  7. In vivo dosimetry thermoluminescence dosimeters during brachytherapy with a 370 GBq {sup 192}Ir source

    Energy Technology Data Exchange (ETDEWEB)

    Cuepers, S.; Piessens, M.; Verbeke, L.; Roelstraete, A. [Onze-Lieve-Vrouw Hospitaal, Aalst (Belgium). Dept. of Radiotherapy and Oncology

    1995-12-01

    When using LiF thermoluminescence dosimeters in brachytherapy, we have to take into account the properties of a high dose rate {sup 192}Ir source (energy spectrum ranging form 9 to 885 keV, steep dose gradient in the vicinity of the source) and these of the dosimeters themselves (supralinearity, reproducibility, size). All these characteristics combine into a set of correction factors which have been determined during in phantom measurements. These results have then been used to measure the dose delivered to organs at risk (e.g. rectum, bladder, etc.) during high dose rate brachytherapy with a 370 GBq {sup 192}Ir source for patients with gynaecological tumors.

  8. Magnetic hyperfine interaction of the 2/sup +/ rotational states in muonic /sup 190,192/Os

    CERN Document Server

    Link, R; Engfer, R; Kankeleit, E; Michaelsen, R; Schellenberg, L; Schneuwly, H; Schröder, W U; Vuilleumier, J L; Walter, H K; Zehnder, A

    1972-01-01

    In muonic /sup 190,192/Os the magnetic hf-splitting of the 2/sup +/ to 0/sup +/ nuclear transition was measured. The hf-splittings Delta E (/sup 190/Os)=665+or-80 eV and Delta E(/sup 192/Os)=800+or-80 eV of the 2/sup +/ state are reduced to 59% compared to a point-like magnetic moment in agreement with the assumption of a magnetization density distribution proportional to R/sup 2/ rho /sub charge/(R) as calculated from a rigid rotator. The influence of these results on the analysis of muonic isomer shifts is pointed out. (11 refs).

  9. Study and development of an Iridium-192 seed for use in ophthalmic cancer; Estudo e desenvolvimento de uma semente de iridio-192 para aplicacao em cancer oftalmico

    Energy Technology Data Exchange (ETDEWEB)

    Mattos, Fabio Rodrigues de

    2013-07-01

    Even ocular tumors are not among the cases with a higher incidence, they affect the population, especially children. The Institute of Energy and Nuclear Research (IPEN-CNEN/SP) in partnership with Escola Paulista de Medicina (UNIFESP), created a project to develop and implement a alternative treatment for ophthalmic cancer that use brachytherapy iridium-192 seeds. The project arose by reason of the Escola Paulista treat many cancer cases within the Unified Health System (SUS) and the research experience of sealed radioactive sources group at IPEN. The methodology was developed from the available infrastructure and the experience of researchers. The prototype seed presents with a core (192-iridium alloy of iridium-platinum) of 3.0 mm long sealed by a capsule of titanium of 0.8 mm outside diameter, 0.05 mm wall thickness and 4,5mm long. This work aims to study and develop a seed of iridium-192 from a platinum-iridium alloy. No study on the fabrication of these seeds was found in available literature. It was created a methodology that involved: characterization of the material used in the core, creation of device for neutron activation irradiation and and seed sealing tests. As a result, proved the feasibility of the method. As a suggestion for future work, studies regarding metrology and dosimetry of these sources and improvement of the methodology should be carried out, for future implementation in national scope. (author)

  10. 41 CFR 102-192.150 - What are your general responsibilities as a program level mail manager?

    Science.gov (United States)

    2010-07-01

    ... responsibilities as a program level mail manager? 102-192.150 Section 102-192.150 Public Contracts and Property... general responsibilities as a program level mail manager? Your responsibilities at the program level... and effective procedures are used; (g) Providing mail training opportunities to your program...

  11. 40 CFR 436.192 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Effluent limitations guidelines... technology currently available. 436.192 Section 436.192 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MINERAL MINING AND PROCESSING POINT SOURCE...

  12. 49 CFR 192.929 - What are the requirements for using Direct Assessment for Stress Corrosion Cracking (SCCDA)?

    Science.gov (United States)

    2010-10-01

    ... requirements for using Direct Assessment for Stress Corrosion Cracking (SCCDA)? (a) Definition. Stress... Assessment for Stress Corrosion Cracking (SCCDA)? 192.929 Section 192.929 Transportation Other Regulations... operator using direct assessment as an integrity assessment method to address stress corrosion cracking...

  13. 41 CFR 102-192.65 - What features must our finance systems have to keep track of mail costs?

    Science.gov (United States)

    2010-07-01

    ... finance systems have to keep track of mail costs? 102-192.65 Section 102-192.65 Public Contracts and... What features must our finance systems have to keep track of mail costs? All agencies must have an... requirement, because the level at which it is cost-beneficial differs widely. The agency's finance...

  14. 41 CFR 102-192.45 - How can we request a deviation from these requirements, and who can approve it?

    Science.gov (United States)

    2010-07-01

    ... and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT Introduction to this Part § 102-192.45 How can we... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false How can we request...

  15. 49 CFR 192.917 - How does an operator identify potential threats to pipeline integrity and use the threat...

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false How does an operator identify potential threats to pipeline integrity and use the threat identification in its integrity program? 192.917 Section 192.917....917 How does an operator identify potential threats to pipeline integrity and use the...

  16. 49 CFR 192.731 - Compressor stations: Inspection and testing of relief devices.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Compressor stations: Inspection and testing of... Maintenance § 192.731 Compressor stations: Inspection and testing of relief devices. (a) Except for rupture discs, each pressure relieving device in a compressor station must be inspected and tested in...

  17. 49 CFR 192.735 - Compressor stations: Storage of combustible materials.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Compressor stations: Storage of combustible... § 192.735 Compressor stations: Storage of combustible materials. (a) Flammable or combustible materials in quantities beyond those required for everyday use, or other than those normally used in...

  18. 49 CFR 192.285 - Plastic pipe: Qualifying persons to make joints.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Plastic pipe: Qualifying persons to make joints... Materials Other Than by Welding § 192.285 Plastic pipe: Qualifying persons to make joints. (a) No person may make a plastic pipe joint unless that person has been qualified under the applicable joining...

  19. 49 CFR Appendix C to Part 192 - Qualification of Welders for Low Stress Level Pipe

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Qualification of Welders for Low Stress Level Pipe.... C Appendix C to Part 192—Qualification of Welders for Low Stress Level Pipe I. Basic test. The test is made on pipe 12 inches (305 millimeters) or less in diameter. The test weld must be made with...

  20. 49 CFR 192.620 - Alternative maximum allowable operating pressure for certain steel pipelines.

    Science.gov (United States)

    2010-10-01

    ... (SCADA) system, other leak detection system, or an alternative method of control. (iii) Remote valve... design requirements in § 192.112; (3) A supervisory control and data acquisition system provides remote... pressure upstream and downstream. (iv) A line break valve control system using differential pressure,...

  1. Audit on source strength determination for HDR and PDR 192Ir brachytherapy in Sweden

    International Nuclear Information System (INIS)

    Background and purpose: To investigate the status of source strength determination in terms of reference air kerma rate (RAKR) for HDR and PDR 192Ir brachytherapy in Sweden. Materials and methods: RAKR was determined in each of the 14 Swedish afterloaders, using calibrated equipment from the Swedish Secondary Standard Dosimetry Laboratory. Results: Values of RAKR from the external audit, the hospitals and vendors agreed within the uncertainty limits guaranteed by the vendors. Conclusions: The accuracy in RAKR determination has increased over the last years as a result of increased availability of interpolation standards for HDR 192Ir and the increased use of robust well-type ion chambers designed for brachytherapy. It is recommended to establish a ratio between the RAKR value from own measurements at the hospital and that of the vendor since such a ratio embeds constant systematic differences due to e.g. varying traceability and therefore has the potential of being less uncertain than the RAKR alone. Traceability to primary standards for HDR 192Ir sources will in the future significantly decrease the uncertainty in RAKR of 192Ir brachytherapy

  2. Tumor dose enhancement by nanoparticles during high dose rate 192 Ir brachytherapy

    Directory of Open Access Journals (Sweden)

    Mansour Zabihzadeh

    2015-01-01

    Conclusion: Injecting of high-Z gold NPs into tumor increases the absorbed dose of tumor irradiated with 192 Ir HDR brachytherapy source. Size, geometry, concentration, and distribution model of NPs and tumor depth are crucial factors to accurately estimate the DEF.

  3. Determination of the Fricke G value for HDR 192Ir sources using ionometric measurements

    International Nuclear Information System (INIS)

    High Dose Rate (HDR) brachytherapy using 192Ir is widely accepted as an important treatment option, and it thus requires an accurate dosimetry standard. However, a dosimetry standard for the direct measurement of absolute dose to water is currently not available. The dose to water conversion is calculated via the dose rate constant Λ and several correction factors accounting for the scatter, attenuation, and anisotropy of the dose distribution, among other effects. Two potentially useful procedures have been reported, including one by Sarfehnia et al. [3,4], which used a water-based calorimeter with an uncertainty of 1.9% for k=1, and a second by Austerlitz et al. and de Almeida et al., which used Fricke dosimetry with estimated uncertainties of 3.9% for k=1 and 1.4% for k=1, respectively. Chemical dosimetry using a standard FeSO4 solution has shown potential to be a reliable standard of absorbed dose for the HDR 192Ir source. A major uncertainty is associated with the G values reported by Fregene, which had a numerical value of 1.1 %. However, that reference provided very little detail of the experimental procedures for the 192Ir source. The G value may be obtained by using a calorimeter or ionometric measurements. In the absence of calorimetric data, this paper makes an attempt to measure the G value for the HDR 192Ir sources using ionometric measurements and recommendations from dosimetry protocols. (author)

  4. 49 CFR 192.355 - Customer meters and regulators: Protection from damage.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Customer meters and regulators: Protection from... SAFETY TRANSPORTATION OF NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Customer Meters, Service Regulators, and Service Lines § 192.355 Customer meters and regulators: Protection...

  5. Determination of the Fricke G value for HDR {sup 192}Ir sources using ionometric measurements

    Energy Technology Data Exchange (ETDEWEB)

    Franco, L.; Coelho, M.; Almeida, C.E. de [Universidade do Estado do Rio de Janeiro (UERJ), RJ (Brazil). Lab. de Ciencias Radiologicas; Gavazza, S. [Instituto Militar de Engenharia (IME), Rio de Janeiro, RJ (Brazil)

    2011-07-01

    High Dose Rate (HDR) brachytherapy using {sup 192}Ir is widely accepted as an important treatment option, and it thus requires an accurate dosimetry standard. However, a dosimetry standard for the direct measurement of absolute dose to water is currently not available. The dose to water conversion is calculated via the dose rate constant {Lambda} and several correction factors accounting for the scatter, attenuation, and anisotropy of the dose distribution, among other effects. Two potentially useful procedures have been reported, including one by Sarfehnia et al. [3,4], which used a water-based calorimeter with an uncertainty of 1.9% for k=1, and a second by Austerlitz et al. and de Almeida et al., which used Fricke dosimetry with estimated uncertainties of 3.9% for k=1 and 1.4% for k=1, respectively. Chemical dosimetry using a standard FeSO{sub 4} solution has shown potential to be a reliable standard of absorbed dose for the HDR {sup 192}Ir source. A major uncertainty is associated with the G values reported by Fregene, which had a numerical value of 1.1 %. However, that reference provided very little detail of the experimental procedures for the {sup 192}Ir source. The G value may be obtained by using a calorimeter or ionometric measurements. In the absence of calorimetric data, this paper makes an attempt to measure the G value for the HDR {sup 192}Ir sources using ionometric measurements and recommendations from dosimetry protocols. (author)

  6. Studies on 192Ir afterloading irradiation of the canine prostate with special consideration of thermoluminescent dosimetry

    International Nuclear Information System (INIS)

    A method for high dose rate afterloading irradiation of the prostate with iridium 192 was developed. The isodoses of the urethra and rectum, which were measured by means of thermoluminescent dosimetry, showed deviations from the doses pre-calculated by computer (BRACHY), because this calculation is based on an anatomically ideal condition. (MBC)

  7. 38 CFR 21.192 - “Independent living program” status.

    Science.gov (United States)

    2010-07-01

    ... 38 U.S.C. Chapter 31 Case Status § 21.192 “Independent living program” status. (a) Purpose. The independent living program status serves to: (1) Identify veterans who are being furnished a program of... timely manner. (b) Assignment to independent living program status. A veteran may be assigned...

  8. Yeast Interacting Proteins Database: YNL189W, YGR192C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YNL189W SRP1 Karyopherin alpha homolog, forms a dimer with karyopherin beta Kap95p to mediate im ... his bait as prey (0) YGR192C TDH3 Glyceraldehyde-3-phosphate ... dehydrogenase, isozyme 3, involved in glycolysis a ... er that catalyzes the reaction of glyceraldehyde-3-phosphate ... to 1,3 bis-phosphoglycerate; detected in the cytop ...

  9. Calibration of well-type chambers in Brazil using 192Ir HDR sources

    International Nuclear Information System (INIS)

    The results obtained by performing of a traceable calibration service for well-type reentrant ionization chamber for HDR 192Ir sources used in brachytherapy physical procedures at the Laboratorio de Ciencias Radiologicas from Universidade do Estado do Rio de Janeiro -LCR/UERJ are described. (author)

  10. Serum cytokeratin 19 fragment, CK19-2G2, as a newly identified biomarker for lung cancer.

    Directory of Open Access Journals (Sweden)

    Jia Gao

    Full Text Available CK19-2G2, a new fragment of cytokeratin 19, is a potential tumor marker for diagnosing lung cancer. The preoperative level of serum CK19-2G2 has been demonstrated to be associated with tumor metastasis and survival of breast cancer patients. This study investigated the postoperative dynamic changes in serum CK19-2G2 levels and its clinical significance in lung cancer patients.Preoperative serum CK19-2G2 levels were measured in 630 lung cancer patients and were compared with individuals with benign pulmonary diseases (n = 134 and healthy volunteers (n = 263. In 352 cases, the patients underwent surgery. In these patients, in addition to preoperative assays, serum CK19-2G2 was also monitored at 1 week and 1 month after the operation.The preoperative baseline levels of serum CK19-2G2 was significantly higher in lung cancer patients than patients with benign diseases and healthy controls (P<0.001. The postoperative levels of CK19-2G2 declined significantly within 1 week after tumor resection. Hereafter, a further decrease was observed in the patients who underwent palliative operations, while for the patients in the radical resection group, their CK19-2G2 levels stabilized.CK19-2G2 may be a candidate marker for diagnosing and monitoring a patient's response to lung cancer treatment. In addition, CK19-2G2 may be an indicator for micrometastases in lung cancer patients.

  11. Production of 198Au and 192Ir sources for cancer therapy

    International Nuclear Information System (INIS)

    Radiation sources of 198Au and 192Ir in various types have been developed for cancer therapy, which are '198Au grains' and 'hairpin, single pin, thin wire, seed and seed assembly of 192Ir'. The products are being supplied to a number of cancer clinics in Japan. As target materials, gold metal and iridium/platinum alloy were used; iridium/platinum alloy gives flexibility to products and reduces pains in the patients. Grains and wires of the target materials were of platinum covered, and irradiated in the JRR-2 or JRR-4 reactor. The platinum cover absorbs the β rays of 198Au and 192Ir, which are not effective for cancer therapy. The neutron irradiation conditions were controlled to produce the following radioactivities: The 198Au grains are 185 MBq each at the time to be used in clinics, the 192Ir source radioactivities were, assayed at the time of shipment, 740 MBq each for the hairpin, 370 MBq for the single pin, 37 MBq for the seed, a radioactivity equivalent to 37 MBq multiplied by the number of seeds loaded for the seed assembly, and 148 MBq, 222 MBq or 370 MBq for the thin wire. There has been confirmed neither significant contamination of other radioactivities nor ununiformity of the radioactivity in the wire source. The radioactivities of products have been kept within ± 5% of an averaged value, except for the seed. For producing the seed assemblies, neutron irradiated seed and spacer teflon wires are loaded one by one into a teflon tube. This loading process and the measurement of radioactivities were automated to meet increased demands. In fiscal year 1989, the 198Au grains were produced in 48 batches and 2570 pieces were shipped and the 192Ir sources were produced in 39 batches and 4852 pieces were delivered, meeting all domestic demands. Being accompanied with the documents related to the production process, the present report is also usable as a production manual. (author)

  12. Calibration procedure for thermoluminescent dosemeters in water absorbed doses for Iridium-192 high dose rate sources

    International Nuclear Information System (INIS)

    Thermoluminescent dosimeters are used in brachytherapy services quality assurance programs, with the aim of guaranteeing the correct radiation dose supplied to cancer patients, as well as with the purpose of evaluating new clinical procedures. This work describes a methodology for thermoluminescent dosimeters calibration in terms of absorbed dose to water for 192Ir high dose rate sources. The reference dose used is measured with an ionization chamber previously calibrated for 192Ir energy quality, applying the methodology proposed by Toelli. This methodology aims to standardizing the procedure, in a similar form to that used for external radiotherapy. The work evolves the adaptation of the TRS-277 Code of the International Atomic Energy Agency, for small and big cavities, through the introduction for non-uniform experimental factor, for the absorbed dose in the neighborhood of small brachytherapy sources. In order to simulate a water medium around the source during the experimental work, an acrylic phantom was used. It guarantees the reproducibility of the ionization chamber and the thermoluminescent dosimeter's location in relation to the radiation source. The values obtained with the ionization chamber and the thermoluminescent dosimeters, exposed to a 192Ir high dose rate source, were compared and correction factors for different source-detector distances were determined for the thermoluminescent dosimeters. A numeric function was generated relating the correction factors and the source-detector distance. These correction factors are in fact the thermoluminescent dosimeter calibration factors for the 192Ir source considered. As a possible application of this calibration methodology for thermoluminescent dosimeters, a practical range of source-detector distances is proposed for quality control of 192Ir high dose rate sources. (author)

  13. Role of afterloading iridium (Ir192) implant in the management of carcinoma of the tongue

    International Nuclear Information System (INIS)

    A total of 86 patients with carcinoma of the tongue were treated between May 1, 1974 and June, 1978, at the Los Angeles County-University of Southern California Medical Center and California Hospital Medical Center, Los Angeles, California. Fifty-five of these patients were treated for primary tumors and 31 of the 86 patients were re-irradiated with interstitial Ir192 implants for recurrent or persistent tumors after radical external irradiation and/or surgery. Primary treatment consisted of a combination of external irradiation and an interstitial after loading Ir192 implant. In the re-irradiation group, 4 of the 13 patients (30%) with lesions of the anterior two-thirds of the tongue and 8 of the 18 patients (44%) with lesions of the base of the tongue achieved local control. The follow-up period for all these patients was a minimum of 24 months complications of radiotherapy of the tongue are discussed

  14. Electric quadrupole interaction of 192Tl(8-) nuclei in hexagonal Tl and in tetragonal In metals

    International Nuclear Information System (INIS)

    The TDPAD technique has been used to measure the electric quadrupole coupling constants for the 192Tl(8-) isomer in hexagonal Tl at different temperatures and in tetragonal In at room temperature. The values measured were e2qQ/h = 24.0(15) MHz extrapolated to T = 0 K, and 33.1(16) MHz at 293 K for the Tl and In hosts, respectively. The electric field gradient for Tl impurities in In was determined from systematics of isoelectric systems, yielding /Q[192Tl(8-)1]/ = 0.44(7) b. The almost perfect symmetry of the Tl crystalline structure makes this metal a sensitive probe to current models for electric field gradients in metals. The magnitude and temperature dependence of the field gradient in thallium metal are discussed within the framework of such models. (author)

  15. PAX2 in 192 Chinese women with Müllerian duct abnormalities: mutation analysis.

    Science.gov (United States)

    Wang, Peng; Zhao, Han; Sun, Mei; Li, Yuan; Chen, Zi-Jiang

    2012-08-01

    The paired box gene 2 (PAX2) has been proven to be a crucial gene during organogenesis of the urogenital system in mice models. This study was aimed to explore the relationship between PAX2 mutations and human Müllerian duct abnormalities (MDA). A total of 192 Chinese MDA patients (15 cases of uterine aplasia and 177 of incomplete Müllerian fusion) and 192 ethnic-matched controls were recruited from 2009 to 2011. Coding regions of PAX2 of MDA cases were amplified and sequenced. One rare novel synonymous variant (c.320G>A) was discovered in one patient with uterus didelphys, whereas this variant was not found in the control group. Mutations in PAX2 may be not a common cause of MDA. PMID:22683154

  16. Response of an implantable MOSFET dosimeter to 192Ir HDR radiation.

    Science.gov (United States)

    Fagerstrom, Jessica M; Micka, John A; DeWerd, Larry A

    2008-12-01

    New in vivo dosimetry methods would be useful for clinical HDR brachytherapy. An implantable MOSFET Dose Verification System designed by Sicel Technologies, Inc. was examined for use with 192Ir HDR applications. This investigation demonstrated that varying the dose rate from 22 to 84 cGy/min did not change detector response. The detectors exhibited a higher sensitivity to 192Ir energies than 60Co energies. A nonlinear accumulated dose effect was characterized by three third-order polynomials fit to data from detectors placed at three different distances from the source. The detectors were found to have minimal rotational angular dependence. A strong longitudinal angular dependence was found when the detector's copper coil and electronics assembly were aligned between the MOSFETs and incident radiation. This orientation showed a 16% decrease in response relative to other orientations tested. PMID:19175130

  17. Response of an implantable MOSFET dosimeter to {sup 192}Ir HDR radiation

    Energy Technology Data Exchange (ETDEWEB)

    Fagerstrom, Jessica M.; Micka, John A.; DeWerd, Larry A. [Department of Medical Physics, University of Wisconsin-Madison, Madison, Wisconsin 53706 (United States)

    2008-12-15

    New in vivo dosimetry methods would be useful for clinical HDR brachytherapy. An implantable MOSFET Dose Verification System designed by Sicel Technologies, Inc. was examined for use with {sup 192}Ir HDR applications. This investigation demonstrated that varying the dose rate from 22 to 84 cGy/min did not change detector response. The detectors exhibited a higher sensitivity to {sup 192}Ir energies than {sup 60}Co energies. A nonlinear accumulated dose effect was characterized by three third-order polynomials fit to data from detectors placed at three different distances from the source. The detectors were found to have minimal rotational angular dependence. A strong longitudinal angular dependence was found when the detector's copper coil and electronics assembly were aligned between the MOSFETs and incident radiation. This orientation showed a 16% decrease in response relative to other orientations tested.

  18. Development of an Iridium-192 seed for use in ophthalmic brachytherapy

    Energy Technology Data Exchange (ETDEWEB)

    Mattos, Fabio R.; Rostelato, Maria Elisa C.M.; Zeituni, Carlos; Moura, Joao A.; Costa, Osvaldo L.; Feher, Anselmo; Moura, Eduardo S.; Souza, Carla D.; Peleias Junior, Fernando S., E-mail: frmattos@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    The Institute for Energy and Nuclear Research (IPEN), in partnership with the School or Medicine (UNIFESP), created a project that aims to develop and implement an ophthalmic therapeutic treatment for cancer with Iridium-192 seeds. The School of Medicine treats many cancer cases in the SUS (Brazilian Public Health System), and brachytherapy group of IPEN has extensive experience in prototype sources. The seed to be manufactured will perform as follows: a core of Iridium-192 is packaged inside small cylindrical seeds consist of a titanium capsule of 0.8 mm outer diameter, 0.05 mm wall thickness and 4 5 mm in length. The core is an alloy of platinum-iridium (20/80) of 3.0 mm in length and 0.3 mm in diameter. Material analysis, neutron activation and activity measurements were carried out. (author)

  19. Dosimetric calculations and measurements of gold plaque ophthalmic irradiators using iridium-192 and iodine-125 seeds

    International Nuclear Information System (INIS)

    The dosimetry of ophthalmic plaques designed to hold iridium-192 or iodine-125 seeds is investigated experimentally and by means of a computer model. A phantom for thermoluminescent dosimetry (TLD) which permits measurements to within 2 mm of the plaque surface is described. TLD data are compared with model calculations that take into account the active length of the seeds, anisotropy of dose distribution from single seeds, and scatter within the phantom. An isotropic point source calculational model is accurate for clinical calculations, particularly at depths greater than 5 mm. Relative central axis dose measurements for 125I in a gold plaque are also in agreement with the model. Comparisons of 192Ir, 125I and 60Co plaques are presented. The relative advantages of using these isotopes in eye plaques are discussed

  20. Enhancement and validation of Geant4 Brachytherapy application on clinical HDR 192Ir source

    International Nuclear Information System (INIS)

    The Geant4 Monte Carlo MC associated Brachytherapy example was adapted, enhanced and several analysis techniques have been developed. The simulation studies the isodose distribution of the total, primary and scattered doses around a Nucletron microSelectron 192Ir source. Different phantom materials were used (water, tissue and bone) and the calculation was conducted at various depths and planes. The work provides an early estimate of the required number of primary events to ultimately achieve a given uncertainty at a given distance, in the otherwise CPU and time consuming clinical MC calculation. The adaptation of the Geant4 toolkit and the enhancements introduced to the code are all validated including the comprehensive decay of the 192Ir source, the materials used to build the geometry, the geometry itself and the calculated scatter to primary dose ratio. The simulation quantitatively illustrates that the scattered dose in the bone medium is larger than its value in water and tissue. As the distance away from the source increases, scatter contribution to dose becomes more significant as the primary dose decreases. The developed code could be viewed as a platform that contains detailed dose calculation model for clinical application of HDR 192Ir in Brachytherapy. - Highlights: • We enhanced and validated the Geant4 associated Brachytherapy code. • Primary and scattered doses from an actual 192Ir source are separated. • Different phantom materials are investigated. • The number of primary events to achieve a given uncertainty is provided. • A platform for detailed dose for clinical HDR Brachytherapy is established

  1. Evidence for an evolutionary relationship between the large adaptor nucleoporin Nup192 and karyopherins.

    Science.gov (United States)

    Stuwe, Tobias; Lin, Daniel H; Collins, Leslie N; Hurt, Ed; Hoelz, André

    2014-02-18

    Nucleocytoplasmic transport is facilitated by nuclear pore complexes (NPCs), which are massive proteinaceous transport channels embedded in the nuclear envelope. Nup192 is a major component of an adaptor nucleoporin subcomplex proposed to link the NPC coat with the central transport channel. Here, we present the structure of the ∼110-kDa N-terminal domain (NTD) of Nup192 at 2.7-Å resolution. The structure reveals an open ring-shaped architecture composed of Huntingtin, EF3, PP2A, and TOR1 (HEAT) and Armadillo (ARM) repeats. A comparison of different conformations indicates that the NTD consists of two rigid halves connected by a flexible hinge. Unexpectedly, the two halves of the ring are structurally related to karyopherin-α (Kap-α) and β-karyopherin family members. Biochemically, we identify a conserved patch that binds an unstructured segment in Nup53 and show that a C-terminal tail region binds to a putative helical fragment in Nic96. The Nup53 segment that binds Nup192 is a classical nuclear localization-like sequence that interacts with Kap-α in a mutually exclusive and mechanistically distinct manner. The disruption of the Nup53 and Nic96 binding sites in vivo yields growth and mRNA export defects, revealing their critical role in proper NPC function. Surprisingly, both interactions are dispensable for NPC localization, suggesting that Nup192 possesses another nucleoporin interaction partner. These data indicate that the structured domains in the adaptor nucleoporin complex are held together by peptide interactions that resemble those found in karyopherin•cargo complexes and support the proposal that the adaptor nucleoporins arose from ancestral karyopherins. PMID:24505056

  2. Radiation injury from acute exposure to an iridium-192 source: case history

    International Nuclear Information System (INIS)

    A 192Ir source became detached and fell from an industrial radiography camera. A labourer, not involved with radiation work and unaware of the hazard picked up the source and kept it in his hip packet for 2 hr. During this period, he received a skin dose of 13,000 rad and testes dose of 130 rad, the latter resulting in temporary sterility for a period of about 2 yr. (author)

  3. Spectrum of [gamma] rays connecting superdeformed and normal states in [sup 192]Hg

    Energy Technology Data Exchange (ETDEWEB)

    Henry, R.G.; Lauritsen, T.; Khoo, T.L.; Ahmad, I.; Carpenter, M.P.; Crowell, B.; Dossing, T.; Janssens, R.V.F.; Hannachi, F.; Korichi, A.; Schuck, C.; Azaiez, F.; Beausang, C.W.; Beraud, R.; Bourgeois, C.; Clark, R.M.; Deloncle, I.; Duprat, J.; Gall, B.; Hubel, H.; Joyce, M.J.; Kaci, M.; Lecoz, Y.; Meyer, M.; Paul, E.S.; Perrin, N.; Poffe, N.; Porquet, M.G.; Redon, N.; Sergolle, H.; Sharpey-Schafer, J.F.; Simpson, J.; Smith, A.G.; Wadsworth, R.; Willsau, P. (Argonne National Laboratory, Argonne, Illinois 60439 (United States) Centre de Spectrometrie Nucleaire et de Spectrometrie, Institut National de Physique Nucleaire et de Physiques des Particules, Centre National de la Recherche Scientifique, F-91405 Orsay (France) Institut de Physique Nucleaire, Institut National de Physique Nucleaire et de Physiques des Particules, Centre National de la Recherche Scientifique, F-91406 Orsay (France) University of Liverpool, Liverpool L69 3BX (United Kingdom) Institut de Physique Nucleaire Lyon, I

    1994-08-08

    The complete spectrum of [gamma] rays following the decay of superdeformed (SD) states in [sup 192]Hg has been extracted. The spectrum, which comprises a quasicontinuous component and sharp lines, reveals the decay mechanism and defines the excitation energies of the SD band. The decay of SD states results from the coupling between a cold, ordered SD system with a hot, chaotic one with normal deformation.

  4. Spectrum of γ rays connecting superdeformed and normal states in 192Hg

    International Nuclear Information System (INIS)

    The complete spectrum of γ rays following the decay of superdeformed (SD) states in 192Hg has been extracted. The spectrum, which comprises a quasicontinuous component and sharp lines, reveals the decay mechanism and defines the excitation energies of the SD band. The decay of SD states results from the coupling between a cold, ordered SD system with a hot, chaotic one with normal deformation

  5. Proposal of LDR Ir-192 Production in the TRIGA Mark II Research Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Karimzadeh, S.; Khan, R.; Boeck, H., E-mail: Sam.karimzadeh@ati.ac.a, E-mail: Nrustam@ati.ac.a, E-mail: Boeck@ati.ac.a [Institute of Atomic and Subatomic Physics (ATI), Vienna University of Technology (TU-Vienna) Stadionallee 2, 1020-Vienna (Austria)

    2011-07-01

    The TRIGA MARK II research reactor in Vienna provides some irradiation positions with different flux distribution. In this regard, a case study is under investigation to appraise the possibility of medical radioisotope production in Vienna. For this purpose, neutron flux mapping and the axial neutron flux distribution are calculated by MCNP5 for the TRIGA Mark II core. This paper describes the feasibility of Low Dose Rate (LDR) {sup 192}Ir production in the core of the low power research reactor. (author)

  6. Iridium-192 curietherapy for T1 and T2 epidermoid carcinomas of the floor of mouth

    International Nuclear Information System (INIS)

    From 1970 to 1986, 117 patients with T1 (47) or T2 (70) epidermoid carcinomas of the floor of the mouth (SCC) were treated by iridium-192 implantation (192 Ir). The dose was prescribed according to the Paris System and varied over those years. Follow-up information was available on 116 patients. There were 46 T1N0, 47 T2N0, and 23 T2N1-3. Neck management varied for the 93 N0 patients consisting of surveillance (24 T1, 17 T2) or elective neck dissection (22 T1:all pN-, 30 T2: 20 pN-, 10 pN+). Cause specific survival rates were 94% for T1N0, 61.5% for T2N0, and 28% for T2N1-3 at 5 years. Primary local control was 93.5%, 74.5%, and 65%, respectively, and 98%, 79%, and 65% after salvage. Patients with gingival extension or a tumor size over 3 cm (T2b) had a local control of 50% (9/18) and 58% (15/26), respectively. Nodal control was 93.5% for Stage I, 85% for Stage II, and 48% for T2N1-3 patients. There was no difference in nodal control with regard to treatment policy for Stage I-II patients. There were few complications including three deaths: two from surgery and one from 192 Ir. Nodal status, tumor size defined as T1, T2a (less than or equal to 3 cm), T2b (greater than 3 cm), and gingival extension were the only independent prognostic factors. The management of T1N0 and T2N0 SCC by 192 Ir to a dose of 65 or 70 Gy, using the Paris System, is recommended for lesions 3 cm or less and without gingival extension

  7. Proposal of LDR Ir-192 Production in the TRIGA Mark II Research Reactor

    International Nuclear Information System (INIS)

    The TRIGA MARK II research reactor in Vienna provides some irradiation positions with different flux distribution. In this regard, a case study is under investigation to appraise the possibility of medical radioisotope production in Vienna. For this purpose, neutron flux mapping and the axial neutron flux distribution are calculated by MCNP5 for the TRIGA Mark II core. This paper describes the feasibility of Low Dose Rate (LDR) 192Ir production in the core of the low power research reactor. (author)

  8. Determination of exit skin dose for 192Ir intracavitary accelerated partial breast irradiation with thermoluminescent dosimeters

    OpenAIRE

    Raffi, Julie A.; Stephen D. Davis; Hammer, Cliff G.; Micka, John A.; Kunugi, Keith A.; Musgrove, Jana E.; Winston, John W.; Ricci-Ott, Terresa J.; DeWerd, Larry A.

    2010-01-01

    Purpose: Intracavitary accelerated partial breast irradiation (APBI) has become a popular treatment for early stage breast cancer in recent years due to its shortened course of treatment and simplified treatment planning compared to traditional external beam breast conservation therapy. However, the exit dose to the skin is a major concern and can be a limiting factor for these treatments. Most treatment planning systems (TPSs) currently used for high dose-rate (HDR) 192Ir brachytherapy overe...

  9. 1979 Los Angeles accident: exposure to iridium 192 industrial radiographic source

    International Nuclear Information System (INIS)

    Eleven engineering plant employees were exposed to a 28-curie 192Ir industrial radiographic source that inadvertently had been left on the floor of the plant by a radiographer. One workman suffered a severe burn on his buttock, two workers developed radiation burns on their fingers, while acute anxiety and emotional disturbances were a prominent reaction of exposed individuals. Clinical observations, radiation dosimetry and depth-dose estimates, hematologic and cytogenetic studies are discussed for the exposed personnel

  10. Loss and recovery of an 192Ir gamma radiography exposure device

    International Nuclear Information System (INIS)

    A radiography exposure device containing 88.8 GBq (2.4 Ci) of 192Ir is inadvertently left in a taxi cab which has sped off before the equipment could be unloaded. The joint effort between the licensee and Philippine Nuclear Research Institute (PNRI) utilizing the tri-media in searching for the missing device resulted in its recovery 32 days later. The regulatory actions taken by the PNRI during and after the accident are discussed. (author). 3 refs

  11. Toward endobronchial Ir-192 high-dose-rate brachytherapy therapeutic optimization

    International Nuclear Information System (INIS)

    A number of patients with lung cancer receive either palliative or curative high-dose-rate (HDR) endobronchial brachytherapy. Up to a third of patients treated with endobronchial HDR die from hemoptysis. Rather than accept hemoptysis as an expected potential consequence of HDR, we have calculated the radial dose distribution for an Ir-192 HDR source, rigorously examined the dose and prescription points recommended by the American Brachytherapy Society (ABS), and performed a radiobiological-based analysis. The radial dose rate of a commercially available Ir-192 source was calculated with a Monte Carlo simulation. Based on the linear quadratic model, the estimated palliative, curative and blood vessel rupture radii from the center of an Ir-192 source were obtained for the ABS recommendations and a series of customized HDR prescriptions. The estimated radius at risk for blood vessel perforation for the ABS recommendations ranges from 7 to 9 mm. An optimized prescription may in some situations reduce this radius to 4 mm. The estimated blood perforation radius is generally smaller than the palliative radius. Optimized and individualized endobronchial HDR prescriptions are currently feasible based on our current understanding of tumor and normal tissue radiobiology. Individualized prescriptions could minimize complications such as fatal hemoptysis without sacrificing efficacy. Fiducial stents, HDR catheter centering or spacers and the use of CT imaging to better assess the relationship between the catheter and blood vessels promise to be useful strategies for increasing the therapeutic index of this treatment modality. Prospective trials employing treatment optimization algorithms are needed

  12. Toward endobronchial Ir-192 high-dose-rate brachytherapy therapeutic optimization

    Energy Technology Data Exchange (ETDEWEB)

    Gay, H A [Department of Radiation Oncology, Brody School of Medicine at East Carolina University, Greenville, NC (United States); Allison, R R [Department of Radiation Oncology, Brody School of Medicine at East Carolina University, Greenville, NC (United States); Downie, G H [Section of Pulmonary and Critical Care Medicine, Department of Internal Medicine, Brody School of Medicine at East Carolina University, Greenville, NC (United States); Mota, H C [Department of Radiation Oncology, Brody School of Medicine at East Carolina University, Greenville, NC (United States); Austerlitz, C [Department of Radiation Oncology, Brody School of Medicine at East Carolina University, Greenville, NC (United States); Jenkins, T [Department of Radiation Oncology, Brody School of Medicine at East Carolina University, Greenville, NC (United States); Sibata, C H [Department of Radiation Oncology, Brody School of Medicine at East Carolina University, Greenville, NC (United States)

    2007-06-07

    A number of patients with lung cancer receive either palliative or curative high-dose-rate (HDR) endobronchial brachytherapy. Up to a third of patients treated with endobronchial HDR die from hemoptysis. Rather than accept hemoptysis as an expected potential consequence of HDR, we have calculated the radial dose distribution for an Ir-192 HDR source, rigorously examined the dose and prescription points recommended by the American Brachytherapy Society (ABS), and performed a radiobiological-based analysis. The radial dose rate of a commercially available Ir-192 source was calculated with a Monte Carlo simulation. Based on the linear quadratic model, the estimated palliative, curative and blood vessel rupture radii from the center of an Ir-192 source were obtained for the ABS recommendations and a series of customized HDR prescriptions. The estimated radius at risk for blood vessel perforation for the ABS recommendations ranges from 7 to 9 mm. An optimized prescription may in some situations reduce this radius to 4 mm. The estimated blood perforation radius is generally smaller than the palliative radius. Optimized and individualized endobronchial HDR prescriptions are currently feasible based on our current understanding of tumor and normal tissue radiobiology. Individualized prescriptions could minimize complications such as fatal hemoptysis without sacrificing efficacy. Fiducial stents, HDR catheter centering or spacers and the use of CT imaging to better assess the relationship between the catheter and blood vessels promise to be useful strategies for increasing the therapeutic index of this treatment modality. Prospective trials employing treatment optimization algorithms are needed.

  13. Preparation and determination of kerma for Iridium 192 sources of low dose rate for brachytherapy

    International Nuclear Information System (INIS)

    The practice of Brachytherapy with Iridium-192 sources of low dose rate (0.4 - 0.8 Gy/h) is a technique used in the treatment of diverse illnesses. in this work the preparation, quality control and calibration are presented in terms of kerma in air of Iridium-192 using as target these recycled Iridium-Platinum wires. The targets were obtained as decayed sources of different radio therapeutical centers in the country and they were characterized by Scanning electron microscopy in order to determine their chemical composition. Subsequently it was developed an experimental design to establish the effect of neutron flux, geometrical array and irradiation time over the activity and percentage of the sources homogeneity. The homogeneity was determined by auto radiography and by Gamma spectroscopy. Once the optimal irradiation conditions were established, it is determined the apparent activity and kerma in air using a well type ionization chamber with traceability to a primary laboratory. Iridium-192 sources were obtained with an average homogeneity 96 %, apparent activity 282.129 ± 0.531 M Bq and kerma in air 0.03200 ± 0.00006 m Gy m/h A. (Author)

  14. Study and development of an Iridium-192 seed for use in ophthalmic cancer

    International Nuclear Information System (INIS)

    Even ocular tumors are not among the cases with a higher incidence, they affect the population, especially children. The Institute of Energy and Nuclear Research (IPEN-CNEN/SP) in partnership with Escola Paulista de Medicina (UNIFESP), created a project to develop and implement a alternative treatment for ophthalmic cancer that use brachytherapy iridium-192 seeds. The project arose by reason of the Escola Paulista treat many cancer cases within the Unified Health System (SUS) and the research experience of sealed radioactive sources group at IPEN. The methodology was developed from the available infrastructure and the experience of researchers. The prototype seed presents with a core (192-iridium alloy of iridium-platinum) of 3.0 mm long sealed by a capsule of titanium of 0.8 mm outside diameter, 0.05 mm wall thickness and 4,5mm long. This work aims to study and develop a seed of iridium-192 from a platinum-iridium alloy. No study on the fabrication of these seeds was found in available literature. It was created a methodology that involved: characterization of the material used in the core, creation of device for neutron activation irradiation and and seed sealing tests. As a result, proved the feasibility of the method. As a suggestion for future work, studies regarding metrology and dosimetry of these sources and improvement of the methodology should be carried out, for future implementation in national scope. (author)

  15. Recovery from Iridium-192 flakes of a radioactive source for industrial use after a radiation incident

    International Nuclear Information System (INIS)

    The Iridium-192 (192Ir) is the most used and ideal for industrial radiography applications, especially in petrochemical plants and pipelines and provides better contrast sensitivity for thick (25.4 mm). This source has constructive sealed double encapsulation, the internal capsule containing stainless steel to radioactive material in the form of flakes and welded with TIG process. The radiological incident happened at a gas station fuel sales in circumstances in which there was a homogeneity test welds a tank, the flakes or Ir-192 fell off his ponytail and left scattered over an area of 2 m2, some fell flat areas and other land so collected in lead shielding and metal container and ground source. Full recovery of the leaflets was performed at the Division of radioactive waste management (GRRA) gaining a total of 22 flakes with no radiation risk to staff performance and installation and the conclusion was reached that the misapplicaion of TIG welding was the main cause the incident. (author)

  16. Zambia's participation in past CTBTO activities and the upgrading of AS119 and N192: Experiences and the way forward

    International Nuclear Information System (INIS)

    This presentation briefly describes the Zambian Seisimic Network (ZSN), Zambia's participation in past CTBTO activities and upgrading of AS119 and N192. It goes on to describe various experiences encountered and makes some suggestions for future considerations

  17. Toxicity of chlorpyrifos and chlorpyrifos oxon in a transgenic mouse model of the human paraoxonase (PON1) Q192R polymorphism

    Energy Technology Data Exchange (ETDEWEB)

    Cole, Toby B.; Walter, Betsy J.; Shih, Diana M.; Tward, Aaron D.; Lusis, Aldons J.; Timchalk, Chuck; Richter, Rebecca J.; Costa, Lucio G.; Furlong, Clement E.

    2005-08-01

    The Q192R polymorphism of paraoxonase (PON1) has been shown to affect hydrolysis of organophosphorus compounds. The Q192 and R192 alloforms exhibit equivalent catalytic efficiencies of hydrolysis for diazoxon, the oxon form of the pesticide (DZ). However, the R192 alloform has a higher catalytic efficiency of hydrolysis than does the Q192 alloform for chlorpyrifos oxon (CPO), the oxon form of the pesticide chlorpyrifos (CPS). The current study examined the relevance of these observations for in-vivo exposures to chlorpyrifos and chlorpyrifos oxon. Methods Using a transgenic mouse model we examined the relevance of the Q192R polymorphism for exposure to CPS and CPO in vivo. Transgenic mice were generated that expressed either human PON1Q192 or PON1R192 at equivalent levels, in the absence of endogenous mouse PON1. Dose-response and time course experiments were performed on adult mice exposed dermally to CPS or CPO. Morbidity and acetylcholinesterase (AChE) activity in the brain and diaphragm were determined in the first 24 h following exposure. Results Mice expressing PON1Q192 were significantly more sensitive to CPO, and to a lesser extent CPS, than were mice expressing PON1R192. The time course of inhibition following exposure to 1.2 mg/kg CPO revealed maximum inhibition of brain AChE at 6?12 h, with PON1R192, PON1Q192, and PON1? /? mice exhibiting 40, 70 and 85% inhibition, respectively, relative to control mice. The effect of PON1 removal on the dose?response curve for CPS exposure was remarkably consistent with a PBPK/PD model of CPS exposure. Conclusion These results indicate that individuals expressing only the PON1Q192 allele would be more sensitive to the adverse effects of CPO or CPS exposure, especially if they are expressing a low level of plasma PON1Q192.

  18. Absorbed dose simulations in near-surface regions using high dose rate Iridium-192 sources applied for brachytherapy

    International Nuclear Information System (INIS)

    Brachytherapy treatment with Iridium-192 high dose rate (HDR) sources is widely used for various tumours and it could be developed in many anatomic regions. Iridium-192 sources are inserted inside or close to the region that will be treated. Usually, the treatment is performed in prostate, gynaecological, lung, breast and oral cavity regions for a better clinical dose coverage compared with other techniques, such as, high energy photons and Cobalt-60 machines. This work will evaluate absorbed dose distributions in near-surface regions around Ir-192 HDR sources. Near-surface dose measurements are a complex task, due to the contribution of beta particles in the near-surface regions. These dose distributions should be useful for non-tumour treatments, such as keloids, and other non-intracavitary technique. For the absorbed dose distribution simulations the Monte Carlo code PENELOPE with the general code penEasy was used. Ir-192 source geometry and a Polymethylmethacrylate (PMMA) tube, for beta particles shield were modelled to yield the percentage depth dose (PDD) on a cubic water phantom. Absorbed dose simulations were realized at the central axis to yield the Ir-192 dose fall-off along central axis. The results showed that more than 99.2% of the absorbed doses (relative to the surface) are deposited in 5 cm depth but with slower rate at higher distances. Near-surface treatments with Ir-192 HDR sources yields achievable measurements and with proper clinical technique and accessories should apply as an alternative for treatment of lesions where only beta sources were used. - Highlights: ► A PMMA (polymethylmethacrylate) tube was used to surround the HDR Ir-192 to shield the beta particles. ► 99.2% of the absorbed doses (relative to the surface) are deposited in 5 cm depth. ► Near-surface treatments with Ir-192 HDR sources yields achievable measurements

  19. The Fricke dosimeter as an absorbed dose to water primary standard for Ir-192 brachytherapy

    Science.gov (United States)

    El Gamal, Islam; Cojocaru, Claudiu; Mainegra-Hing, Ernesto; McEwen, Malcolm

    2015-06-01

    The aim of this project was to develop an absorbed dose to water primary standard for Ir-192 brachytherapy based on the Fricke dosimeter. To achieve this within the framework of the existing TG-43 protocol, a determination of the absorbed dose to water at the reference position, D(r0,θ0), was undertaken. Prior to this investigation, the radiation chemical yield of the ferric ions (G-value) at the Ir-192 equivalent photon energy (0.380 MeV) was established by interpolating between G-values obtained for Co-60 and 250 kV x-rays. An irradiation geometry was developed with a cylindrical holder to contain the Fricke solution and allow irradiations in a water phantom to be conducted using a standard Nucletron microSelectron V2 HDR Ir-192 afterloader. Once the geometry and holder were optimized, the dose obtained with the Fricke system was compared to the standard method used in North America, based on air-kerma strength. Initial investigations focused on reproducible positioning of the ring-shaped holder for the Fricke solution with respect to the Ir-192 source and obtaining an acceptable type A uncertainty in the optical density measurements required to yield the absorbed dose. Source positioning was found to be reproducible to better than 0.3 mm, and a careful cleaning and control procedure reduced the variation in optical density reading due to contamination of the Fricke solution by the PMMA holder. It was found that fewer than 10 irradiations were required to yield a type A standard uncertainty of less than 0.5%. Correction factors to take account of the non-water components of the geometry and the volume averaging effect of the Fricke solution volume were obtained from Monte Carlo calculations. A sensitivity analysis showed that the dependence on the input data used (e.g. interaction cross-sections) was small with a type B uncertainty for these corrections estimated to be 0.2%. The combined standard uncertainty in the determination of absorbed dose to water

  20. The Fricke dosimeter as an absorbed dose to water primary standard for Ir-192 brachytherapy

    International Nuclear Information System (INIS)

    The aim of this project was to develop an absorbed dose to water primary standard for Ir-192 brachytherapy based on the Fricke dosimeter. To achieve this within the framework of the existing TG-43 protocol, a determination of the absorbed dose to water at the reference position, D(r0,θ0), was undertaken. Prior to this investigation, the radiation chemical yield of the ferric ions (G-value) at the Ir-192 equivalent photon energy (0.380 MeV) was established by interpolating between G-values obtained for Co-60 and 250 kV x-rays.An irradiation geometry was developed with a cylindrical holder to contain the Fricke solution and allow irradiations in a water phantom to be conducted using a standard Nucletron microSelectron V2 HDR Ir-192 afterloader. Once the geometry and holder were optimized, the dose obtained with the Fricke system was compared to the standard method used in North America, based on air-kerma strength.Initial investigations focused on reproducible positioning of the ring-shaped holder for the Fricke solution with respect to the Ir-192 source and obtaining an acceptable type A uncertainty in the optical density measurements required to yield the absorbed dose. Source positioning was found to be reproducible to better than 0.3 mm, and a careful cleaning and control procedure reduced the variation in optical density reading due to contamination of the Fricke solution by the PMMA holder. It was found that fewer than 10 irradiations were required to yield a type A standard uncertainty of less than 0.5%.Correction factors to take account of the non-water components of the geometry and the volume averaging effect of the Fricke solution volume were obtained from Monte Carlo calculations. A sensitivity analysis showed that the dependence on the input data used (e.g. interaction cross-sections) was small with a type B uncertainty for these corrections estimated to be 0.2%.The combined standard uncertainty in the determination of absorbed dose to water at

  1. Dosimetry experience of 192IR sources used In HDR brachytherapy for cervical cancer

    International Nuclear Information System (INIS)

    Purpose/Objective: The 192IR Sources are the most commonly used in radiotherapy treatments HDR worldwide. According to international recommendations on quality assurance in HDR brachytherapy, an acceptance test based on the determination of the source strength of any new source shall be carried out before first application to verify the manufacturer’s calibration data. The present paper gives the experimental determination of the source strength for our brachytherapy sources used until now in brachytherapy treatments. Materials/Methods: At Mother Teresa University Hospital we have a cost-effective gynecological brachytherapy unit from Eckert & Ziegler BEBIG named GyneSource® that is a five channel HDR after loader equipped with an 192IR source. The software used is HDR plus™ 2.5 that delivers an optimized treatment plan and makes the process especially fast and we use intracavitary BEBIG applicators. From April 2009 up to December 2012, we have imported nine HDR 192IR Sources. The exchange of the source and acceptance test is done by the physicist of the clinic once the source is imported. The measurements are done with a Well-type ionization chamber HDR1000 Plus and the electrometer used is MAX4000. Only seven sources are compared as we miss the dosimetry data of the first source, and the forth source was not measured and not used because the machine was not working in that time. Results/Conclusions: Eight sources were accepted for clinically use as the measurement were within the tolerance. The source number four with e deviation of -1.92% has been double checked compared with a free in-air measurement with farmer type chamber that gave a deviation to source certificate of 4% that is still inside the tolerance to accept a source for clinical use. The deviations of measured Air Kerma rate to the value of the sources certificates of all our used 192IR sources are less than 2%, which are within the tolerance. The checked value of updated source strength in

  2. Required treatment margin for coronary endovascular brachytherapy with iridium-192 seed ribbon

    International Nuclear Information System (INIS)

    Purpose: Preliminary clinical trials (SCRIPPS I, WRIST and Gamma 1) employing catheter-based endovascular brachytherapy (EVBT) with iridium-192 (Ir-192) seeds show promising results in reducing restenosis after coronary intervention. Failure analysis of these studies showed a significant number of restenosis at the treatment margin called ''edge effect.'' The objective of this study is to investigate the factors that contribute to the adequacy of treatment margin. Methods and materials: The factors contributing to the margins are penumbra effect at the end of the seed train, uncertainty in target localization, longitudinal seed movement during cardiac cycle and barotrauma due to stent deployment. The magnitudes of the penumbra effect, which refers to the tapering off the prescribed isodose line near the ends of the source train, were calculated for various source lengths of Ir-192 seed ribbon using AAPM TG-43 algorithm. Uncertainty in target localization refers to the fact that the visual estimation of proximal and distal extent of the injury is not accurate, and this can be obtained by comparing the 'estimate' from the interventional cardiologist with careful review of the cine-angiogram. Longitudinal seed movements relative to the coronary vessel during the cardiac cycle were determined by frame-by-frame reviewing cine-angiograms of 30 patients. The proximal and distal source points were measured in reference to branching vessels during the contrast phase of the cine-angiogram. The maximum proximal and distal longitudinal movement was captured and source displacement was measured from the closest proximal and distal branching vessel. Barotrauma, additional injury to the vessel arising from the stent deployment balloon, was obtained by reviewing specifications from commercially available stent delivery systems. Results: The penumbra effect ranges from 3.9 to 4.5 mm for 6-22 Ir-192 seed ribbons. The uncertainty in target localization is within 3 mm for our

  3. 儿童孤独症192例临床分析%Analysis of clinical character of 192 cases with childhood autism

    Institute of Scientific and Technical Information of China (English)

    刘静; 徐琼; 张颖; 徐秀

    2011-01-01

    [目的]探讨儿童孤独症的临床特点及危险因素,为该临床的早期发现、早期诊治提供依据. [方法]对2004年11月-2010年8月复旦大学附属儿科医院儿童保健科收治的192例孤独症患儿的主诉、临床表现、个人史及家庭状况(妊产期不利因素、家族史、父母文化、父母性格、家庭教育情况)、和辅助检查(脑CT/MRI、EEG、BAEP)进行回顾性分析. [结果]在192例孤独症患儿中,≤24个月龄的患儿21例(10.9%),病例主诉以语言障碍为主,尤以不会说话突出(62%).母亲存在妊产期不利因素者共85例(44.3%),异常家族史者52例(27%),辅助检查中,EEG异常检出率较高. [结论]语言障碍最易为家长注意,建议常规健康体检中纳入和重视儿童社会能力的发展,以利于早期发现孤独症患儿.妊娠不利因素、家族史和父亲内向的性格特点与孤独症发病有密切关系.%[Objective] To explore the clinical characteristics and risk factors of autism, in order to provide scientific basis for autism early detection and diagnosis. [Methods] One hundred and ninety two cases of autism children between 2004 November and 2010 August had been collected in this article. All these 192 cases were studied about chief complaint,clinical manifestation, personal history and family conditions(pregnancy, family, parents educational background, parents disposition, household education)and assistant examinations (CT/MRI,EEG,BAEP). [Results] Among 192 cases, 21 one cases( 10.9% ) were less than two years old. The language development disability was the mainly chief compliant, especially had no language(62 % ). During gestation period and childbirth time, 85(44.3 % ) had adverse factors. 52 cases(27 % )had abnormal family history. Among the assistant examinations, an especially highabnormality was found in EEG. [Conclusions] Parents often pay highly attention to language development disability, in order to improve the early

  4. 对7轮ARIA-192的不可能差分分析%Impossible Differential Cryptanalysis of 7-Round ARIR-192

    Institute of Scientific and Technical Information of China (English)

    谢作敏; 陈少真

    2013-01-01

    ARIA cipher is a new block cipher proposed by some South Korean experts in 2003. The design principle of ARIA is similar to the AES. ARIA is established as a Korean Standard block cipher algorithm by Korean Agency for Technology and Standards. In this paper, a new impossible differential attack on 7 rounds of the ARIA cipher is presented. By this attack, 7-round ARIA-192 is breakable with a data complexity of about 2176.2 encryptions, while the previous best impossible differential attack on ARIA broke on 7-round ARIA-256. Then some characters on diffusion layer are used to reduce the complexity of the ARIA-256 to 2192.2 .%ARIA密码是2003年由韩国学者提出的新的分组密码算法,该密码与AES的设计原理相类似,并在2004年被选为韩国的分组密码标准。该文根据ARIA密码的结构特征,提出ARIA密码的一种新的7轮不可能差分攻击路径,首次实现了对ARIA-192的不可能差分攻击,攻击的时间复杂度为2176.2。同时,利用扩散层的相关性质降低攻击ARIA-256的时间复杂度为2192.2。

  5. Calculation of dose decrease in a finite phantom of a 192Ir point source

    International Nuclear Information System (INIS)

    The purpose of this study was to calculate the dose decrease in a finite phantom of a 192Ir-point source by using a new algorithm based on field theory. The methods used included the phenomenological application of the principle ''mirror image of an electric point source in front of a dielectric semi-plateau'' to a radioactive source in a finite phantom results in a function to calculate the dose decrease near the surface. Measurements were done in a water phantom in three different experimental setups. To verify the calculated results Monte Carlo (MC) simulations of dose distribution of a 192Ir point source in 34x40x40 cm3 water were carried out. The strength of mirror source was found -0.103 of the real source. A lack scatter function was necessary to handle the dose decrease very close to surface. The measured and calculated dose values differed less than 0.9%. Both MC simulations and the new algorithm show the dose decrease near phantom surface with differences less than 2% between each other. The new algorithm based on field theory calculated the dose decrease of a 192Ir point source in a finite phantom with a very good agreement to measured and simulated data. A clinical example, which affects only a single planar boundary, is given by using molds in the treatment of skin tumors. This was calculated with the new algorithm presented in this article. The comparison with the common algorithm demonstrates the differences that might cause an overestimation of the dose, which probably leads an underdosing of the tumor. The general use of the new algorithm in brachytherapy where a variety of boundary shapes are encountered has to be verified seriously

  6. Radiation levels in Cath Lab and occupational exposures during manual 192Ir intracoronary brachytherapy

    International Nuclear Information System (INIS)

    Intracoronary brachytherapy is a new modality of radiation therapy and is being used to reduce the rate of restenosis after angioplasty. Clinical trials for evaluation of safety and efficacy of manually implanted 192Ir seed ribbons are underway at various cardiology centres in India. 192Ir emits high energy gamma rays (0.136 -1.06 MeV), which causes concern regarding safety of the personnel when these sources are manually used in the cardiac catheterization laboratory (Cath Lab) for intracoronary irradiation. Radiation levels in Cath Lab and exposures to personnel have been measured at 6 different cardiology centres in the country during 8 different clinical trials using radiation survey meter, personnel monitoring badges and pocket dosimeters. Activities of 192Ir seed ribbons used in these clinical trials were in the range of 5.55 - 14.8 GBq. Measured radiation levels behind the mobile lead shields, at the top of lead shields, near the patient head, near the patient toes and at the main door of the Cath Lab were in the range of 2.6-20, 50-256, 385-450, 22-225 and 2-16 μSv/hr/3.7GBq, respectively. Measured effective doses to occupational workers were in range of 14-100 μSv/procedure/3.7GBq. Based on these measurements, user institutions have been advised to use lead glass mounted L-shaped mobile lead shields with proper orientation during clinical trials, avoid unwanted occupancy in the Cath Lab and around the patient during irradiation and use conveniently long forceps or tongs for implantation and removal of sources. (author)

  7. Dosimetry audit on the accuracy of 192Ir brachytherapy source strength determinations in Sweden

    International Nuclear Information System (INIS)

    The absorbed dose delivered to the patient in brachytherapy is directly proportional to the source strength in terms of the reference air-kerma rate (RAKR). Verification of this quantity by the hospitals is widely recognized as an important part of a quality assurance program. An external audit was performed on behalf of the Secondary Standard Dosimetry Laboratory at the Swedish Radiation Protection Authority (SSI). The aim was to investigate how accurately the source-strength in 192Ir brachytherapy is determined at Swedish hospitals. The SSI reference well-type ion chamber and calibrated equipment were used to measure the RAKR of an 192Ir source in each of the 14 Swedish afterloading units. Comparisons with values determined by vendors and hospitals were made. Agreement in values of RAKR as determined by SSI, hospitals and vendors were in all cases within the ±3% uncertainty (at a coverage factor of k=2), typically guaranteed by the vendors. The good agreement reflects the robustness and easy handling of well-type chambers designed for brachytherapy in use by all Swedish hospitals. The 192Ir calibration service planned at SSI will solve the hospitals current problem with recalibration of equipment. SSI can also advise hospitals to follow the IAEA recommendations for measurement techniques and maintenance of equipment. It is worthwhile for the hospitals to establish their own ratio (or deviation) with the vendor and follow it as function of time. Such a mean-ratio embeds systematic differences of various origins and have a lower uncertainty than has the RAKR alone, making it useful for early detection of problems with equipment or routines. SSI could also define requirements for the agreement between source strengths as determined by hospitals and vendors and couple this to an action plan, dependent on level of disagreement, and some kind of reporting to SSI

  8. Dosimetric characterization of round HDR {sup 192}Ir AccuBoost applicators for breast brachytherapy

    Energy Technology Data Exchange (ETDEWEB)

    Rivard, Mark J.; Melhus, Christopher S.; Wazer, David E.; Bricault, Raymond J. Jr. [Department of Radiation Oncology, Tufts University School of Medicine, Boston, Massachusetts 02111 (United States); Advanced Radiation Therapy, Billerica, Massachusetts 01821 (United States)

    2009-11-15

    Purpose: The AccuBoost brachytherapy system applies HDR {sup 192}Ir beams peripherally to the breast using collimating applicators. The purpose of this study was to benchmark Monte Carlo simulations of the HDR {sup 192}Ir source, to dosimetrically characterize the round applicators using established Monte Carlo simulation and radiation measurement techniques and to gather data for clinical use. Methods: Dosimetric measurements were performed in a polystyrene phantom, while simulations estimated dose in air, liquid water, polystyrene and ICRU 44 breast tissue. Dose distribution characterization of the 4-8 cm diameter collimators was performed using radiochromic EBT film and air ionization chambers. Results: The central axis dose falloff was steeper for the 4 cm diameter applicator in comparison to the 8 cm diameter applicator, with surface to 3 cm depth-dose ratios of 3.65 and 2.44, respectively. These ratios did not considerably change when varying the phantom composition from breast tissue to polystyrene, phantom thickness from 4 to 8 cm, or phantom radius from 8 to 15 cm. Dose distributions on the central axis were fitted to sixth-order polynomials for clinical use in a hand calculation spreadsheet (i.e., nomogram). Dose uniformity within the useful applicator apertures decreased as depth-dose increased. Conclusions: Monte Carlo benchmarking simulations of the HDR {sup 192}Ir source using the MCNP5 radiation transport code indicated agreement within 1% of the published results over the radial/angular region of interest. Changes in phantom size and radius did not cause noteworthy changes in the central axis depth-dose. Polynomial fit depth-dose curves provide a simple and accurate basis for a nomogram.

  9. Dosimetric characterization of round HDR 192Ir AccuBoost applicators for breast brachytherapy

    International Nuclear Information System (INIS)

    Purpose: The AccuBoost brachytherapy system applies HDR 192Ir beams peripherally to the breast using collimating applicators. The purpose of this study was to benchmark Monte Carlo simulations of the HDR 192Ir source, to dosimetrically characterize the round applicators using established Monte Carlo simulation and radiation measurement techniques and to gather data for clinical use. Methods: Dosimetric measurements were performed in a polystyrene phantom, while simulations estimated dose in air, liquid water, polystyrene and ICRU 44 breast tissue. Dose distribution characterization of the 4-8 cm diameter collimators was performed using radiochromic EBT film and air ionization chambers. Results: The central axis dose falloff was steeper for the 4 cm diameter applicator in comparison to the 8 cm diameter applicator, with surface to 3 cm depth-dose ratios of 3.65 and 2.44, respectively. These ratios did not considerably change when varying the phantom composition from breast tissue to polystyrene, phantom thickness from 4 to 8 cm, or phantom radius from 8 to 15 cm. Dose distributions on the central axis were fitted to sixth-order polynomials for clinical use in a hand calculation spreadsheet (i.e., nomogram). Dose uniformity within the useful applicator apertures decreased as depth-dose increased. Conclusions: Monte Carlo benchmarking simulations of the HDR 192Ir source using the MCNP5 radiation transport code indicated agreement within 1% of the published results over the radial/angular region of interest. Changes in phantom size and radius did not cause noteworthy changes in the central axis depth-dose. Polynomial fit depth-dose curves provide a simple and accurate basis for a nomogram.

  10. Fission fragment angular distribution in 24Mg induced reactions on 192Os and 197Au

    International Nuclear Information System (INIS)

    Angular distributions of fission fragments have been measured in 24Mg + 192Os and 24Mg + 197Au reactions at Elab = 128 MeV which is close to entrance channel Coulomb barrier. Experimental angular anisotropies were in reasonably good agreement with those calculated using the statistical theory. Analysis of the angular distribution data of the present study and of our earlier measurement in 19F + 197Au reaction has shown that contribution from non-compound nucleus fission in these systems is not significant. (author)

  11. Superdeformation studies in the odd-odd nucleus {sup 192}Tl

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, S.; Carpenter, M.P.; Janssens, R.V.F. [and others

    1995-08-01

    The study of yrast and near-yrast structures of odd-odd nuclei to high spins is somewhat limited due to the complexity of the spectra resulting from the many proton-neutron couplings near the Fermi surface. In superdeformed nuclei, the number of available protons and neutrons near the Fermi surface is somewhat limited due to the presence of large-shell gaps which stabilize the nuclear shape. A relatively small number of available neutron and proton configurations can lead to fragmentation of the SD intensity into a number of different bands. Two good examples of this phenomenon were found in {sup 192}Tl and {sup 194}Tl where the presence of six superdeformed bands were reported in both nuclei. We reexamined {sup 192}Tl at Gammasphere using the {sup 160}Gd({sup 37}Cl,5n) reaction at 178 MeV to populate states in the superdeformed well of this nucleus. While our previous study on {sup 192}Tl at ATLAS was very successful, a number of questions remained which formed the basis of our objectives in this experiment: obtain better {gamma}-ray energies for the known transitions and identify higher spin members in each band; determine how the bands feed the known yrast states in {sup 192}Tl as well as determine the complete spectrum in coincidence with the SD bands; look for M1 transitions connecting proposed signature partners; and attempt to identify other excitations in the superdeformed well. Analysis is underway and four of the six bands were confirmed. The reasons that two of the reported bands were not observed in this latest work is still under investigation. As of this time, no other superdeformed bands were identified in the data. Two of the confirmed SD bands have a constant moment of inertia and show indications of cross-talk between each other. This observation is not unexpected since the calculated M1 rates for the proposed configuration of the band, {pi}{sub 13/2} x {upsilon}j{sub 15/2}, indicate that M1 transitions linking the two SD bands should be observed.

  12. Study of the superdeformed band in [sup 194]Pb and [sup 192]Hg with EUROGAM

    Energy Technology Data Exchange (ETDEWEB)

    Hannachi, F.; Schueck, C.; Bastin, G.; Deloncle, I.; Gall, B.; Porquet, M.G.; Smith, A.G.; Azaiez, F.; Bourgeois, C.; Duprat, J.; Korichi, A.; Perrin, N.; Poffe, N.; Sergolle, H.; Astier, A.; Coz, Y. le; Meyer, M.; Redon, N.; Bentley, M.; Simpson, J.; Sharpey-Schafer, J.F.; Joyce, M.J.; Beausang, C.W.; Fallon, P.; Paul, E.S.; Dagnall, P.J.; Forbes, S.A.; Gale, S.; Jones, P.M.; Wadsworth, R.; Clark, R.M.; Aleonard, M.M.; Curien, D.; Defrance, G.; Carpenter, M.; Henry, R.; Lauritsen, T.; Willsau, P. (SERC, Daresbury Lab., Warrington (United Kingdom) C.S.N.S.M., IN2P3-CNRS, 91 Orsay (France) I.P.N., Orsay (France) Univ. of Oxford, Dept. of Physics (United Kingdom) I.P.N., Univ. Lyon-1, 69 Villeurbanne (France) Staffordshire Polytechnic, Stoke-on-Trent (United Kingdom) Oliver Lodge Lab., Univ. of Liverpool (United Kingdom) Univ. of York, Dept. of Physics, Helsington, York (United Kingdom) C.E.N.B.G., 33 Gradignan (France) C.R.N., 67 Strasbourg (France) Argonne National Lab., IL (United St

    1993-05-31

    A subset of the Eurogam array has been used to investigate the decay out of the superdeformed (SD) band in [sup 194]Pb. Two new band members and a new decay pattern into the low lying states at normal deformation (ND) have been established for this band. In the level scheme at normal deformation, the linking transitions between the previously known floating [Delta] I=1 sequence and the lower states have been established for the first time. In this talk we will also report on the preliminary results of the search for the linking transitions between the SD and ND states in [sup 192]Hg with the fully operational EUROGAM array. (orig.)

  13. Study of the superdeformed band in 194Pb and 192Hg with EUROGAM

    International Nuclear Information System (INIS)

    A subset of the Eurogam array has been used to investigate the decay out of the superdeformed (SD) band in 194Pb. Two new band members and a new decay pattern into the low lying states at normal deformation (ND) have been established for this band. In the level scheme at normal deformation, the linking transitions between the previously known floating Δ I=1 sequence and the lower states have been established for the first time. In this talk we will also report on the preliminary results of the search for the linking transitions between the SD and ND states in 192Hg with the fully operational EUROGAM array. (orig.)

  14. New methods for implanting plastic tubes for 192iridium brachytherapy using steel needles

    International Nuclear Information System (INIS)

    A revised method for implanting plastic tubes used to carry 192iridium for brachytherapy is described. Solid malleable stainless steel needles are machined at one end with a tapered screw thread, on to which the plastic tubing can be placed for pulling through tissue. The technique has proved to be both simpler and quicker than the standard 'Amersham' method. Since the solid needles may be moulded, it is easier to implant relatively inaccessible areas such as axillary, intrathoracic and paraspinal sites. For sites with no clear exit point for the needles, a large diameter steel needle is described, which enables the plastic tubes to be inserted with less trauma to the tissues. (author)

  15. Fragmentation of the Decay from the Superdeformed Yrast Band in 192Hg

    International Nuclear Information System (INIS)

    The decay-out spectrum of the superdeformed yrast band in 192Hg comprises a quasicontinuum, from which about 50 weak discrete transitions of energy between 1 and 3.2MeV are resolved. The fluctuations of the one-dimensional quasicontinuum spectrum are studied with the fluctuation analysis method, which shows that of the order of a few thousand different transitions are available in the first step of the decay-out cascades. The experimental effective number of transitions is compared to schematic theoretical calculations. copyright 1996 The American Physical Society

  16. Investigation of the Dynamical Dipole mode in the 192Pb mass region

    Directory of Open Access Journals (Sweden)

    Parascandolo Concetta

    2014-03-01

    Full Text Available The dynamical dipole mode was investigated in the mass region of the 192Pb compound nucleus, by using the 40Ca + 152Sm and 48Ca + 144Sm reactions at Elab=11 and 10.1 MeV/nucleon, respectively. Both fusion–evaporation and fission events were studied simultaneously for the first time. Our results show that the dynamical dipole mode survives in reactions involving heavier nuclei than those studied previously, however, its yield is lower than that expected within BNV calculations.

  17. RESULTS OF 192IR CONTACT RADIATION THERAPY FOR CERVIX UTERI CANCER

    Directory of Open Access Journals (Sweden)

    O. A. Kravets

    2014-09-01

    Full Text Available The paper presents the results of treatment for locally advanced cervix uteri cancer, by applying a 192Ir radioactive source for contact radiation. Three- and five-year overall and relapse-free survival rates have been obtained for stages: 82.5 and 82.5%; 78.4 and 78.4% for Stage IIb; 57 and 52.3%; 41.6 and 41.6 for IIIb; 53.3 and 47.3%; 42.4 and 37.7% for IVb, respectively.

  18. The influence of different 192Ir sources geometries to the energy deposition

    International Nuclear Information System (INIS)

    In this paper, various simplifications of the HDR source Varian VariSource Classic model, in which 192Ir as a radionuclide is used, were compared. These simplifications were carried out by the simulation of Monte Carlo, using the MCNPX code. The different sources were compared through a distribution of energy deposition in a water phantom. Our results indicated that small simplifications will present no influence on the source response, and the removal of the entire capsule surrounding the radionuclide will present a difference of just 0.51% in the final response. (author)

  19. 轮状病毒肠炎192例临床分析%A Clinical Analysis of 192 Cases of Rotavirus Gastroenteritis

    Institute of Scientific and Technical Information of China (English)

    蔡雪梅

    2011-01-01

    Objective To summarize the clinical characteristics of rotavirus gastroenteritis,especial the manifestations of dysfunctions of extraintestinal organs. Methods We conducted a retrospective analysis of 192 children with rotavirus gastroenteritis from January 2010 to December 2010 in our department. Results The occurrence of the disease peaked from September to No-vember(97/192,50.5% ) ,and ages from 6 months to 12 months . The stools were watery or egg-soup like in all cases. Dehydration of various degrees occurred in 102 children and 44 of them were with metabolic acidosis. 85 patients (44. 3% ) were with vomit and 131(68.2% ) cases had fever. 168(87.5% ) cases had cardiac muscle damage,47(24.5% ) patients had liver damage , another 73 (38.0 % ) children had renal damage ,40 cases with respiratory infection, 19 patients had anemia. All cases completely recovered after the treatment of rehydration,correction of acid-base imbalance,anti-viral therapy,oral administration of biologic and mucus protecting agents. Conclusion Rotavirus gastroenteritis occurs mostly in the autumn season,peak age was 6 to 12 months. Apart from gastroenterological symptoms, dehydration and acidosis can be easily observed. Fat drops were mostly observed in stool examination. Among organ damages other than gastroenterology system,cardiac muscle damage was the most common occurrence. But the prognosis was excellent after routine treatment.%目的 总结轮状病毒肠炎的临床特点,分析其对肠道外损害的表现.方法 对2010年1月- 2010年12月在乌鲁木齐儿童医院消化科住院的轮状病毒肠炎患儿192例临床资料进行回顾性分析.结果本组患儿发病高峰为9月~11月97例(50.5%),高发年龄为6个月~1岁111例(57.8%),所有惠儿大便呈水样或蛋花汤样.102例患儿出现不同程度脱水,合并代谢性酸中毒44例,伴呕吐85例(44.3%),伴发热131例(68.2%).心肌损害168例(87.5%);肝功损害47例(24.5%);肾功损害73

  20. Clinicopathological analysis of ovarian teratoma in 192 cases%卵巢畸胎瘤192例临床病理分析

    Institute of Scientific and Technical Information of China (English)

    郭霞; 祝珍; 成如兰

    2013-01-01

    Objective To investigate the clinicalpathological features of ovarian teratoma.Methods The clinical data of 192 patients with ovarian teratoma in Yancheng maternal and child health hospital were retrospectively analyzed.Results The age of patients ranged from 9 to 65 year old,and the age between 21 and 40 accounting for 75%,unilateral tumor accounting for 90.11%.One hundred and eighty-six cases of ovarian mature cystic teratoma,accounting for 96.88% ; 2 cases of ovarian solid teratoma,accounting for 1.04% ; 1 case of struma ovarian,accounting for 0.52% ; 1 case of immature teratoma,accounting for 0.52% ; 2 cases of teratoma with malignant transformation,accounting for 1.04%.Twenty cases with complications,accounting for 10.42%.Conclusions Most of ovarian teratoma is benign.Strengthening the gynecological examination,early detection and treatment can reduce the occurrence of complications and malignant transformation of teratoma.%目的 探讨卵巢畸胎瘤的临床病理特点.方法 对盐城市妇幼保健院收治的192例卵巢畸胎瘤住院患者的临床资料进行回顾性分析.结果 患者年龄9~65岁,其中21~ 40岁较多,占75%;单侧肿瘤多见,占90.11%.卵巢畸胎瘤中卵巢成熟性囊性畸胎瘤186例,占96.88%;卵巢实性畸胎瘤2例,占1.04%;卵巢甲状腺肿1例,占0.52%;未成熟性畸胎瘤l例,占0.52%;畸胎瘤恶变2例,占1.04%.发生并发症20例,占10.42%.结论 卵巢畸胎瘤绝大多数为良性,加强妇科检查,及早发现、及时手术,可减少并发症及畸胎瘤恶变的发生.

  1. Results of temporary interstitial iridium-192 implantation in head and neck tumors

    International Nuclear Information System (INIS)

    In order to improve local tumor control in advanced head and neck tumors, a temporary interstitial iridium-192 implantation (40 to 50 cGy/h) was performed as a boost therapy (20 to 30 Gy at the surface of the target volume). This treatment was part of a multimodal therapy conception for primary tumors (N=55) as well as for recurrences (N=22). Local control was achieved in 89% (49/55) of patients treated for primary tumors. Complications appeared in the form of soft tissue necroses in 55% (30/55) and in the form of osteoradionecroses of the mandible in 7% (4/55) of the patients. The authors discuss as possible reasons for this high complication rate: Implantation volume too large or total activity too high, activities of the individual iridium-192 seeds to high, setting of radiation sources too close together, total dose too high, disturbed reparation capacity of sound tissues due to preceding operation and chemotherapy, premature test biopsies in the area of implantation, lacking oral hygiene and dental care by uncooperative patients. A local control rate of 50% was achieved by the treatment of recurrences, but this has no importance for the course of this tumor disease which is fatefully determined by the formation of remote metastases. (orig.)

  2. Photodisintegration of the isotopes 186,188,189,190,192Os: Similarities and distinctions

    International Nuclear Information System (INIS)

    In addition to the results obtained earlier for the isotopes 188,189Os, experimental data on the photodisintegration of the isotopes 186,190,192Os are analyzed on the basis of specially introduced objective criteria of reliability of data on the cross sections for partial photoneutron reactions. It is found that the (γ, 1n), (γ, 2n), and (γ, 3n) cross sections for each isotope satisfy differently or, on the contrary, do not satisfy the data-reliability criteria. In many cases, the multiplicity transition functions specified as the ratios Fi = σ(γ, in)/σ(γ, xn) of the cross sections for the (γ, in) partial reactions to the neutron-yield reaction cross section σ(γ, xn) = σ(γ, 1n) + 2σ(γ, 2n) + 3σ(γ, 3n) +... have values that are physically unreliable by definition. It is shown that ambiguities in the dependence of significant systematic uncertainties in experimentally determined neutron multiplicities on the measured kinetic energies is the reason for this. The dependence of these uncertainties on the energy spectra of neutrons is analyzed. For the isotopes 186,190,192Os, new evaluated data satisfying the data-reliability criteria are obtained for the cross sections for partial and total photoneutron reactions

  3. Treatment of carcinoma of the penis by iridium 192 wire implant

    International Nuclear Information System (INIS)

    Since 1971, a group of 22 adult patients with squamous cell carcinoma of the penis have been treated by iridium 192 wire implants. There were 6 T1 tumors, 14 T2 tumors and 2 T3; only one patient (T3) presented with local failure after implant. Local necrosis occurred in 2 patients without local tumoral recurrence, but was sufficient enough to warrant amputation. Thus 19/22 (86%) patients were locally cured with penile conservation. In these patients the most frequent posttherapeutic complication is chronic urethral stenosis (9/19 patients, 47%) requiring repeated instrumental dilations. Four patients presented with initial inguinal mestastatic nodes; only one was cured by radiosurgical treatment. Among patients without metastatic nodes at the time of diagnosis, none had delayed metastatic nodes. Three patients died of nodal evolution, 5 patients died of intercurrent disease without evidence of disease and 14 are now alive and NED. It appears that iridium 192 wire implant is the most effective conservative treatment of invasive squamous cell carcinoma of the penis; however, these results confirm that no particular treatment is required for inguinal nodal areas for patients who initially present with no disease

  4. Development and characterisation of iridium-192 seeds for brachytherapy treatment of ocular tumors

    International Nuclear Information System (INIS)

    Even ocular tumors are not amongst the cases with a high incidence, they affect the population, particularly children. The Institute of Energy and Nuclear Research (IPEN-CNEN/SP) in partnership with Escola Paulista de Medicina (UNIFESP), created a project to develop an alternative treatment for ophthalmic cancer that uses iridium-192 seeds in brachytherapy. This work aims to study and develop a seed of iridium-192 from a platinum-iridium alloy The prototype seed has a 3.0 mm long core sealed by a titanium capsule of 0.8 mm of outer diameter, 0.05 mm of wall thickness and 4.5 mm long. We developed a methodology that covered: characterisation of the material used in the core, creation of a device for neutron activation of the cores and leakage tests. The results show that this methodology is feasible. As a suggestion for future work, studies regarding metrology and dosimetry of these sources should be carried out. (authors)

  5. Two proton high-spin excitations and dipole bands in 192Hg

    International Nuclear Information System (INIS)

    The 192Hg nucleus was populated in the 160Gd(36S, 4n) reaction at a beam energy of E=159 MeV. Emitted γ-rays were detected with the EUROGAM array comprising 43 Compton-suppressed large volume Ge detectors. The level scheme of 192Hg has been extended up to an excitation energy of E=10.4 MeV and spin I=34 h. Two new structures, made of competing ΔI=1 and ΔI=2 transitions have been observed and their connexions with the low-lying levels established. Their lowest levels are located at 6.304 MeV and 6.879 MeV excitation energy. The experimental results are compared with mean-field HF+BCS calculations. It is proposed that the new structures originate from deformation-aligned quasi-proton excitations π(i13/2*h9/2)K=11 and π(h9/2)K=82, coupled to rotation-aligned quasi-neutron ν(i13/2)n and quasi-proton π(h11/2)2 excitations. (orig.)

  6. Two proton high-spin excitations and dipole bands in [sup 192]Hg

    Energy Technology Data Exchange (ETDEWEB)

    Coz, Y. le; Redon, N.; Astier, A.; Beraud, R.; Duffait, R.; Meyer, M.; Hannachi, F.; Bastin, G.; Deloncle, I.; Gall, B.; Kaci, M.; Porquet, M.G.; Schueck, C.; Azaiez, F.; Bourgeois, C.; Duprat, J.; Korichi, A.; Perrin, N.; Poffe, N.; Sergolle, H.; Sharpey-Schafer, J.F.; Beausang, C.W.; Gale, S.J.; Joyce, M.J.; Paul, E.S.; Clark, R.M.; Hauschild, K.; Wadsworth, R.; Simpson, J.; Bentley, M.A.; Smith, A.G.; Huebel, H.; Willsau, P.; France, G. de; Ahmad, I.; Carpenter, M.; Henry, R.; Janssens, R.V.F.; Khoo, T.L.; Lauritsen, T. (Inst. de Physique Nucleaire de Lyon, Univ. C. Bernard Lyon-1, 69 - Villeurbanne (France) Centre de Spectrometrie Nucleaire et Spectrometire de Masse, 91 - Orsay (France) Inst. de Physique Nucleaire, 91 - Orsay (France) CRNS Office, London (United Kingdom) Oliver Lodge Lab., Univ. of Liverpool (United Kingdom) Univ. of York, Dept. of Physics, Helsington (United Kingdom) SERC Daresbury Lab., Warrington (United Kingdom) School of Sciences, Staffordshire Univ., Stoke o

    1994-04-01

    The [sup 192]Hg nucleus was populated in the [sup 160]Gd([sup 36]S, 4n) reaction at a beam energy of E=159 MeV. Emitted [gamma]-rays were detected with the EUROGAM array comprising 43 Compton-suppressed large volume Ge detectors. The level scheme of [sup 192]Hg has been extended up to an excitation energy of E=10.4 MeV and spin I=34 h. Two new structures, made of competing [Delta]I=1 and [Delta]I=2 transitions have been observed and their connexions with the low-lying levels established. Their lowest levels are located at 6.304 MeV and 6.879 MeV excitation energy. The experimental results are compared with mean-field HF+BCS calculations. It is proposed that the new structures originate from deformation-aligned quasi-proton excitations [pi](i[sub 13/2]*h[sub 9/2])[sub K=11] and [pi](h[sub 9/2])[sub K=8][sup 2], coupled to rotation-aligned quasi-neutron [nu](i[sub 13/2])[sup n] and quasi-proton [pi](h[sub 11/2])[sup 2] excitations. (orig.)

  7. Verification of high dose rate 192Ir source position during brachytherapy treatment

    International Nuclear Information System (INIS)

    A system for in vivo tracking of 1 Ci 192Ir source during brachytherapy treatment has been built using high resistivity silicon pad detectors as image sensors and knife-edge lead pinholes as collimators. The sensors consist of 256 pads arranged in 32 x8 grid with pad size 1.4x1.4mm2 and 1 mm thickness. The sensors have two metal layers, enabling connection of readout electronics (VATAGP31 chips) at the edge of the detector. With source self-images obtained from a dual-pinhole system, location of the source can be reconstructed in three dimensions in real time, allowing on-line detection of deviations from planned treatment. The system was tested with 1 Ci 192Ir clinical source in air and plexi-glass phantom. The movements of the source could be tracked in a field of view of approximately 20x20x20cm3 with absolute precision of about 5 mm. Positions of the source, relative to the first measured source position, could be mapped with precision of around 3 mm.

  8. Calculation of iridium-192 production for radiography using G.A. Siwabessy reactor

    International Nuclear Information System (INIS)

    Iridium-In is one of the radioisotopes used in gamma radiography. Calculation for producing iridium-In using G.A. Siwabessy nuclear reactor has been carried out. The targets were discs with 2.7 mm in diameter and 0.15 mm in thickness. The neutron flux was the value at the central irradiation position as high as 1.3 x 1014 n.s-1.cm-2. Calculation results showed that iridium metal irradiation for 12 days resulted in iridium-192 with radioactivity of 96.8 GBq per disc at the end of irradiation. If the irradiation was continued to the next irradiation period after 16 days of shut down, the irradiation resulted in 171.2 GBq of iridium-In. If the target was irradiated continuously for 40 days, the irradiation resulted in 284.5 GBq of iridium-192. The resulted radionuclide impurity was iridium-194 which decayed rapidly with half life of 19.15 hours. The initial radioactivity required for effective radiation source for gamma radiography was 3700 GBq in a radiation source. If the target was irradiated with shut down, the discs required in a radiation sources were 24 discs. If the target was irradiated continuously, the required discs were 14 discs in a radiation source. (author)

  9. Determination of the tissue inhomogeneity correction in high dose rate Brachytherapy for Iridium-192 source

    Directory of Open Access Journals (Sweden)

    Barlanka Ravikumar

    2012-01-01

    Full Text Available In Brachytherapy treatment planning, the effects of tissue heterogeneities are commonly neglected due to lack of accurate, general and fast three-dimensional (3D dose-computational algorithms. In performing dose calculations, it is assumed that the tumor and surrounding tissues constitute a uniform, homogeneous medium equivalent to water. In the recent past, three-dimensional computed tomography (3D-CT based treatment planning for Brachytherapy applications has been popularly adopted. However, most of the current commercially available planning systems do not provide the heterogeneity corrections for Brachytherapy dosimetry. In the present study, we have measured and quantified the impact of inhomogeneity caused by different tissues with a 0.015 cc ion chamber. Measurements were carried out in wax phantom which was employed to measure the heterogeneity. Iridium-192 (192 Ir source from high dose rate (HDR Brachytherapy machine was used as the radiation source. The reduction of dose due to tissue inhomogeneity was measured as the ratio of dose measured with different types of inhomogeneity (bone, spleen, liver, muscle and lung to dose measured with homogeneous medium for different distances. It was observed that different tissues attenuate differently, with bone tissue showing maximum attenuation value and lung tissue resulting minimum value and rest of the tissues giving values lying in between those of bone and lung. It was also found that inhomogeneity at short distance is considerably more than that at larger distances.

  10. Real-size CT slices to optimize brachytherapy treatments in vaginal moulds using 192-IR

    International Nuclear Information System (INIS)

    INTRODUCTION. We use individualized vaginal moulds with 192-Ir as radioactive source. This technique of treatment allows us to perform a previous dosimetric study and the knowledge of the sources spatial distribution. Their elaboration is slow but it offers an individualized treatment of each patient. To optimize the treatment we perform a CT the day after of the application. METHODS. The patients are referred to the Radiology Dp. with hyperdense dummy sources in the plastic tubes of the vaginal mould. After the selection of the central perpendicular plane to the dummy sources, some real size CT slices (RSCTS) are obtained every 5 mm (2mm. of thickness). Then, the dosimetric study is performed. RESULTS. RSCTS give us information about the localization of the sources and a more precise knowledge of the dose received by the bladder, rectum, vaginal vault and the tumor in each plane of interest. However, in some cases the fat plane between the vaginal vault and the rectum and bladder doesn't exist; this is a limitation in the identification of both structures. Likewise, in the cases that the rectum is collapsed when the CT is performed we lost this information too. CONCLUSIONS. 1- Probably this technique will allow us to correlate the dose received by the different structures and the late toxicity. 2- RSCTS allow us a good optimization of the brachytherapy in the plastic tube technique in centers without sophisticated planning systems. 3- RSCTS is a good system of quality control in the vaginal moulds with 192-IR

  11. Safety of /sup 125/iodine and /sup 192/iridium implants to the canine carotid artery: preliminary report

    Energy Technology Data Exchange (ETDEWEB)

    Fee, W.E. Jr.; Goffinet, D.R.; Guthaner, D.; Fajardo, L.F.; Handen, C.

    1985-03-01

    Thirty-nine healthy dogs underwent a simulated radical neck dissection followed by implantation of either /sup 125/Iodine or /sup 192/Iridium in various dose regimes randomized prospectively from 3,000 to 30,000 rad. Bilateral selective carotid angiography was performed immediately postoperatively and at six months and one year. No significant effects occurred to the animals who received 15,000 rad /sup 125/I or 6,000 rad /sup 192/Ir. In the higher dosed animals the /sup 125/I treated group fared better than the /sup 192/Ir treated group, probably due to the lower dose rate delivery. All surviving animals will be maintained an additional year to determine the late effects of brachytherapy irradiation to the carotid artery.

  12. Verification of the dose from an Iridium-192 (192Ir) sealed source absorbed by an implantable cardioverter defibrillator (ICD) during uterine intracavitary brachytherapy

    International Nuclear Information System (INIS)

    The purpose of this study was to verify the dose absorbed by an implantable cardioverter defibrillator (ICD) from an 192Ir sealed source during uterine intracavitary brachytherapy, and to confirm its immunity to radiation effects. First, prior to treatment, the doses around the ICD position of an anthromorphic phantom were evaluated. Next, we also measured the dose at the ICD position using a fluorescent glass dosimeter and silicon diode dosimeter during the treatment of intracavitary brachytherapy of a patient implanted with an ICD. The results of the phantom study showed the dose percentage at the ICD location, 2 cm deep, to be 0.074% of the prescribed dose. The results of a treatment study similarly showed the dose, measured using a fluorescent glass dosimeter in the ICD position, to be 0.071% of the prescribed dose. During the application of the total prescribed dose, 30 Gy/5 fraction, the dose at the surface of the ICD position was estimated to be 21.2 mGy, well below the 1 Gy maximum recommended in the JASTRO guidelines. We regard dose verification and monitoring during treatment to be both necessary and useful in the treatment of individual cases. (author)

  13. An innovative method for 192Ir HDR calibration by farmer chamber, V-film, and solid phantom

    International Nuclear Information System (INIS)

    A simple, practical and economical technique was proposed to calibrate an 192Ir HDR brachytherapy source in terms of air kerma strength. This technique makes use of the 0.6 cm3 Farmer type ion chamber, radiographic film and polystyrene phantom. These tools are commonly used for dosimetry quality assurance of the clinical linear accelerator. In this study, the Exradin A19, PTW N30004 and TM30001 Farmer type ion chambers were used for the calibration of the 192Ir HDR source. To perform the calibration, a 25.4x30.5 cm2 radiographic film was taped on a piece of polystyrene plate, and a straight applicator probe of a HDR brachytherapy unit and the Farmer type ion chamber were affixed to the film envelope. The film was irradiated by the 192Ir source, followed by an exposure in the simulator X-ray beam. The film set with the film removed was then placed on a 5 cm thick polystyrene phantom for calibration measurement. Based on the electrometer reading from the Farmer type ion chamber irradiated by 192Ir and the measured source-to-chamber distance by means of the images on the developed film, we can calculate the air kerma strength of the 192Ir using the new technique. Our calibration results were compared to the data provided by the manufacturer and that of five different well type ion chambers, namely, Sun Nuclear cooperation (SNC) 1008, Nucletron SDS 077.091, SDS 077.094, PTW TN33004 and Standard Imaging (SI) HDR-1000 Plus. The differences were all within 1.6%. Relative to the '7-distance measurement technique' by Stump et al., 2002, our method is more efficient if our empirical formula was used. In summary, our method is simpler and cost-effective to calibrate an 192Ir HDR brachytherapy source for those hospitals without a calibration jig or a well type ion chamber.

  14. Automated attenuation-based tube voltage selection for body CTA: Performance evaluation of 192-slice dual-source CT

    Energy Technology Data Exchange (ETDEWEB)

    Winklehner, Anna; Gordic, Sonja; Lauk, Eliane; Frauenfelder, Thomas; Alkadhi, Hatem; Husarik, Daniela B. [University Hospital Zurich, Institute for Diagnostic and Interventional Radiology, Zurich (Switzerland); Leschka, Sebastian [University Hospital Zurich, Institute for Diagnostic and Interventional Radiology, Zurich (Switzerland); Division of Radiology and Nuclear Medicine, St. Gallen (Switzerland)

    2015-08-15

    To assess radiation dose and image quality in body CT-angiography (CTA) with automated attenuation-based tube voltage selection (ATVS) on a 192-slice dual-source CT (DSCT). Forty patients (69.5 ± 9.6 years) who had undergone body CTA with ATVS (ref.kVp 100, ref.mAs 90) using a 2x192-slice CT in single-source mode were retrospectively included. All patients had undergone prior CTA with a 2x128-slice CT and ATVS with identical imaging and contrast media protocols, serving for comparison. Images were reconstructed with iterative reconstruction at similar strength levels. Radiation dose was determined. Image quality was assessed semi-quantitatively (1:excellent, 5:non-diagnostic), aortic attenuation, noise and CNR were determined. As compared to 128-slice DSCT, 192-slice DSCT selected tube voltages were lower in 30 patients (75 %), higher in 3 (7.5 %), and similar in 7 patients (17.5 %). CTDI{sub vol} was lower with 192-slice DSCT (4.7 ± 1.9 mGy vs. 5.8 ± 2.1 mGy; p < 0.001). Subjective image quality, mean aortic attenuation (342 ± 67HU vs. 268 ± 67HU) and CNR (9.8 ± 2.5 vs. 8.2 ± 2.9) were higher with 192-slice DSCT (all p < 0.01), all datasets being diagnostic. Our study suggests that ATVS of 192-slice DSCT for body CTA is associated with an improved image quality and further radiation dose reduction of 19 % compared to 128-slice DSCT. (orig.)

  15. Absorbed dose simulations in near-surface regions using high dose rate Iridium-192 sources applied for brachytherapy

    Science.gov (United States)

    Moura, E. S.; Zeituni, C. A.; Sakuraba, R. K.; Gonçalves, V. D.; Cruz, J. C.; Júnior, D. K.; Souza, C. D.; Rostelato, M. E. C. M.

    2014-02-01

    Brachytherapy treatment with Iridium-192 high dose rate (HDR) sources is widely used for various tumours and it could be developed in many anatomic regions. Iridium-192 sources are inserted inside or close to the region that will be treated. Usually, the treatment is performed in prostate, gynaecological, lung, breast and oral cavity regions for a better clinical dose coverage compared with other techniques, such as, high energy photons and Cobalt-60 machines. This work will evaluate absorbed dose distributions in near-surface regions around Ir-192 HDR sources. Near-surface dose measurements are a complex task, due to the contribution of beta particles in the near-surface regions. These dose distributions should be useful for non-tumour treatments, such as keloids, and other non-intracavitary technique. For the absorbed dose distribution simulations the Monte Carlo code PENELOPE with the general code penEasy was used. Ir-192 source geometry and a Polymethylmethacrylate (PMMA) tube, for beta particles shield were modelled to yield the percentage depth dose (PDD) on a cubic water phantom. Absorbed dose simulations were realized at the central axis to yield the Ir-192 dose fall-off along central axis. The results showed that more than 99.2% of the absorbed doses (relative to the surface) are deposited in 5 cm depth but with slower rate at higher distances. Near-surface treatments with Ir-192 HDR sources yields achievable measurements and with proper clinical technique and accessories should apply as an alternative for treatment of lesions where only beta sources were used.

  16. Automated attenuation-based tube voltage selection for body CTA: Performance evaluation of 192-slice dual-source CT

    International Nuclear Information System (INIS)

    To assess radiation dose and image quality in body CT-angiography (CTA) with automated attenuation-based tube voltage selection (ATVS) on a 192-slice dual-source CT (DSCT). Forty patients (69.5 ± 9.6 years) who had undergone body CTA with ATVS (ref.kVp 100, ref.mAs 90) using a 2x192-slice CT in single-source mode were retrospectively included. All patients had undergone prior CTA with a 2x128-slice CT and ATVS with identical imaging and contrast media protocols, serving for comparison. Images were reconstructed with iterative reconstruction at similar strength levels. Radiation dose was determined. Image quality was assessed semi-quantitatively (1:excellent, 5:non-diagnostic), aortic attenuation, noise and CNR were determined. As compared to 128-slice DSCT, 192-slice DSCT selected tube voltages were lower in 30 patients (75 %), higher in 3 (7.5 %), and similar in 7 patients (17.5 %). CTDIvol was lower with 192-slice DSCT (4.7 ± 1.9 mGy vs. 5.8 ± 2.1 mGy; p < 0.001). Subjective image quality, mean aortic attenuation (342 ± 67HU vs. 268 ± 67HU) and CNR (9.8 ± 2.5 vs. 8.2 ± 2.9) were higher with 192-slice DSCT (all p < 0.01), all datasets being diagnostic. Our study suggests that ATVS of 192-slice DSCT for body CTA is associated with an improved image quality and further radiation dose reduction of 19 % compared to 128-slice DSCT. (orig.)

  17. Shapes of the $^{192,190}$Pb ground states from beta decay studies using the total absorption technique

    CERN Document Server

    Aguado, M E Estevez; Agramunt, J; Rubio, B; Tain, J L; Jordan, D.; Fraile, L M; Gelletly, W; Frank, A.; Csatlos, M.; Csige, L; Dombradi, Zs.; Krasznahorkay, A; Nacher, E; Sarriguren, P; Borge, M J G; Briz, J A; Tengblad, O; Molina, F.; Moreno, O; Kowalska, M; Fedosseev, V N; Marsh, B A; Fedorov, D V; Molkanov, P L; Andreyev, A.N.; Seliverstov, M D; Burkard, K; Huller, W

    2015-01-01

    The beta decay of $^{192,190}$Pb has been studied using the total absorption technique at the ISOLDE(CERN) facility. The beta-decay strength deduced from the measurements, combined with QRPA theoretical calculations, allow us to infer that the ground states of the $^{192,190}$Pb isotopes are spherical. These results represent the first application of the shape determination method using the total absorption technique for heavy nuclei and in a region where there is considerable interest in nuclear shapes and shape effects.

  18. Influence of paraoxonase-1 Q192R and cytochrome P450 2C19 polymorphisms on clopidogrel response

    Directory of Open Access Journals (Sweden)

    Li L

    2012-02-01

    Full Text Available Rolf P Kreutz1,2, Perry Nystrom2, Yvonne Kreutz2, Jia Miao2, Zeruesenay Desta2, Jeffrey A Breall1, Lang Li2, ChienWei Chiang2, Richard Kovacs1, David A Flockhart2, Yan Jin21Krannert Institute of Cardiology, 2Division of Clinical Pharmacology, Indiana University School of Medicine, Indianapolis, IN, USABackground: The metabolic activation of clopidogrel is a two-step process. It has been suggested that paraoxonase-1 (PON1 is a rate-limiting enzyme in the conversion of 2-oxo-clopidogrel to an active thiol metabolite. Conflicting results have been reported in regard to (1 the association of a common polymorphism of PON1 (Q192R with reduced rates of coronary stent thrombosis in patients taking clopidogrel and (2 its effects on platelet inhibition in patient populations of European descent. Methods: Blood samples from 151 subjects of mixed racial background with established coronary artery disease and who received clopidogrel were analyzed. Platelet aggregation was determined with light transmittance aggregometry and VerifyNow® P2Y12 assay. Genotyping for cytochrome P450 2C19 (CYP2C19*2 and *3 and PON1 (Q192R polymorphisms was performed.Results: Carriers of CYP2C19*2 alleles exhibited lower levels of platelet inhibition and higher on-treatment platelet aggregation than noncarriers. There was no significant difference in platelet aggregation among PON1 Q192R genotypes. Homozygous carriers of the wild-type variant of PON1 (QQ192 had similar on-treatment platelet reactivity to carriers of increased-function variant alleles during maintenance clopidogrel dosing, as well as after administration of a clopidogrel 600 mg loading dose.Conclusion: CYP2C19*2 allele is associated with impaired platelet inhibition by clopidogrel and high on-treatment platelet aggregation. PON1 (Q192R polymorphism does not appear to be a significant determinant of clopidogrel response.Keywords: PON1, platelet, aggregation, cytochrome P450 enzymes

  19. Comparison of air-kerma strength determinations for HDR 192Ir sources

    International Nuclear Information System (INIS)

    Purpose: To perform a comparison of the interim air-kerma strength standard for high dose rate (HDR) 192Ir brachytherapy sources maintained by University of Wisconsin Accredited Dosimetry Calibration Laboratory (UWADCL) with measurements of the various source models using modified techniques from the literature. The current interim standard was established by Goetsch et al. in 1991 and has remained unchanged to date. Methods: The improved, laser-aligned seven-distance apparatus of University of Wisconsin Medical Radiation Research Center (UWMRRC) was used to perform air-kerma strength measurements of five different HDR 192Ir source models. The results of these measurements were compared with those from well chambers traceable to the original standard. Alternative methodologies for interpolating the 192Ir air-kerma calibration coefficient from the NIST air-kerma standards at 137Cs and 250 kVp x rays (M250) were investigated and intercompared. As part of the interpolation method comparison, the Monte Carlo code EGSnrc was used to calculate updated values of Awall for the Exradin A3 chamber used for air-kerma strength measurements. The effects of air attenuation and scatter, room scatter, as well as the solution method were investigated in detail. Results: The average measurements when using the inverse NK interpolation method for the Classic Nucletron, Nucletron microSelectron, VariSource VS2000, GammaMed Plus, and Flexisource were found to be 0.47%, -0.10%, -1.13%, -0.20%, and 0.89% different than the existing standard, respectively. A further investigation of the differences observed between the sources was performed using MCNP5 Monte Carlo simulations of each source model inside a full model of an HDR 1000 Plus well chamber. Conclusions: Although the differences between the source models were found to be statistically significant, the equally weighted average difference between the seven-distance measurements and the well chambers was 0.01%, confirming that it is

  20. Mutation screening of the TPO gene in a cohort of 192 Chinese patients with congenital hypothyroidism

    Science.gov (United States)

    Fu, Chunyun; Xie, Bobo; Zhang, Shujie; Wang, Jin; Luo, Shiyu; Zheng, Haiyang; Su, Jiasun; Hu, Xuyun; Chen, Rongyu; Fan, Xin; Luo, Jingsi; Gu, Xuefan; Chen, Shaoke

    2016-01-01

    Objectives Defects in the human thyroid peroxidase (TPO) gene are reported to be one of the causes of congenital hypothyroidism (CH) due to dyshormonogenesis. The aim of this study was to examine the TPO mutation spectrum and prevalence among patients with CH in the Guangxi Zhuang Autonomous Region of China and to define the relationships between TPO genotypes and clinical phenotypes. Methods Blood samples were collected from 192 patients with CH in the Guangxi Zhuang Autonomous Region, China and genomic DNA was extracted from peripheral blood leucocytes. All exons of the 10 common CH-associated genes including TPO together with their exon-intron boundaries were screened by next-generation sequencing (NGS). The effect of the novel TPO mutation was investigated by ‘in silico’ studies. Results NGS analysis of TPO in 192 patients with CH revealed 3 different variations in 2 individuals (2/192, 1%). Sequencing other CH candidate genes in the patients with TPO variants revealed that patient 1 was homozygous for c.2422delT TPO mutation combined with double heterozygous DUOX2 pathogenic variants (p.R683L/p.L1343F) and patient 2 was triallelic for TPO pathogenic variants (p.R648Q/p.T561M/p.T561M). The present study identified a novel TPO variation c.1682C>T/p.T561M; and four known mutations: c.2422delT/p.C808Afs×24 and c.1943C>T/p.R648Q in TPO, c.2048G>T/p.R683L and c.4027C>T/p.L1343F in DUOX2. Conclusions Our study indicated that the prevalence of TPO mutations was 1% among studied Chinese patients with CH. More than two variations in one or more CH-associated genes can be found in a single patient, and may, in combination, affect the phenotype of the individual. A novel TPO variation c.1682C>T/p.T561M was found, thereby expanding the mutational spectrum of the gene. PMID:27173810

  1. 49 CFR 192.555 - Uprating to a pressure that will produce a hoop stress of 30 percent or more of SMYS in steel...

    Science.gov (United States)

    2010-10-01

    ... stress of 30 percent or more of SMYS in steel pipelines. 192.555 Section 192.555 Transportation Other... of 30 percent or more of SMYS in steel pipelines. (a) Unless the requirements of this section have been met, no person may subject any segment of a steel pipeline to an operating pressure that...

  2. 41 CFR 102-192.15 - How are “I”, “you”, “me”, “we”, and “us” used in this part?

    Science.gov (United States)

    2010-07-01

    ... Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT Introduction to this Part § 102-192.15 How are “I”, “you”, “me”, “we... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false How are âIâ, âyouâ,...

  3. Clinical analysis of pregnancy outcomes in 192 cases with syphilis%妊娠合并梅毒192例妊娠结局分析

    Institute of Scientific and Technical Information of China (English)

    王翠敏; 王根菊; 韩国荣; 江红秀; 丁祎

    2015-01-01

    Objective To analyze the relationship between rapid plasma regain(RPR) titer of syphilis and adverse pregnancy outcomes in pregnant woman with syphilis .Methods Screened by treponema pallidum particle agglutination (TPPA ) test ,RPR titer of syphilis was examined in 192 pregnant women with syphilis before delivery .Adverse pregnancy outcomes were analyzed and compared between the pregnant women with syphilis treated by anti-syphilis therapy (group A ,162 cases) and those without treatment (group B ,30 cases ) .Results The risks for malformation , stillbirth ,congenital syphilis ,preterm birth and neonatal death were increased as RPR titer of syphilis elevated .The incidence rates of preterm birth ,neonatal malformation ,and congenital syphilis were higher in the cases with RPR titer of syphilis ≥1:8 than those ≤1:4(P<0 .05) .The incidence rates of neonatal malformation ,congenital syphilis and neonatal death were higher in group A than those in group B(P<0 .05) .Conclusion The risks for adverse pregnancy outcomes are increased as RPR titer of syphilis increases in pregnant woman with syphilis .The pregnancy outcomes can be improved significantly by anti-syphilis therapy in pregnant woman with syphilis .%目的 探讨妊娠梅毒快速血浆反应试验(RPR)滴度与妊娠不良结局的关系.方法 经梅毒螺旋体颗粒凝集试验(T PPA )筛查 ,对妊娠合并梅毒患者共192例孕母分娩前外周血检测RPR滴度 ,分析妊娠不良结局 ,比较孕期抗梅毒治疗组(162例)与未治疗组(30例)妊娠并发症及新生儿不良结局发生率.结果 随着孕母RPR滴度的升高 ,畸形、死胎、早产、先天性梅毒及新生儿死亡的风险升高.孕母RPR滴度≥1:8时早产、新生儿畸形和先天性梅毒发生率高于RPR滴度≤1:4者(P<0 .05).未治疗组新生儿畸形、先天性梅毒和死胎发生率高于治疗组(P<0 .05).结论 随着孕母RPR滴度的升高 ,妊娠不良结局风险升高;抗梅毒治疗能

  4. Retreatment of recurrent carcinoma of the head and neck by afterloading interstitial 192Ir implant

    Energy Technology Data Exchange (ETDEWEB)

    Emami, B.; Marks, J.E.

    1983-10-01

    From January 1975 to December 1980, 25 patients with persistent or recurrent carcinomas of the head and neck were retreated for palliation at the Division of Radiation Oncology, Mallinckrodt Institute of Radiology. These patients had all undergone extensive previous treatment by surgery and/or radiation. All were retreated with 192Ir interstitial implant with or without external radiation and/or surgical excision. Of 25 patients, 13 had complete response (CR) and 6 had partial response for a follow-up period of 1 to 7 years. Of 13 patients with CR, 6 are alive with no evidence of disease (NED) and two died NED. Detailed results are presented and the new strategy for such patients is discussed.

  5. Leach test of six 192-iridium pellets based on the IAEA 'special form' test procedures

    International Nuclear Information System (INIS)

    The designation 'special form' may be applied to indispersible solid radioactive material if the material meets the requirements of the tests described in the International Atomic Energy Agency Regulations for the Safe Transport of Radioactive Type Materials. This report presents the procedures and results of a leach test performed as specified in the regulations on 6 'as received' active 192-iridium pellets. Mechanical tests were not carried out prior to or following the leach test. The activity of each of the first 6 water baths was found to be between 2.3 and 12.6 μCi, (8.5 x 104 and 4.7 x 105 Bq) and of the second 6, between 1.3 to 6.0 μCi, (4.8 x 104 to 2.2 x 105 Bq) thus exceeding the allowable limit

  6. Isomers and excitation modes in the gamma-soft nucleus 192Os

    International Nuclear Information System (INIS)

    New spectroscopic results for high-spin states in 192Os populated in deep-inelastic reactions include the identification of a 2-ns, 12+ isomeric state at 2865 keV and a 295-ns, 20+ state at 4580 keV and their associated ΔJ=2 sequences. The structures are interpreted as manifestations of maximal rotation alignment within the neutron i13/2 and proton h11/2 shells at oblate deformation. Rotational band members based on the long-lived, Kπ=10− isomer are also identified for the first time. Configuration-constrained, potential-energy-surface calculations predict that other prolate multi-quasiparticle high-K states should exist at low energy

  7. Retreatment of recurrent carcinoma of the head and neck by afterloading interstitial 192Ir implant

    International Nuclear Information System (INIS)

    From January 1975 to December 1980, 25 patients with persistent or recurrent carcinomas of the head and neck were retreated for palliation at the Division of Radiation Oncology, Mallinckrodt Institute of Radiology. These patients had all undergone extensive previous treatment by surgery and/or radiation. All were retreated with 192Ir interstitial implant with or without external radiation and/or surgical excision. Of 25 patients, 13 had complete response (CR) and 6 had partial response for a follow-up period of 1 to 7 years. Of 13 patients with CR, 6 are alive with no evidence of disease (NED) and two died NED. Detailed results are presented and the new strategy for such patients is discussed

  8. Standardization of iridium-192 coiled source in terms of air kerma output

    International Nuclear Information System (INIS)

    ICRU (1985) recommended that the output of gamma ray brachytherapy sources should be specified in terms of reference air kerma rate, defined as the kerma rate to air in air at a reference distance of 1 meter, perpendicular to the long axis of the source, corrected for air attenuation and scattering. As these measurements are difficult to carry out in the routine clinical use, it is the common practice to calibrate the re-entrant ionization chamber with respect to open air measurements and use the re-entrant chamber for routine measurements. This paper reports on the measurements carried out to correlate the nominal activity and air kerma rate of 192Ir wire sources supplied by the Board of Radiation and Isotope Technology, Department of Atomic Energy. (author). 3 refs, 1 tab

  9. Interstitial iridium-192 implantation for malignant brain tumours: Pt. 2. Clinical experience

    Energy Technology Data Exchange (ETDEWEB)

    Chun, M.; McKeough, P.; Wu, A.; Kasdon, D.; Heros, D.; Chang, H.

    1989-02-01

    The treatment results of 37 patients with malignant brain neoplasms treated with a computed-tomography-guided stereotactic iridium-192 implant are reviewed. Of these, 29 patients with high-grade gliomas (20 with glioblastoma multiforme (GBM), nine with anaplastic astrocytoma (AA)) received an implant as part of their initial management. The median survival was 14.5 and 15.5 months in the patients with previously untreated GBM and AA, respectively. In those patients with recurrent tumour after external-beam irradiation, durable local control over a year was achieved with implantation. Increasing the total tumour dose from 120 to 160 Gy did not improve survival or local control. Karnofsky Performance Status (KPS) was used as an indicator of quality of life and was seen to decrease with a median interval of 8.5 months following treatment. No severe complications were noted in the entire group of patients treated with this implant procedure.

  10. Wall Thickness Measurement Of Insulated Pipe By Tangential Radiography Technique Using Ir 192

    International Nuclear Information System (INIS)

    Insulation pipe wall thickness by tangential radiography technique has been carried out using 41 Curie Iridium 192 source has activity for two carbon steel pipes. The outer diameter of the first pipe is 90 mm, wall thickness is 75.0 mm, source film film distance is 609.5 mm, source tangential point of insulation is 489.5 mm and exposure time 3 minute and 25 second. From the calculation, the first pipe thickness is found to be 12.54 mm and for the second pipe is 8.42 mm. The thickness is due to inaccuracy in reading the pipe thickness on radiography film and the geometry distortion radiation path

  11. Quality control for cervical cancer treatments on Hdr brachytherapy with Ir-192

    International Nuclear Information System (INIS)

    This work, developed at the National Cancer Institute in partnership with Universidad Nacional de Colombia located in Bogota, Colombia, presents the results of simulations of cervical cancer treatments, on Hdr brachytherapy with Ir-192, using as a physical simulator a natural female pelvis bone with soft tissue elaborated with the experimental material JJT. The doses were measured experimentally, prior to dosimetric characterization, with crystal thermoluminescence 100 LiF: Mg, Ti, located in the organs at risk: rectum and bladder. On the other hand, these treatments were planned and calculated theoretically by the system Micro-Selectron Hdr, with Plato brachytherapy software V 14.1 from the Netherlands Nucletron, and doses obtained in the same organs were compared with experimental results using dosimeters. The comparison of these results shows the correlation degree between the planning of dosimetric treatments and the experimental results, making the process in a form of quality control in vivo, of this type of procedure. (Author)

  12. Oscillation up to 1.92 THz in resonant tunneling diode by reduced conduction loss

    Science.gov (United States)

    Maekawa, Takeru; Kanaya, Hidetoshi; Suzuki, Safumi; Asada, Masahiro

    2016-02-01

    A large increase in oscillation frequency was achieved in resonant-tunneling-diode (RTD) terahertz oscillators by reducing the conduction loss. An n+-InGaAs layer under the air-bridge electrode connected to the RTD was observed to cause a large conduction loss for high-frequency current due to the skin effect. By introducing a new fabrication process removing the InGaAs layer, we obtained 1.92-THz oscillation, which extended the highest frequency of room-temperature electronic single oscillators. Theoretical calculations reasonably agreed with the experiment, and an oscillation above 2 THz is further expected with an improved structure of the slot antenna used as a resonator and radiator.

  13. HDR {sup 192}Ir source speed measurements using a high speed video camera

    Energy Technology Data Exchange (ETDEWEB)

    Fonseca, Gabriel P. [Instituto de Pesquisas Energéticas e Nucleares—IPEN-CNEN/SP, São Paulo 05508-000, Brazil and Department of Radiation Oncology (MAASTRO), GROW School for Oncology and Developmental Biology, Maastricht University Medical Center, Maastricht 6201 BN (Netherlands); Viana, Rodrigo S. S.; Yoriyaz, Hélio [Instituto de Pesquisas Energéticas e Nucleares—IPEN-CNEN/SP, São Paulo 05508-000 (Brazil); Podesta, Mark [Department of Radiation Oncology (MAASTRO), GROW School for Oncology and Developmental Biology, Maastricht University Medical Center, Maastricht 6201 BN (Netherlands); Rubo, Rodrigo A.; Sales, Camila P. de [Hospital das Clínicas da Universidade de São Paulo—HC/FMUSP, São Paulo 05508-000 (Brazil); Reniers, Brigitte [Department of Radiation Oncology - MAASTRO, GROW School for Oncology and Developmental Biology, Maastricht University Medical Center, Maastricht 6201 BN (Netherlands); Research Group NuTeC, CMK, Hasselt University, Agoralaan Gebouw H, Diepenbeek B-3590 (Belgium); Verhaegen, Frank, E-mail: frank.verhaegen@maastro.nl [Department of Radiation Oncology - MAASTRO, GROW School for Oncology and Developmental Biology, Maastricht University Medical Center, Maastricht 6201 BN (Netherlands); Medical Physics Unit, Department of Oncology, McGill University, Montréal, Québec H3G 1A4 (Canada)

    2015-01-15

    Purpose: The dose delivered with a HDR {sup 192}Ir afterloader can be separated into a dwell component, and a transit component resulting from the source movement. The transit component is directly dependent on the source speed profile and it is the goal of this study to measure accurate source speed profiles. Methods: A high speed video camera was used to record the movement of a {sup 192}Ir source (Nucletron, an Elekta company, Stockholm, Sweden) for interdwell distances of 0.25–5 cm with dwell times of 0.1, 1, and 2 s. Transit dose distributions were calculated using a Monte Carlo code simulating the source movement. Results: The source stops at each dwell position oscillating around the desired position for a duration up to (0.026 ± 0.005) s. The source speed profile shows variations between 0 and 81 cm/s with average speed of ∼33 cm/s for most of the interdwell distances. The source stops for up to (0.005 ± 0.001) s at nonprogrammed positions in between two programmed dwell positions. The dwell time correction applied by the manufacturer compensates the transit dose between the dwell positions leading to a maximum overdose of 41 mGy for the considered cases and assuming an air-kerma strength of 48 000 U. The transit dose component is not uniformly distributed leading to over and underdoses, which is within 1.4% for commonly prescribed doses (3–10 Gy). Conclusions: The source maintains its speed even for the short interdwell distances. Dose variations due to the transit dose component are much lower than the prescribed treatment doses for brachytherapy, although transit dose component should be evaluated individually for clinical cases.

  14. Development of the doubly sealed Ir192 sources for industrial applications

    International Nuclear Information System (INIS)

    A Program for Developing Double Sealed Irradiation Sources for industrial and medical applications is in progress at the Argentine Atomic Energy Commission. The present work describes the mechanical and metallurgical procedures for designing and welding dummy capsules of the two types that are required for making double sealed Ir192 industrial sources with the designation ISO/98/C43515 according to ISO 2919 and leak tight according to ISO/98/9978 standards. That is part of a Project with INVAP company. Four different models, including the typical international model, were designed, machined and TIG-welded. Both the internal and external capsules and the end caps were made from AISI 316L stainless steel. Two types of welding station were made. In the first one the 'end cap' was welded to the capsule keeping the torch and the capsule fixed (stationary process), while in the second type the capsule rotates around its own axes during the process (out of cell dynamic semiautomatic controlled process). The welding parameters for the second welding process were selected from the different parameters used to process 120 'international type' capsules. All the processed units were subject to a visual inspection, 85% of them were considered acceptable, while the rest were rejected because of having, at naked eyes and/or under magnification glasses, different types of welding defects. Metallographic examination of the microstructure at the welding seam and the matrix were made in welded unit selected at random from different lots of all processed units in order to determine the penetration of the weld and the microstructure of the weld seam. Present results are encouraging enough to consider to start with the next step, where the capsules are process inside a 'hot cell' and with a Ir192 foil inside the inner capsule to reproduce actual fabrication conditions. (author)

  15. On source models for (192)Ir HDR brachytherapy dosimetry using model based algorithms.

    Science.gov (United States)

    Pantelis, Evaggelos; Zourari, Kyveli; Zoros, Emmanouil; Lahanas, Vasileios; Karaiskos, Pantelis; Papagiannis, Panagiotis

    2016-06-01

    A source model is a prerequisite of all model based dose calculation algorithms. Besides direct simulation, the use of pre-calculated phase space files (phsp source models) and parameterized phsp source models has been proposed for Monte Carlo (MC) to promote efficiency and ease of implementation in obtaining photon energy, position and direction. In this work, a phsp file for a generic (192)Ir source design (Ballester et al 2015) is obtained from MC simulation. This is used to configure a parameterized phsp source model comprising appropriate probability density functions (PDFs) and a sampling procedure. According to phsp data analysis 15.6% of the generated photons are absorbed within the source, and 90.4% of the emergent photons are primary. The PDFs for sampling photon energy and direction relative to the source long axis, depend on the position of photon emergence. Photons emerge mainly from the cylindrical source surface with a constant probability over  ±0.1 cm from the center of the 0.35 cm long source core, and only 1.7% and 0.2% emerge from the source tip and drive wire, respectively. Based on these findings, an analytical parameterized source model is prepared for the calculation of the PDFs from data of source geometry and materials, without the need for a phsp file. The PDFs from the analytical parameterized source model are in close agreement with those employed in the parameterized phsp source model. This agreement prompted the proposal of a purely analytical source model based on isotropic emission of photons generated homogeneously within the source core with energy sampled from the (192)Ir spectrum, and the assignment of a weight according to attenuation within the source. Comparison of single source dosimetry data obtained from detailed MC simulation and the proposed analytical source model show agreement better than 2% except for points lying close to the source longitudinal axis. PMID:27191179

  16. On source models for 192Ir HDR brachytherapy dosimetry using model based algorithms

    Science.gov (United States)

    Pantelis, Evaggelos; Zourari, Kyveli; Zoros, Emmanouil; Lahanas, Vasileios; Karaiskos, Pantelis; Papagiannis, Panagiotis

    2016-06-01

    A source model is a prerequisite of all model based dose calculation algorithms. Besides direct simulation, the use of pre-calculated phase space files (phsp source models) and parameterized phsp source models has been proposed for Monte Carlo (MC) to promote efficiency and ease of implementation in obtaining photon energy, position and direction. In this work, a phsp file for a generic 192Ir source design (Ballester et al 2015) is obtained from MC simulation. This is used to configure a parameterized phsp source model comprising appropriate probability density functions (PDFs) and a sampling procedure. According to phsp data analysis 15.6% of the generated photons are absorbed within the source, and 90.4% of the emergent photons are primary. The PDFs for sampling photon energy and direction relative to the source long axis, depend on the position of photon emergence. Photons emerge mainly from the cylindrical source surface with a constant probability over  ±0.1 cm from the center of the 0.35 cm long source core, and only 1.7% and 0.2% emerge from the source tip and drive wire, respectively. Based on these findings, an analytical parameterized source model is prepared for the calculation of the PDFs from data of source geometry and materials, without the need for a phsp file. The PDFs from the analytical parameterized source model are in close agreement with those employed in the parameterized phsp source model. This agreement prompted the proposal of a purely analytical source model based on isotropic emission of photons generated homogeneously within the source core with energy sampled from the 192Ir spectrum, and the assignment of a weight according to attenuation within the source. Comparison of single source dosimetry data obtained from detailed MC simulation and the proposed analytical source model show agreement better than 2% except for points lying close to the source longitudinal axis.

  17. HDR 192Ir source speed measurements using a high speed video camera

    International Nuclear Information System (INIS)

    Purpose: The dose delivered with a HDR 192Ir afterloader can be separated into a dwell component, and a transit component resulting from the source movement. The transit component is directly dependent on the source speed profile and it is the goal of this study to measure accurate source speed profiles. Methods: A high speed video camera was used to record the movement of a 192Ir source (Nucletron, an Elekta company, Stockholm, Sweden) for interdwell distances of 0.25–5 cm with dwell times of 0.1, 1, and 2 s. Transit dose distributions were calculated using a Monte Carlo code simulating the source movement. Results: The source stops at each dwell position oscillating around the desired position for a duration up to (0.026 ± 0.005) s. The source speed profile shows variations between 0 and 81 cm/s with average speed of ∼33 cm/s for most of the interdwell distances. The source stops for up to (0.005 ± 0.001) s at nonprogrammed positions in between two programmed dwell positions. The dwell time correction applied by the manufacturer compensates the transit dose between the dwell positions leading to a maximum overdose of 41 mGy for the considered cases and assuming an air-kerma strength of 48 000 U. The transit dose component is not uniformly distributed leading to over and underdoses, which is within 1.4% for commonly prescribed doses (3–10 Gy). Conclusions: The source maintains its speed even for the short interdwell distances. Dose variations due to the transit dose component are much lower than the prescribed treatment doses for brachytherapy, although transit dose component should be evaluated individually for clinical cases

  18. Determination of the G value for HDR 192Ir sources using ionometric measurements

    International Nuclear Information System (INIS)

    A dosimetry standard for the direct measurement of absolute dose to water for 192Ir source is currently still under development. For the time being, the dose to water conversion is done via a dose rate constant Λ and several correction factors accounting for scatter, attenuation, and anisotropy of the dose distribution among other effects. Recently a report has been published on a water-based calorimeter with an overall uncertainties of 1.9 % k=1. Chemical dosimetry using a standard FeS04 solution has shown to be a reliable absorbed dose standard. Absolute absorbed dose to water measurement has been explored using Fricke for 192Ir HDR sources with uncertainties estimated of 3.9 % k=1 and very recently similar work has reported improved results with much lower uncertainties of 1.24% k=1. The G values previously reported is the major uncertainty associated to this technique and this paper presents new G values measured with ion chambers using recent dosimetry protocols. For this study, the source was positioned in a PMMA holder with its center coinciding with the center of a Framer type the ion chamber and the Fricke solution holder. The solution container was constructed with the same volume and dimensions of the ion chamber. The measurements were taken with the ion chamber placed in one of the holders and the Fricke solutions in the other three holders. The chamber and the Fricke were irradiated in all four times around the source in order to minimize the positioning uncertainties and the average reading values for each one were taken. For the 60Co and 6 MV, the beam measurements were made with the chamber at the center and the solutions on each side

  19. 49 CFR 192.915 - What knowledge and training must personnel have to carry out an integrity management program?

    Science.gov (United States)

    2010-10-01

    ...: MINIMUM FEDERAL SAFETY STANDARDS Gas Transmission Pipeline Integrity Management § 192.915 What knowledge... to the integrity management program possesses and maintains a thorough knowledge of the integrity... 49 Transportation 3 2010-10-01 2010-10-01 false What knowledge and training must personnel have...

  20. The determination of Q192R polymorphism of paraoxonase 1 by using non-toxic substrate p-nitrophenylacetate

    Directory of Open Access Journals (Sweden)

    M R Mogarekar

    2013-01-01

    Conclusion: The Q192R polymorphism of PON1 by using non-toxic substrate p-nitrophenylacetate showed trimodal distribution of QQ (homozygous, QR (heterozygous, and RR (homozygous phenotype and it is comparable with reference method. This method can be used for PON1 phenotype in different pathological and complex disease conditions.

  1. The microscopic approach of sdgIBM-1 and study of the 192,190,188Os isotopes

    International Nuclear Information System (INIS)

    From the shell model configurations, valence nucleon effective interactions and fermion E2 transition operator, the sdgIBM-1 Hamiltonian and boson E2 transition operator are derived microscopically with the help of Dyson boson expansion technique. Spectra and reduced E2 matrix elements are calculated for the 192,190,188Os isotopes. Present theoretical results fit experimental data quite well

  2. 41 CFR 102-192.175 - What types of support does GSA offer to Federal agency mail management programs?

    Science.gov (United States)

    2010-07-01

    ... in mail management and mail operations; (b) Identifying better business practices and sharing them... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What types of support...-192.175 What types of support does GSA offer to Federal agency mail management programs? GSA...

  3. Microdosimetric spread for cell-sized targets exposed to 60Co, 192Ir and 125I sources

    International Nuclear Information System (INIS)

    The magnitude of the spread in specific energy deposition per cell may be a confounding factor in dose- response analysis motivating derivation of explicit data for the most common brachytherapy isotopes 125I and 192Ir, and for 60Co radiation frequently used as reference in RBE studies. The aim of this study is to analyse the microdosimetric spread as given by the frequency distribution of specific energy for a range of doses imparted by 125I, 192Ir and 60Co sources. An upgraded version of the Monte Carlo code PENELOPE was used for scoring energy deposition distributions in liquid water for each of the radiation qualities. Frequency distributions of specific energy were calculated according to the formalism of Kellerer and Chmelevsky. Results indicate that the magnitude of the microdosimetric spread increases with decreasing target size and decreasing energy of the radiation quality. Within the clinical relevant dose range (1 to 100 Gy), the spread does not exceed 4 % for 60Co, 5 % for 192Ir and 6 % for 125I. The frequency distributions can be accurately approximated with symmetrical normal distributions at doses down to 0.2 Gy for 60Co, 0.1 Gy for 192Ir and 0.08 Gy for 125I. (authors)

  4. Astatination of closo-dodecaborate(2-) anion

    Czech Academy of Sciences Publication Activity Database

    Orlova, A.; Lebeda, Ondřej; Tolmachev, V.; Lundquist, H.; Carlsson, J.; Sjöberg, S.

    Cambridge : The Royal Society of Chemistry , 2000 - (Davidson, M.; Hughes, A.; Marder, T.; Wade , K.), s. 144-147 [Conference "Contemporary Boron Chemistry ". Durham (GB), 11.07.1999-15.07.1999] Institutional research plan: CEZ:AV0Z1048901 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  5. Maternal exposure to floricultural work during pregnancy, PON1 Q192R polymorphisms and the risk of low birth weight

    International Nuclear Information System (INIS)

    Background: Although there is evidence from animal studies of impaired reproductive function by exposure to organophosphates (OP), the effects on birth weight have not been sufficiently evaluated in epidemiological studies. Paraoxonase (PON1) detoxifies organophosphates by cleavage of active oxons. Some PON1 gene polymorphisms could reduce the enzyme activity and increase susceptibility to OP toxicity. Objective: To assess the association between maternal exposure to floriculture during pregnancy and the risk of low birth weight (< 2500 g) in their offspring, as well as to evaluate the interaction between this exposure and maternal genotype for PON1 Q192R polymorphisms. Materials and methods: A cross sectional study was carried out in two Mexican states (States of Mexico and Morelos) with high frequencies of greenhouse activity. We interviewed and collected blood samples from 264 females (floriculturists or partners of floricultural workers) who became pregnant during the 10 years prior to the interview. The questionnaire measured socioeconomic characteristics, tobacco and alcohol consumption, diseases and occupational and reproductive history. We also applied a food frequency questionnaire. Information was obtained pertaining to 467 pregnancies. DNA was extracted from white cells, and PON1 genotype was determined by Restriction Fragment Length Polymorphism for Q192R polymorphisms. Results were analyzed with generalized estimating equations models. Results: After adjusting for potential confounders, we detected a statistically significant interaction between maternal exposure to flower growing work during pregnancy and PON1 Q192R polymorphisms on risk of low birth weight. The risk of having a baby with LBW is nearly six times higher if a mother is a floriculture worker during pregnancy and has PON1 192RR genotype (OR 5.93, 95% CI 1.28, 27.5). Conclusion: These results suggest that the interaction between maternal floriculture work during pregnancy and 192RR PON1

  6. Balloon-based adjuvant radiotherapy in breast cancer: comparison between 99mTc and HDR 192Ir*

    Science.gov (United States)

    de Campos, Tarcísio Passos Ribeiro; de Lima, Carla Flavia; Cuperschmid, Ethel Mizrahy

    2016-01-01

    Objective To perform a comparative dosimetric analysis, based on computer simulations, of temporary balloon implants with 99mTc and balloon brachytherapy with high-dose-rate (HDR) 192Ir, as boosts to radiotherapy. We hypothesized that the two techniques would produce equivalent doses under pre-established conditions of activity and exposure time. Materials and Methods Simulations of implants with 99mTc-filled and HDR 192Ir-filled balloons were performed with the Siscodes/MCNP5, modeling in voxels a magnetic resonance imaging set related to a young female. Spatial dose rate distributions were determined. In the dosimetric analysis of the protocols, the exposure time and the level of activity required were specified. Results The 99mTc balloon presented a weighted dose rate in the tumor bed of 0.428 cGy.h-1.mCi-1 and 0.190 cGyh-1.mCi-1 at the balloon surface and at 8-10 mm from the surface, respectively, compared with 0.499 and 0.150 cGyh-1.mCi-1, respectively, for the HDR 192Ir balloon. An exposure time of 24 hours was required for the 99mTc balloon to produce a boost of 10.14 Gy with 1.0 Ci, whereas only 24 minutes with 10.0 Ci segments were required for the HDR 192Ir balloon to produce a boost of 5.14 Gy at the same reference point, or 10.28 Gy in two 24-minutes fractions. Conclusion Temporary 99mTc balloon implantation is an attractive option for adjuvant radiotherapy in breast cancer, because of its availability, economic viability, and similar dosimetry in comparison with the use of HDR 192Ir balloon implantation, which is the current standard in clinical practice. PMID:27141131

  7. Dosimetry of HDR afterloading machines with Ir-192- und Co-60-sources. Comparison of different international protocols

    International Nuclear Information System (INIS)

    The air kerma rate in air at a reference distance of 1 meter from the source is the recommended quantity for the specification of gamma ray source in brachytherapy. The absorbed dose for the patients is directly proportional to the air kerma rate. Therefore the air kerma rate should be determined before the first use of the source on patients by a medical physicist who is independent from the source manufacturer. The air kerma rate will then be applied in the calculation of the dose delivered to patients. In practice, high dose rate (HDR) Ir-192 afterloading machines are mostly used in brachytherapy treatment. Currently HDR-Co-60 increasingly come into operation, too. The essential advantage of the use of Co-60 sources is its longer half-life compared to Ir-192. In addition, the purchasing and disposal costs are lower. The use of HDR-Co-60- afterloading machines is also quite interesting for developing countries. This work describes the dosimetry at HDR afterloading machines according to the protocols DIN 6809-2 (1993) in relation to the DGMP-Report 13 (2006), IAEA-TECDOC-1274 (2002) and AAPM Report 41 (1993) with the nuclides Ir-192 and Co-60. We have used 3 different measurement methods (with a cylindrical chamber in solid phantom and in free air and with a well chamber) in dependence of each of the protocols. We have shown that the standard deviations of the measured air kerma rate for the Co-60 source are generally larger than those of the Ir-192 source. The measurements with the well chamber had the lowest deviation from the certificate value. In all protocols and methods the deviations stood for both nuclides by a maximum of about 1.2% for Ir-192 and 2.5% for Co-60-sources respectively. (orig.)

  8. Maternal exposure to floricultural work during pregnancy, PON1 Q192R polymorphisms and the risk of low birth weight

    Energy Technology Data Exchange (ETDEWEB)

    Moreno-Banda, G.; Blanco-Munoz, J. [Population Health Research Center, National Institute of Public Health, Avenida Universidad 655, Colonia Santa Maria Ahuacatitlan, 62508 Cuernavaca, Morelos (Mexico); Lacasana, M., E-mail: marina.lacasana.easp@juntadeandalucia.es [Andalusian School of Public Health, Campus Universitario de la Cartuja, Cuesta del Observatorio, 4, 18080 Granada (Spain); CIBER of Epidemiology and Public Health (CIBERESP) (Spain); Rothenberg, S.J. [Population Health Research Center, National Institute of Public Health, Avenida Universidad 655, Colonia Santa Maria Ahuacatitlan, 62508 Cuernavaca, Morelos (Mexico); Center of Research and Advanced Studies, National Institute Polytechnic, Department of Toxicology, Av, Instituto Politecnico Nacional No. 2508, Col. San Pedro Zacatenco, Deleg. Gustavo A. Madero, 07360 Mexico, D.F. (Mexico); Aguilar-Garduno, C. [Andalusian School of Public Health, Campus Universitario de la Cartuja, Cuesta del Observatorio, 4, 18080 Granada (Spain); Andalusian Observatory of Environmental Health, Campus Universitario de la Cartuja, Cuesta del Observatorio, 4, 18080 Granada (Spain); Gamboa, R. [Department of Physiology, National Institute of Cardiology ' Ignacio Chavez' , Juan Badiano 4, Section XVI, 14080, Mexico DF (Mexico); Perez-Mendez, O. [Department of Molecular Biology and cardiovascular Diseases Genomic and Proteomic, National Institute of Cardiology ' Ignacio Chavez' , Juan Badiano 4, Section XVI, 14080, Mexico DF (Mexico)

    2009-10-15

    Background: Although there is evidence from animal studies of impaired reproductive function by exposure to organophosphates (OP), the effects on birth weight have not been sufficiently evaluated in epidemiological studies. Paraoxonase (PON1) detoxifies organophosphates by cleavage of active oxons. Some PON1 gene polymorphisms could reduce the enzyme activity and increase susceptibility to OP toxicity. Objective: To assess the association between maternal exposure to floriculture during pregnancy and the risk of low birth weight (< 2500 g) in their offspring, as well as to evaluate the interaction between this exposure and maternal genotype for PON1 Q192R polymorphisms. Materials and methods: A cross sectional study was carried out in two Mexican states (States of Mexico and Morelos) with high frequencies of greenhouse activity. We interviewed and collected blood samples from 264 females (floriculturists or partners of floricultural workers) who became pregnant during the 10 years prior to the interview. The questionnaire measured socioeconomic characteristics, tobacco and alcohol consumption, diseases and occupational and reproductive history. We also applied a food frequency questionnaire. Information was obtained pertaining to 467 pregnancies. DNA was extracted from white cells, and PON1 genotype was determined by Restriction Fragment Length Polymorphism for Q192R polymorphisms. Results were analyzed with generalized estimating equations models. Results: After adjusting for potential confounders, we detected a statistically significant interaction between maternal exposure to flower growing work during pregnancy and PON1 Q192R polymorphisms on risk of low birth weight. The risk of having a baby with LBW is nearly six times higher if a mother is a floriculture worker during pregnancy and has PON1 192RR genotype (OR 5.93, 95% CI 1.28, 27.5). Conclusion: These results suggest that the interaction between maternal floriculture work during pregnancy and 192RR PON1

  9. Balloon-based adjuvant radiotherapy in breast cancer: comparison between {sup 99m}Tc and HDR {sup 192}Ir

    Energy Technology Data Exchange (ETDEWEB)

    Campos, Tarcisio Passos Ribeiro de; Lima, Carla Flavia de; Cuperschmid, Ethel Mizrahy, E-mail: tprcampos@pq.cnpq.br [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil)

    2016-03-15

    Objective: To perform a comparative dosimetric analysis, based on computer simulations, of temporary balloon implants with {sup 99m}Tc and balloon brachytherapy with high-dose-rate (HDR) {sup 192}Ir, as boosts to radiotherapy. We hypothesized that the two techniques would produce equivalent doses under pre-established conditions of activity and exposure time. Materials and methods: simulations of implants with {sup 99m}Tc-filled and HDR {sup 192}Ir-filled balloons were performed with the Siscodes/MCNP5, modeling in voxels a magnetic resonance imaging set related to a young female. Spatial dose rate distributions were determined. In the dosimetric analysis of the protocols, the exposure time and the level of activity required were specified. Results: the {sup 99m}Tc balloon presented a weighted dose rate in the tumor bed of 0.428 cGy.h{sup -1}.mCi{sup -1} and 0.190 cGyh{sup -1} at the balloon surface and at 8-10 mm from the surface, respectively, compared with 0.499 and 0.150 cGyh{sup -1}.mCi{sup -1}, respectively, for the HDR {sup 192}Ir balloon. An exposure time of 24 hours was required for the {sup 99m}Tc balloon to produce a boost of 10.14 Gy with 1.0 Ci, whereas only 24 minutes with 10.0 Ci segments were required for the HDR {sup 192}Ir balloon to produce a boost of 5.14 Gy at the same reference point, or 10.28 Gy in two 24-minutes fractions. Conclusion: temporary {sup 99m}Tc balloon implantation is an attractive option for adjuvant radiotherapy in breast cancer, because of its availability, economic viability, and similar dosimetry in comparison with the use of HDR {sup 192}Ir balloon implantation, which is the current standard in clinical practice. (author)

  10. p192sc.m77t and p192sc.h77t: MGD77T data and header files for single-beam bathymetry data for field activity P-1-92-SC in Santa Monica Basin, Southern California from 01/30/1992 to 02/04/1992

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with Loran-C and GPS navigation data was collected as part of the U.S. Geological Survey cruise P-1-92-SC. The cruise was...

  11. p192mb.m77t and p192mb.h77t: MGD77T data and header files for single-beam bathymetry data for field activity P-1-92-MB in Monterey Bay from 03/20/1992 to 03/22/1992

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with SINS navigation data was collected as part of the U.S. Geological Survey cruise P-1-92-MB. The cruise was conducted in...

  12. Comparison of calibration procedures for 192Ir high-dose-rate brachytherapy sources

    International Nuclear Information System (INIS)

    Purpose: To compare the efficacy of different calibration procedures for 192Ir high-dose-rate (HDR) brachytherapy sources and to determine their suitability in clinical practice. In addition the manufacturer's calibration is compared with our experimental measurements so that the accuracy of the source strength on the manufacturer certificate which is supplied with each new 192Ir source can be accessed. Methods and Materials: We compared three types of calibration system: well-type chambers (HDR-1000 and SDS), cylindrical phantom, and plate phantom. The total number of measurements we obtained was 365. The number of sources used for the calibration procedure comparison was 20 and the number used for comparison with the manufacturer's calibration was 46. This study was made during the period 1989-1997. Also, Physikalisch-Technische Bundesanstalt (PTB) calibrated one of our sources using their PTB protocol so that the results could be compared with our own. Results: The sensitivity of each system on scattering from the room walls was studied. It was found that different minimum lateral distances from the walls were required for the different systems tested: 15 cm and 25 cm for the well-type chambers, 75 cm for the cylindrical phantom, and 13 cm for the plate phantom. The minimum thickness required to reach phantom scattering saturation for the plate phantom setup is 24 cm. The influence of the applicator material used in the calibration setup was found to be 1.7% for the stainless steel dosimetry applicator compared to the plastic 5F applicator. The accuracy of source positioning within the applicator can lead to dosimetric errors of ±1.2% for the radial distance of 8.0 cm used with both solid phantoms. The change in the response for both well-type chambers was only 0.1% for changes in the source position within ±7.5 mm around the response peak. Good agreement was found between all dosimetry systems included in our study. Taking the HDR-1000 well-type chamber

  13. A CT-based analytical dose calculation method for HDR 192Ir brachytherapy

    International Nuclear Information System (INIS)

    Purpose: This article presents an analytical dose calculation method for high-dose-rate 192Ir brachytherapy, taking into account the effects of inhomogeneities and reduced photon backscatter near the skin. The adequacy of the Task Group 43 (TG-43) two-dimensional formalism for treatment planning is also assessed. Methods: The proposed method uses material composition and density data derived from computed tomography images. The primary and scatter dose distributions for each dwell position are calculated first as if the patient is an infinite water phantom. This is done using either TG-43 or a database of Monte Carlo (MC) dose distributions. The latter can be used to account for the effects of shielding in water. Subsequently, corrections for photon attenuation, scatter, and spectral variations along medium- or low-Z inhomogeneities are made according to the radiological paths determined by ray tracing. The scatter dose is then scaled by a correction factor that depends on the distances between the point of interest, the body contour, and the source position. Dose calculations are done for phantoms with tissue and lead inserts, as well as patient plans for head-and-neck, esophagus, and MammoSite balloon breast brachytherapy treatments. Gamma indices are evaluated using a dose-difference criterion of 3% and a distance-to-agreement criterion of 2 mm. PTRANCT MC calculations are used as the reference dose distributions. Results: For the phantom with tissue and lead inserts, the percentages of the voxels of interest passing the gamma criteria (Pγ≥1) are 100% for the analytical calculation and 91% for TG-43. For the breast patient plan, TG-43 overestimates the target volume receiving the prescribed dose by 4% and the dose to the hottest 0.1 cm3 of the skin by 9%, whereas the analytical and MC results agree within 0.4%. Pγ≥1 are 100% and 48% for the analytical and TG-43 calculations, respectively. For the head-and-neck and esophagus patient plans, Pγ≥1 are ≥99

  14. Vascular brachytherapy with 90Sr/Y versus 192Ir: A health physics perspective

    International Nuclear Information System (INIS)

    Purpose: Currently there are two ongoing trials of catheter based radiation therapy in the United States, the BERT Trial (Emory University, Atlanta, GA) and the SCRIPPS Trial (Scripps Clinic, La Jolla, CA). The BERT method involved the use of a treatment system to manually deliver a source train consisting of 12, encapsulated 90Sr/Y seeds of 3 cm total active length. The total activity of the source train was approximately 3.7 GBq. The SCRIPPS trial involved the use of a hand delivered 192Ir (BEST Industries) source train of either 5 or 9 sources with 1 mm spacing between the sources. The average total activity of the source train was 3.6 GBq ± 1.08 GBq. It is the purpose of this study to compare the patient dose and staff exposures from the above source trains. A comparison with exposures from use of fluoroscopy in the catheterization laboratory will also be made. Materials and Methods: Measurements made with a GM meter at specified locations around the BERT patients during the insertion of the seeds were compared with published information from the SCRIPPS Trial. Monte Carlo modeled measurements of the equivalent dose in humans from insertion of the source trains were also compared for both methods. The above were contrasted with GM measurements from use of fluoroscopy in the catheterization laboratory. Results: Average exposure rates recorded at the patient's chest and groin from the BERT method were 4.9x10-4 and 1.29x10-4 C/kg·hr respectively. Average exposures to the operator from the BERT method and the SCRIPPS method were 8.6x10-6 and 1.03x10-3 C/kg respectively. A typical exposure rate for conventional cardiac fluoroscopy is 3.9x10-3 C/kg·hr. Monte Carlo modeled calculations of patient dose equivalent for the BERT method and the SCRIPPS method were 0.43 μSv and 6.41 mSv respectively. Conclusions: Vascular brachytherapy performed with 90Sr/Y sources resulted in staff exposures of at least a factor of 120 less and patient doses of a factor of nearly 15

  15. An innovative method for {sup 192}Ir HDR calibration by farmer chamber, V-film, and solid phantom

    Energy Technology Data Exchange (ETDEWEB)

    Chang, Liyun; Ding, Hueisch-Jy [Department of Medical Imaging and Radiological Sciences, I-Shou University, Kaohsiung, Taiwan (China); Ho, Sheng-Yow, E-mail: shengho@seed.net.tw [Department of Radiation Oncology, Sinlau Christian Hospital, Tainan, Taiwan (China)

    2011-08-01

    A simple, practical and economical technique was proposed to calibrate an {sup 192}Ir HDR brachytherapy source in terms of air kerma strength. This technique makes use of the 0.6 cm{sup 3} Farmer type ion chamber, radiographic film and polystyrene phantom. These tools are commonly used for dosimetry quality assurance of the clinical linear accelerator. In this study, the Exradin A19, PTW N30004 and TM30001 Farmer type ion chambers were used for the calibration of the {sup 192}Ir HDR source. To perform the calibration, a 25.4x30.5 cm{sup 2} radiographic film was taped on a piece of polystyrene plate, and a straight applicator probe of a HDR brachytherapy unit and the Farmer type ion chamber were affixed to the film envelope. The film was irradiated by the {sup 192}Ir source, followed by an exposure in the simulator X-ray beam. The film set with the film removed was then placed on a 5 cm thick polystyrene phantom for calibration measurement. Based on the electrometer reading from the Farmer type ion chamber irradiated by {sup 192}Ir and the measured source-to-chamber distance by means of the images on the developed film, we can calculate the air kerma strength of the {sup 192}Ir using the new technique. Our calibration results were compared to the data provided by the manufacturer and that of five different well type ion chambers, namely, Sun Nuclear cooperation (SNC) 1008, Nucletron SDS 077.091, SDS 077.094, PTW TN33004 and Standard Imaging (SI) HDR-1000 Plus. The differences were all within 1.6%. Relative to the '7-distance measurement technique' by Stump et al., 2002, our method is more efficient if our empirical formula was used. In summary, our method is simpler and cost-effective to calibrate an {sup 192}Ir HDR brachytherapy source for those hospitals without a calibration jig or a well type ion chamber.

  16. Preparation and determination of kerma for Iridium 192 sources of low dose rate for brachytherapy; Preparacion y determinacion del kerma de fuentes de iridio-192 de baja tasa de dosis para braquiterapia

    Energy Technology Data Exchange (ETDEWEB)

    Tendilla, J.I.; Tovar M, V.; Mitsoura, E.; Aguilar H, F.; Alanis M, J. [Instituto Nacional de Investigaciones Nucleares, C.P. 52045-1, Salazar, Esrado de Mexico, D.F. (Mexico)

    2000-07-01

    The practice of Brachytherapy with Iridium-192 sources of low dose rate (0.4 - 0.8 Gy/h) is a technique used in the treatment of diverse illnesses. in this work the preparation, quality control and calibration are presented in terms of kerma in air of Iridium-192 using as target these recycled Iridium-Platinum wires. The targets were obtained as decayed sources of different radio therapeutical centers in the country and they were characterized by Scanning electron microscopy in order to determine their chemical composition. Subsequently it was developed an experimental design to establish the effect of neutron flux, geometrical array and irradiation time over the activity and percentage of the sources homogeneity. The homogeneity was determined by auto radiography and by Gamma spectroscopy. Once the optimal irradiation conditions were established, it is determined the apparent activity and kerma in air using a well type ionization chamber with traceability to a primary laboratory. Iridium-192 sources were obtained with an average homogeneity 96 %, apparent activity 282.129 {+-} 0.531 M Bq and kerma in air 0.03200 {+-} 0.00006 m Gy m/h A. (Author)

  17. Chemical constituents of marine mangrove-derived endophytic fungus Alternaria tenuissima EN-192

    Science.gov (United States)

    Sun, Hong; Gao, Shushan; Li, Xiaoming; Li, Chunshun; Wang, Bingui

    2013-03-01

    A chemical investigation of the ethyl acetate extract of the fermentation broth of Alternaria tenuissima EN-192, an endophytic fungus obtained from the stems of the marine mangrove plant Rhizophora stylosa, resulted in the isolation of nine known secondary metabolites, including four indole-diterpenoids: penijanthine A ( 1), paspaline ( 2), paspalinine ( 3), and penitrem A ( 4); three tricycloalternarene derivatives: tricycloalternarene 3a ( 5), tricycloalternarene 1b ( 6), and tricycloalternarene 2b ( 7); and two alternariol congeners: djalonensone ( 8) and alternariol ( 9). The chemical structures of these metabolites were characterized through a combination of detailed spectroscopic analyses and their comparison with reports from the literature. The inhibitory activities of each isolated compound against four bacteria were evaluated and compounds 5 and 8 displayed moderate activity against the aquaculture pathogenic bacterium Vibrio anguillarum, with inhibition zone diameters of 8 and 9 mm, respectively, at 100 μg/disk. To the best of our knowledge, this is the first report on the secondary metabolites of mangrove-derived A lternaria tenuissima and also the first report of the isolation of indole-diterpenoids from fungal genus A lternaria.

  18. Monte Carlo angular dose distribution of the microselectron HDR 192Ir brachytherapy source

    International Nuclear Information System (INIS)

    Polar dose profiles around the Nucletron MicroSelectron high dose rate (HDR) 192Ir brachytherapy source were calculated using the Monte Carlo radiation transport code MCNP (Monte Carlo N Particle) version 4A. The geometry modeled consisted of an identical simulation of the construction of the MicroSelectron HDR source located at the centre of a spherical water phantom of 100cm radius. Doses were calculated using a spherical coordinate system at 5 degree intervals (measured relative to the cable) at radii of 0.25, 0.5,1.0, 3.0, 5.0 and 7.0cm. These polar doses were compared to equivalent profiles from the Nucletron PLATO Brachytherapy Planning System (BPS) version 13.X. At 3.0, 5.0 and 7.0cm radii, the Monte Carlo and BPS profiles are generally within 3%. The near field polar dose profiles however, are in significant disagreement. At 1.0cm radius, the discrepancy can exceed 5%. At 0.5cm this figure rises to 15%, and even 60% at 0.25cm radius

  19. Calibration of Gammamed 12i 192Ir high dose rate source

    International Nuclear Information System (INIS)

    High-dose-rate (HDR) brachytherapy has been used in our department for cancer treatment for about three years. The HDR 192Ir source is usually calibrated using a well-type ionisation chamber or a thimble chamber free in air. This paper presents the calibration of 11 sources using Standard Imaging HDR1000 well chamber. We investigated the effect of location of the chamber in the room and scatter environment on output ionisation current and determined the most sensitive measurement point in the chamber. The largest discrepancy between the measured air kerma rate (AKR) and manufacturer's specification was 3.4%.These results were compared with calibration in the air done using the 0.6 ccm Farmer-type chamber, attached to a special lightweight holder. Instead of interpolative techniques recommended by either the IAEA or authorised laboratories, we used a calibration coefficient for 60Co quality only. Beside the conventional electrometer/chamber corrections, the exposure gradient corrections due to the finite dimensions of the chamber were employed. The influence of room scatter was also estimated. Preliminary results of calibration in air indicated that well chamber calibration and Farmer chamber calibration with 60Co calibration factor were within 2%.(author)

  20. Transperineal low-dose rate iridium-192 interstitial brachytherapy in cervical carcinoma stage IIB

    Energy Technology Data Exchange (ETDEWEB)

    Budrukkar, A.N.; Shrivastava, S.K.; Jalali, R.; Agarwal, J.P.; Dinshaw, K.A. [Tata Memorial Hospital, Parel, Mumbai (India). Dept. of Radiation Oncology; Deshpande, D.D.; Nehru, R.M. [Tata Memorial Hospital, Parel, Mumbai (India). Dept. of Medical Physics

    2001-10-01

    Purpose: To assess local control, survival and complications in patients with cervical carcinoma Stage IIB treated radically with transperineal Iridium-192 low-dose rate interstitial brachytherapy following external beam radiotherapy. Patients and Methods: 65 women (age 25-70 years, mean 47 years) with cervical carcinoma Stage IIB were initially treated with external beam radiotherapy on a telecobalt or 6 MW linear accelerator to a dose of 50 Gy delivered in 5-6 weeks. After 2-3 weeks of completing external radiation, patients received interstitial brachytherapy with Iridium-192 (activity 0.5-1 mCi/cm) using a Syed-Neblett perineal template. The median dose delivered to the implant volume was 24 Gy (range 20-32 Gy) delivered at an average dose rate of 0.70 Gy/h (range 0.40-1.20 Gy/h). A point defined at 1.5 cm lateral to the central uterine tandem at the level of os was taken as a representative for assessing the dose to the cervix. Mean doses delivered by interstitial brachytherapy to point A, cervix, point B and rectum were 38 Gy, 34 Gy, 16 Gy and 16 Gy, respectively. Results: At a median follow-up of 53 months, the actuarial disease free survival and overall survival for 65 patients at both 5 and 10 years was 64% and 44%, respectively. Response to radiotherapy was a strong predictor of local control with 82% of patients continuing to have pelvic control after initial complete response. Overall, nine (14%) patients had persistent disease, ten (15%) developed a central recurrence after initial control and three patients developed distant metastasis on follow-up. No patient had any immediate treatment-related complication. Late toxicity included grade I-II rectal reactions in five patients and grade IV bladder complication (vesico-vaginal fistula) in two patients. 5 years after treatment, one patient developed intestinal obstruction, which was relieved after conservative management. Two patients developed vaginal stenosis. The 5- and 10-year disease free survival

  1. Monte Carlo characterization of the Gamma-Med Hdr plus Ir-192 brachytherapy source

    International Nuclear Information System (INIS)

    Full text: The MCNP4C Monte Carlo code was used to simulate the dosimetry around the Gamma-Med Hdr Plus iridium-192 brachytherapy source in both air/vacuum and water environments. Dosimetry data in water was calculated and are presented into an away-along table. All dosimetric quantities recommended by the AAPM Task Group 43 report have been also calculated. These quantities are air kerma strength, dose rate constant, radial dose function and anisotropy function. The obtained data are compared to this source reference data, finding results in good agreement with them. In this study, recommendations of the AAPM TG-43U1 report have been followed and comply with the most recent AAPM and ESTRO physics committee recommendations about Monte Carlo techniques. The data in the present study complement published data and can be used as input in the Tps or as benchmark data to verify the results of the treatment planning systems as well as a means of comparison with other datasets from this source. (Author)

  2. Two proton high spin excitations and dipole bands in {sup 192}Hg

    Energy Technology Data Exchange (ETDEWEB)

    Le Coz, Y.; Astier, A.; Beraud, R.; Duffait, R.; Meyer, M.; Redon, N.; Bastin, G.; Deloncle, I.; Gall, B.; Hannachi, F.; Kaci, M.; Porquet, M.G.; Schueck, C.; Azaiez, F.; Bourgeois, C.; Duprat, J.; Korichi, A.; Perrin, N.; Poffe, N.; Sergolle, H.; Beausang, C.W.; Gale, S.J.; Joyce, M.J.; Paul, E.S.; Sharpey-Schafer, J.F.; Clark, R.M.; Hauschild, K.; Wadsworth, R.; Simpson, J.; Bentley, M.A.; Smith, G.; Huebel, H.; Willsau, P.; France, G. de; Ahmad, I.; Carpenter, M.; Henry, R.; Janssens, R.V.F.; Khoo, T.L.; Lauritsen, T. [Inst. de Physique Nucleaire de Lyon, IN2P3-CNRS, Univ. C. Bernard Lyon-1, 69 Villeurbanne (France)]|[Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse, IN2P3/CNRS, 91 Orsay (France)]|[Inst. de Physique Nucleaire, IN2P3/CNRS, 91 Orsay (France)]|[Univ. of Oxford, Dept. of Physics, Oxford (United Kingdom)]|[Oliver Lodge Lab., Univ. of Liverpool (United Kingdom)]|[Univ. of York, Dept. of Physics, Helsington (United Kingdom)]|[SERC, Daresbury Lab., Warrington (United Kingdom)]|[School of Sciences, Staffordshire Univ., Stoke on Trent (United Kingdom)]|[Schuster Lab., Univ. of Manchester (United Kingdom)]|[Inst. fuer Strahlen- und Kernphysik, Univ. Bonn (Germany)]|[Centre de Recherches Nucleaires, IN2P3/CNRS, Univ. L. Pasteur, 67 Strasbourg (France)]|[Argonne National Lab., IL (United States)

    1995-12-31

    The {sup 192}Hg nucleus has been produced via the {sup 36}S({sup 160}Gd, 4n) reaction at a beam energy of 159 MeV. The {gamma}-rays have been detected with the multidetector array EUROGAM phase 1. The level scheme has been extended up to 10.4 MeV excitation energy and spin 34. Two new structures, composed of competing {Delta}I = 1 and {Delta}I = 2 transitions, have been observed and, for the first time in Mercury isotopes, some links with the previously known low-lying states have been established. These experimental results are discussed in terms of mean-field Hartree-Fock plus BCS calculations and the new bands are proposed to originate from deformation-aligned quasi-proton excitations. {pi}(i{sub 13/2} * h{sub 9/2}){sub K}{sup {sub {pi}}} {sub =} {sub 11} and {pi}(h{sub 9/2}){sup 2}{sub K{pi}} {sub =} {sub 8} coupled to rotation-aligned quasi-neutrons v(i{sub 13/2}){sup n} and quasi-proton {pi}(h{sub 11/2}){sup 2} excitations. (orig.).

  3. Two proton high spin excitations and dipole bands in 192Hg

    International Nuclear Information System (INIS)

    The 192Hg nucleus has been produced via the 36S(160Gd, 4n) reaction at a beam energy of 159 MeV. The γ-rays have been detected with the multidetector array EUROGAM phase 1. The level scheme has been extended up to 10.4 MeV excitation energy and spin 34. Two new structures, composed of competing ΔI = 1 and ΔI = 2 transitions, have been observed and, for the first time in Mercury isotopes, some links with the previously known low-lying states have been established. These experimental results are discussed in terms of mean-field Hartree-Fock plus BCS calculations and the new bands are proposed to originate from deformation-aligned quasi-proton excitations. π(i13/2 * h9/2)Kπ=11 and π(h9/2)2Kπ=8 coupled to rotation-aligned quasi-neutrons v(i13/2)n and quasi-proton π(h11/2)2 excitations. (orig.)

  4. CT localization and stereotactic implantation of Ir192 into CNS neoplasms

    International Nuclear Information System (INIS)

    The authors describe their method for the localization of deep seated CNS tumors by tridimensional CT scanning and the utilization of this information in the stereotactic placement of Ir192 interstitially. The method allows the radiation dose to be administered within a relatively short period of time with the sources being removed before the tumor begins to degenerate, greatly reducing the period of time the patient is ''radioactive''. The outer catheter is fixed to a screw embedded in the skull, securing the sources in place, avoiding the possibility of movement of the wires as the tumor degenerates. The skin may be closed over the implantation system, thus reducing the risk of infection and CSF leakage. Three case studies are presented which indicate, together with more extensive experience of others, that the best candidates for interstitial irradiation are those with relatively deep seated lesions of low malignancy which, on three-dimensional reconstruction, have a well defined shape to which a conforming isodose curve can be fitted. (Auth./C.F.)

  5. Monte Carlo estimation of dose difference in lung from 192Ir brachytherapy due to tissue inhomogeneity

    International Nuclear Information System (INIS)

    Lung brachytherapy using high-dose rate 192Ir technique is a well-established technique of radiation therapy. However, many commercial treatment planning systems do not have the ability to consider the inhomogeneity of lung in relation to normal tissue. Under such circumstances dose calculations for tissues and organs at risk close to the target are inaccurate. The purpose of the current study was to estimate the dose difference due to tissue inhomogeneity using the Monte Carlo simulation code MCNP-5. Results showed that there was a relative sub dosage by treatment planning systems calculations in neighbouring tissues around the radioactive source due to inhomogeneity ignorance. The presence of lung instead of normal tissue resulted in an increase in relative dose, which approached 8 % at 4-cm distance from the source. Additionally, the relative increase was small for the lung (2.1 %) and larger for organs at risk such as the heart (6.8 %) and bone marrow (7.6 %). (authors)

  6. Chemical constituents of marine mangrove-derived endophytic fungus Alternaria tenuissima EN-192

    Institute of Scientific and Technical Information of China (English)

    SUN Hong; GAO Shushan; LI Xiaoming; LI Chunshun; WANG Bingui

    2013-01-01

    A chemical investigation of the ethyl acetate extract of the fermentation broth of Alternaria tenuissima EN-192,an endophytic fungus obtained from the stems of the marine mangrove plant Rhizophora stylosa,resulted in the isolation of nine known secondary metabolites,including four indole-diterpenoids:penijanthine A (1),paspaline (2),paspalinine (3),and penitrem A (4); three tricycloaltemarene derivatives:tricycloalternarene 3a (5),tricycloaltemarene lb (6),and tricycloalternarene 2b (7); and two altemariol congeners:djalonensone (8) and altemariol (9).The chemical structures of these metabolites were characterized through a combination of detailed spectroscopic analyses and their comparison with reports from the literature.The inhibitory activities of each isolated compound against four bacteria were evaluated and compounds 5 and 8 displayed moderate activity against the aquaculture pathogenic bacterium Vibrio anguillarum,with inhibition zone diameters of 8 and 9 mm,respectively,at 100 μ.g/disk.To the best of our knowledge,this is the first report on the secondary metabolites of mangrove-derived Alternaria tenuissima and also the first report of the isolation of indole-diterpenoids from fungal genus Alternaria.

  7. Quality control and enhancement of microwelds for Ir-192 sample holders

    International Nuclear Information System (INIS)

    This study shows the micro quality results of tungsten inert gas welds on stainless steel AISI 304 of 5 sample holders for 30 discs by 3 mm diameter and 0.5 mm thick of Ir-192 sources produced in the Radioisotope Production Plant (RPP) of IPEN, generally used in industrial gammagraphy. Macrographic and conventional metallographic analysis were performed to measure the amplitude, thickness and centering parameters of the weld bead, centered data have helped to determine the parameters for welds with good quality, showing defects due to the misaligned glass lens, low magnification image and high visual angle of incidence across the 200 mm security leaded glass giving a low quality weld image due to the low magnification, large chromatic aberration resulting in a weld outside the seam, this problem was solved by changing the old optical visualization system by an external telescope specially designed for this purpose and raising the workbench so that the optical telescope axis and the weld are horizontally, achieving more rapid processes, reliable and reproducible, this new system has proved more convenient, reliable and reproducible. (authors).

  8. Calibration of a 192Ir source for high dose brachytherapy using various techniques

    International Nuclear Information System (INIS)

    In this research we studied three experimental procedures for calibration of a source of 192Ir to high dose rate for clinical brachytherapy use, and thus were compared and analysis of the advantages and disadvantages of each. For this study we quantified the value of the current kerma rate reference in air by three procedures: source calibration using a well chamber, with an cylindrical ionization chamber in air, and a cylindrical ionization chamber on a phantom, and this magnitude was compared with the value provided by the manufacturer of the source and thereby obtaining the deviation corresponding . Thus, it was found that the deviation corresponding to the source calibration making use of a well chamber, remained within tolerance, while the cylindrical ionization chamber in air and on phantom exceeded the standards established in some documents. However, although both the measurement in air and in the phantom are the procedures for the final calibration source, these can be used to verify that the delivered dose are in tolerance.

  9. Monte Carlo characterization of the Gamma-Med Hdr plus Ir-192 brachytherapy source

    Energy Technology Data Exchange (ETDEWEB)

    Reyes, E.; Sosa, M. A.; Gil V, A. [Universidad de Guanajuato, Division de Ciencias e Ingenierias, Av. Insurgentes 2354, 37150 Leon, Guanajuato (Mexico); Monzon, E., E-mail: eric_1985@fisica.ugto.mx [IMSS, Unidad Medica de Alta Especialidad No. 1, Av. Adolfo Lopez Mateos 1813, 37340 Leon, Guanajuato (Mexico)

    2015-10-15

    Full text: The MCNP4C Monte Carlo code was used to simulate the dosimetry around the Gamma-Med Hdr Plus iridium-192 brachytherapy source in both air/vacuum and water environments. Dosimetry data in water was calculated and are presented into an away-along table. All dosimetric quantities recommended by the AAPM Task Group 43 report have been also calculated. These quantities are air kerma strength, dose rate constant, radial dose function and anisotropy function. The obtained data are compared to this source reference data, finding results in good agreement with them. In this study, recommendations of the AAPM TG-43U1 report have been followed and comply with the most recent AAPM and ESTRO physics committee recommendations about Monte Carlo techniques. The data in the present study complement published data and can be used as input in the Tps or as benchmark data to verify the results of the treatment planning systems as well as a means of comparison with other datasets from this source. (Author)

  10. Intercomparison of calibration procedures of high dose rate 192 Ir sources in Brazil and a proposal of a new methodology

    International Nuclear Information System (INIS)

    The objective of this paper is to report the results of an intercomparison of the calibration procedures for 192 Ir sources presently in use in Brazil and to proposal a calibration procedure to derive the Nk for a Farmer type ionization chamber for 192 Ir energy by interpolating from a 60 Co gamma-rays and 250 kV x-rays calibration factors. the intercomparison results were all within ± 3.0 % except one case where 4.6 % was observed and latter identified as a problem with N-k value for X-rays. The method proposed by the present work make possible the improvement of the metrological coherence among the calibration laboratories and their users once the Nk values could then provided by any of the members of SSDL network. (Author)

  11. Assessment of radiation dose for surrounding organs and persons approaching implanted patients upon brachytherapy of prostate cancer with Iridium-192

    International Nuclear Information System (INIS)

    To assess a proper dose for radiation therapy fitting the typical physical characteristics of male Korean bodies, a mathematical phantom was prepared based on standard Korean male measurements. Upon brachytherapy of prostate cancer by implanting 192Ir into the prostate gland (the source organ), the absorbed dose of the prostate gland and surrounding organs and the expected dose of people within the vicinity were assessed. 192Ir, which has been the radionuclide of choice for prostate cancer brachytherapy, was selected for the simulation. It was assumed that 1 Ci of initial radioactivity would be administered. As a result, 1.28 E-02 Gy/Ci was exhibited in the prostate gland of the source organ, and the dose to which persons within the vicinity were exposed was exhibited to be 9.19 E-06 Sv at a distance of 30 cm from the front. (authors)

  12. Evaluation of radiation dose on people adjacent to implant patients during brachytherapy for prostate cancer using {sup 192}Ir

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jung Hoon; Ko, Seong Jin; Kang, Se Sik; Kim, Chang Soo [Catholic University, Busan (Korea, Republic of)

    2009-10-15

    The incidence of prostate cancer is rapidly increasing due to aging of the population and westernization of dietary habits, etc. As a result, the frequency of prostate cancer has become the fifth highest among all male cancers and the first among urological cancers. Brachytherapy is commonly used for locally progressing prostate cancers. Since the mid 1980s, therapies using radio-isotopes, such as low-invasive {sup 125}I, {sup 103}Pd and {sup 192}Ir, have been widely performed in the U.S. and Europe. However, brachytherapy involves implanting radio-isotopes into the human body which is of concern because it may expose the health care professionals administering the therapy to unnecessary radiation. Accordingly, this study intends to predict the radiation dose that people adjacent to patients implanted with a radio-isotope are exposed to during prostate cancer radiation therapy by using a mathematical anthropomorphic phantom and {sup 192}Ir.

  13. Evaluation of radiation dose on people adjacent to implant patients during brachytherapy for prostate cancer using 192Ir

    International Nuclear Information System (INIS)

    The incidence of prostate cancer is rapidly increasing due to aging of the population and westernization of dietary habits, etc. As a result, the frequency of prostate cancer has become the fifth highest among all male cancers and the first among urological cancers. Brachytherapy is commonly used for locally progressing prostate cancers. Since the mid 1980s, therapies using radio-isotopes, such as low-invasive 125I, 103Pd and 192Ir, have been widely performed in the U.S. and Europe. However, brachytherapy involves implanting radio-isotopes into the human body which is of concern because it may expose the health care professionals administering the therapy to unnecessary radiation. Accordingly, this study intends to predict the radiation dose that people adjacent to patients implanted with a radio-isotope are exposed to during prostate cancer radiation therapy by using a mathematical anthropomorphic phantom and 192Ir

  14. A comparison of dosimetric parameters and dose distribution around CF -252 and IR-192 LDR Brachytherapy Sources

    International Nuclear Information System (INIS)

    Full text: The purpose of this work is the evaluation and comparison of the dose rate distributions around a 252Cf Applicator Tube (AT) and 192Ir LDR sources. The dosimetric parameters were determined for both sources according to the updated AAPM TG-43U1 protocol. The calculations were performed using the Monte Carlo N-particle MCNP code, version 5C. To validate the results of this study, they were compared to experimental and analytical dosimetric data available in the literature for similar source configurations. After validation, the Monte Carlo computer code was applied to investigate the difference between dose rate distributions around the two brachytherapy sources, with the purpose of comparing their efficiency in treatment. The data so obtained also provide further information about spatial dose distributions and are important for detailed treatment planning with 252 Cf or 192Ir LDR sources for interstitial and intracavitary therapy

  15. Correction factors for Farmer-type chambers for absorbed dose determination in 60Co and 192Ir brachytherapy dosimetry

    International Nuclear Information System (INIS)

    This paper presents experimentally determined correction factors for Farmer-type chambers for absorbed dose determination in 60Co and 192Ir brachytherapy dosimetry. The correction factors were determined from measurements made in a PMMA phantom and calculation of ratios of measured charges. The ratios were corrected for the different volumes of the ionization chambers, determined in external high-energy electron beams. The correction factors for the central electrode effect and the wall material dependency in 60Co brachytherapy dosimetry agree with those used in external 60Co beam dosimetry. In 192Ir dosimetry, the central aluminium electrode increases the response of an NE2571 chamber compared with that of a chamber with a central graphite electrode. The increase is 1.1 and 2.1% at 1.5 and 5.0 g cm-2 distance, respectively. Similar values are obtained with an NE2577 chamber. The wall correction factor in 192Ir dosimetry for a chamber with an A-150 wall has been determined to be 1.018, independent of the measurement distance. For a graphite walled chamber, the correction factor is 0.996 and 1.001 at 1.5 and 5.0 g cm-2 distance, respectively. The values of the wall correction factors are evaluated by a theory presented. If the chamber is used according to the 'large cavity' principle, the correction factor to account for the replacement of the phantom material by the ionization chamber was determined to be 0.982 for an NE2571 chamber when used with a Delrin cap, and 0.978 for an NE2581 when used with a polystyrene cap. The correction factors for the 'large cavity' principle are valid at both 60Co and 192Ir qualities. (author)

  16. The use of radioactive platinum-iridium (Ir-192) tags for locating honey bee queens in colonies (Hymenoptera: Apidae)

    International Nuclear Information System (INIS)

    Platinum-iridium (192Ir) wires were flattened to form tags 1.5 x 0.5 mm and attached to queen bees. The specific activity of each tag was approximately 25 μCi. No effect on fecundity or hive behaviour was noted. A manifold saving in time is to be realized in using this technique to locate queen bees in large late summer hives. (E.C.B.)

  17. Effect of surgical delay on outcome in hip fracture patients: a retrospective multivariate analysis of 192 patients

    OpenAIRE

    Verbeek, D. O.F.; Ponsen, K.J.; Goslings, J.C.; Heetveld, M.J.

    2007-01-01

    Previous studies have not demonstrated consistent results on the effect of surgical delay on outcome. This study investigated the association between the delay to surgery and the development of postoperative complications, length of hospital stay (LOS) and one-year mortality. Patients that underwent surgery for a hip fracture in a two-year period were included in a retrospective study. Uni- and multivariate regression analysis was performed in 192 hip fracture patients. There was a trend towa...

  18. Development of a water calorimetry-based standard for absorbed dose to water in HDR 192Ir brachytherapy

    International Nuclear Information System (INIS)

    Purpose: The aim of this article is to develop and evaluate a primary standard for HDR 192Ir brachytherapy based on 4 deg. C stagnant water calorimetry. Methods: The absolute absorbed dose to water was directly measured for several different Nucletron microSelectron 192Ir sources of air kerma strength ranging between 21 000 and 38 000 U and for source-to-detector separations ranging between 25 and 70 mm. The COMSOL MULTIPHYSICS software was used to accurately calculate the heat transport in a detailed model geometry. Through a coupling of the ''conduction and convection'' module with the ''Navier-Stokes incompressible fluid'' module in the software, both the conductive and convective effects were modeled. Results: A detailed uncertainty analysis resulted in an overall uncertainty in the absorbed dose of 1.90%(1σ). However, this includes a 1.5% uncertainty associated with a nonlinear predrift correction which can be substantially reduced if sufficient time is provided for the system to come to a new equilibrium in between successive calorimetric runs, an opportunity not available to the authors in their clinical setting due to time constraints on the machine. An average normalized dose rate of 361±7 μGy/(h U) at a source-to-detector separation of 55 mm was measured for the microSelectron 192Ir source based on water calorimetry. The measured absorbed dose per air kerma strength agreed to better than 0.8%(1σ) with independent ionization chamber and EBT-1 Gafchromic film reference dosimetry as well as with the currently accepted AAPM TG-43 protocol measurements. Conclusions: This work paves the way toward a primary absorbed dose to water standard in 192Ir brachytherapy.

  19. The influence of CYP 2C19*2 polymorphism on platelet function testing during single antiplatelet treatment with clopidogrel

    Directory of Open Access Journals (Sweden)

    Opstad Trine B

    2011-03-01

    Full Text Available Abstract Background Different platelet function tests can be used to evaluate the degree of achieved platelet inhibition in patients treated with clopidogrel. The presence of CYP 2C19*2 polymorphism can reduce the formation of the active metabolite of clopidogrel, resulting in less platelet inhibition. Patients and Methods Patients with symptomatic coronary artery disease, all on chronic single aspirin treatment were randomized to continue on aspirin or change to clopidogrel. In 219 randomly selected clopidogrel treated patients, platelet reactivity was evaluated by VASP-PRI determination and by use of VerifyNow P2Y12-PRU. The CYP 2C19*2 G/A polymorphism was further determined. Results The total frequency of clopidogrel resistance was 29.0% by VASP-PRI and 31.6% by VerifyNow-PRU. The number of patients being hetero- and homozygous combined for the CYP 2C19*2 polymorphism (GA/AA was 64 (29%. Platelet reactivity was significantly higher in patients with the polymorphism compared to wild-type patients (GG. VASP-PRI was 50.9% (SD19 in patients having the polymorphism compared to 38.3% (SD21 in patients with the GG genotype (p = 0.001. Correspondingly, the mean PRU was 165 (SD67 compared to 124 (SD69 (p Conclusions Clopidogrel treated patients with the CYP 2C19*2 polymorphism have significantly increased platelet reactivity compared to patients with the wild-type, evaluated with the VASP determination, and even more pronounced with the VerifyNow P2Y12 method. Trial Registration ClinicalTrials.gov: NCT00222261

  20. Dosimetric study of a brachytherapy treatment of esophagus with Brazilian 192Ir sources using an anthropomorphic phantom

    International Nuclear Information System (INIS)

    Several radioisotopes are produced at Instituto de Pesquisas Energéticas e Nucleares for the use in medical treatments, including the activation of 192Ir sources. These sources are suitable for brachytherapy treatments, due to their low or high activity, depending on the concentration of 192Ir, easiness to manufacture, small size, stable daughter products and the possibility of re-utilization. They may be used for the treatment of prostate, cervix, head and neck, skin, breast, gallbladder, uterus, vagina, lung, rectum, and eye cancer treatment. In this work, the use of some 192Ir sources was studied for the treatment of esophagus cancer, especially the dose determination of important structures, such as those on the mediastinum. This was carried out utilizing a FASH anthropomorphic phantom and the MCNP5 Monte Carlo code to transport the radiation through matter. It was possible to observe that the doses at lungs, breast, esophagus, thyroid and heart were the highest, which was expected due to their proximity to the source. Therefore, the data are useful to assess the representative dose specific to brachytherapy treatments on the esophagus for radiation protection purposes. - Author-Highlights: • The use of brachytherapy sources was studied for the treatment of esophagus cancer. • FASH anthropomorphic phantom and MCNP5 Monte Carlo code were employed. • The doses at lungs, breast, esophagus, thyroid and heart were the highest. • The data is useful to assess the representative doses of treatments on the esophagus

  1. Effects of Endovascular Brachytherapy with 192Ir Afterloading System on Expression of Type Ⅰ Collagen after Angioplasty

    Institute of Scientific and Technical Information of China (English)

    向定成; 杨传红; 候友贤; 龚志华; 易绍东; 邱建

    2003-01-01

    Objectives To investi-gate the effect and mechanism of endovascularbrachytherapy with 192Ir on expression of type Ⅰ collagen, metalloproteinases - 1 (MMP - 1) and the tissueinhibitor (TIMP- 1 ) after angioplasty. MethodsRestenotic model of domestic microswine was em-ployed and the iliac arteries were randomized to radi-ation group ( n = 12), which were treated with 20 ~ 25Gy of 192Ir, and non - radiation group ( n = 36) afterangioplasty. The target vessels were harvested in theend of 3 months and 6 months after angioplasty. Im-munohistochemistry and in situ hybridization were usedto detect proteins of type Ⅰ collagen, MMP-1 andTIMP- 1, and mRNA expression of type Ⅰ collagen.Results The protein and mRNA of type Ⅰ collagen,the ratios of TIMP-1/MMP-1 were significantlylower iu radiation group than in non- radiation group( P < 0.05 or 0.01 ). The peak of transcription of typeⅠ collagen mRNA was at 6 months and 3 months in non-radiation group and radiation group respectively.Conclusions Endovascular brachytherapy with192Ir might modify the metabolism of extracellular ma-trix after angioplasty by inhibiting the synthesis of typeⅠ collagen and the activities of MMP - 1 and TIMP - 1.

  2. Positive clinical response to clopidogrel is independent of paraoxonase 1 Q192R and CYP2C19 genetic variants.

    Science.gov (United States)

    Martínez-Quintana, Efrén; Medina-Gil, José M; Rodríguez-González, Fayna; Garay-Sánchez, Paloma; Limiñana, José M; Saavedra, Pedro; Tugores, Antonio

    2014-08-01

    There is increasing controversy about the influence of serum paraoxonase type 1 and cytochrome CYP2C19 in the conversion of clopidogrel to its pharmaceutically active metabolite. The effect of concomitant medication with the proton pump inhibitor omeprazole has been also subject of intense scrutiny. We present a cohort of 263 patients receiving anti-platelet aggregation treatment with clopidogrel and aspirin for 1 year. The paraoxonase 1 gene Q192R variant along with the presence of CYP2C19*2 and *3 loss of function alleles, concomitant medication with proton pump inhibitors and known cardiovascular risk factors were examined to determine their influence in disease relapse due to an ischaemic event during the 12 month treatment period. The low number of patients suffering a relapse (20 out of 263), indicates that double anti-aggregation therapy with aspirin and clopidogrel was very effective in our patients. Among the relapsers, evidence of coronary heart disease was the most influencial factor affecting response to therapy, while the presence of the paraoxonase 1 Q192R variant, loss of function of CYP2C19, and concomitant medication with omeprazole were non-significant. PMID:24504666

  3. PON1Q192R genetic polymorphism modifies organophosphorous pesticide effects on semen quality and DNA integrity in agricultural workers from southern Mexico

    International Nuclear Information System (INIS)

    Pesticide exposure, including organophosphorous (OP) insecticides, has been associated with poor semen quality, and paraoxonase (PON1), an enzyme involved in OP deactivation, may have a role on their susceptibility, due to PON1 polymorphisms. Our objective was to evaluate the role of PON1Q192R polymorphism on the susceptibility to OP toxicity on semen quality and DNA integrity in agricultural workers. A cross-sectional study was conducted in farmers with Mayan ascendancy from southeastern Mexico chronically exposed to pesticides; mostly OP. Fifty four agricultural workers (18-55 years old) were included, who provided semen and blood samples. Semen quality was evaluated according to WHO, sperm DNA damage by in situ-nick translation (NT-positive cells), PON1Q192R polymorphism by real-time PCR and serum PON1 activity by using phenylacetate and paraoxon. Two OP exposure indexes were created: at the month of sampling and during 3 months before sampling, representing the exposure to spermatids-spermatozoa and to cells at one spermatogenic cycle, respectively. PON1 192R and 192Q allele frequencies were 0.54 and 0.46, respectively. Significant associations were found between OP exposure at the month of sampling and NT-positive cells and sperm viability in homozygote 192RR subjects, and dose-effect relationships were observed between OP exposure during 3 months before sampling and sperm quality parameters and NT-positive cells in homozygote 192RR farmers. This suggests that cells at all stages of spermatogenesis are target of OP, and that there exists an interaction between OP exposure and PON1Q192R polymorphism on these effects; farmers featuring the 192RR genotype were more susceptible to develop reproductive toxic effects by OP exposure

  4. Proposal of a postal system for Ir-192 sources calibration used in high dose rate brachytherapy with LiF:Mn:Ti thermoluminescent dosemeters

    International Nuclear Information System (INIS)

    A proposal in order to improve the brachytherapy quality control and to allow postal intercomparison of Ir-192 sources used in high dose rate brachytherapy has been presented. The LiF: Mn: Ti (TLD 100) detector has been selected for such purpose. The experimental array and the TLDs irradiation and calibration techniques, at the treatment units, have been specified in the light of more recent methodology of Ir-192 calibration sources. (Author)

  5. Tb0.3Dy0.7Fe1.92 nanoflakes prepared by surfactant-assisted high energy ball milling

    International Nuclear Information System (INIS)

    Highlights: → Tb0.3Dy0.7Fe1.92 nanoflakes have been prepared by high energy ball milling (HEBM) with oleic acid. → The morphology, structure and magnetic properties of Tb0.3Dy0.7Fe1.92 have been investigated. → These Tb0.3Dy0.7Fe1.92 nanoflakes had a thickness of 50-400 nm and a grain size of 15-21 nm. → The as-made samples had sustained little oxidation after surfactant-assisted HEBM. → Oleic acid was efficient to protect the powders from oxidation. - Abstract: Tb0.3Dy0.7Fe1.92 nanoflakes with larger specific surface and higher resistance to oxidation have been prepared by high energy ball milling (HEBM) with oleic acid. The morphology, structure and magnetic properties of Tb0.3Dy0.7Fe1.92 have been investigated using scanning electron microscopy, transmission electron microscopy, X-ray diffraction and vibrating sample magnetometry, respectively. The experimental results showed that the as-made samples had sustained little oxidation after surfactant-assisted HEBM suggesting that oleic acid was efficient to protect the powders from oxidation. These Tb0.3Dy0.7Fe1.92 nanoflakes have great potential to be used for the preparation of high performance Terfenol composites with reduced eddy current heating.

  6. CT-guided percutaneous puncture sclerotherapy for parapelvic cysts: clinical analysis of 192 cases

    International Nuclear Information System (INIS)

    Objective: To discuss the technology and experience of CT-guided percutaneous puncture sclerotherapy for the treatment of parapelvic cysts. Methods: During the period from June 2002 and June 2012, a total of 192 patients with parapelvic cyst were admitted to authors' hospital. The diameter of the cysts varied from 3 to 8 cm with a mean of 4.2 cm CT-guided percutaneous puncture sclerotherapy was carried out in all patients. All the patients were followed up, and the therapeutic results as well as the complications were analyzed. Results: Successful percutaneous puncture sclerotherapy with single procedure was obtained in all patients. The operation time was 25-55 minutes with an average time of 38.6 minutes. During the procedure, pain at renal region occurred in 16 patients, which was spontaneously relieved without receiving any special management. Eight patients developed dizzy and flushing, as slight drunk-like reactions, which disappeared after 30 minutes. Six months after the treatment, ultrasonography or CT scanning was performed to check the results. The cyst disappeared in 185 cases, and the diameter of the cyst became < 2 cm in 7 cases. The effective rate was 96.4%. During the follow-up period lasting for 6-24 months, no recurrence or enlargement of the cyst was seen. Conclusion: For the treatment of parapelvic cyst, CT-guided percutaneous puncture sclerotherapy is technically-simple with reliable effect and fewer complications. Therefore, this method should be regarded as one of the most optimal therapies. (authors)

  7. High-Dose-Rate 192Ir Brachytherapy Dose Verification: A Phantom Study

    Directory of Open Access Journals (Sweden)

    Alireza Nikoofar

    2015-05-01

    Full Text Available Background: The high-dose-rate (HDR brachytherapy might be an effective tool for palliation of dysphagia. Because of some concerns about adverse effects due to absorbed radiation dose, it is important to estimate absorbed dose in risky organs during this treatment. Objectives: This study aimed to measure the absorbed dose in the parotid, thyroid, and submandibular gland, eye, trachea, spinal cord, and manubrium of sternum in brachytherapy in an anthropomorphic phantom. Materials and Methods: To measure radiation dose, eye, parotid, thyroid, and submandibular gland, spine, and sternum, an anthropomorphic phantom was considered with applicators to set thermoluminescence dosimeters (TLDs. A specific target volume of about 23 cm3 in the upper thoracic esophagus was considered as target, and phantom planned computed tomography (CT for HDR brachytherapy, then with a micro-Selectron HDR (192Ir remote after-loading unit. Results: Absorbed doses were measured with calibrated TLDs and were expressed in centi-Gray (cGy. In regions far from target (≥ 16 cm such as submandibular, parotid and thyroid glands, mean measured dose ranged from 1.65 to 5.5 cGy. In closer regions (≤ 16 cm, the absorbed dose might be as high as 113 cGy. Conclusions: Our study showed similar depth and surface doses; in closer regions, the surface and depth doses differed significantly due to the role of primary radiation that had imposed a high-dose gradient and difference between the plan and measurement, which was more severe because of simplifications in tissue inhomogeneity, considered in TPS relative to phantom.

  8. The contribution from transit dose for 192Ir HDR brachytherapy treatments

    Science.gov (United States)

    Fonseca, G. P.; Landry, G.; Reniers, B.; Hoffmann, A.; Rubo, R. A.; Antunes, P. C. G.; Yoriyaz, H.; Verhaegen, F.

    2014-04-01

    Brachytherapy treatment planning systems that use model-based dose calculation algorithms employ a more accurate approach that replaces the TG43-U1 water dose formalism and adopt the TG-186 recommendations regarding composition and geometry of patients and other relevant effects. However, no recommendations were provided on the transit dose due to the source traveling inside the patient. This study describes a methodology to calculate the transit dose using information from the treatment planning system (TPS) and considering the source's instantaneous and average speed for two prostate and two gynecological cases. The trajectory of the 192Ir HDR source was defined by importing applicator contour points and dwell positions from the TPS. The transit dose distribution was calculated using the maximum speed, the average speed and uniform accelerations obtained from the literature to obtain an approximate continuous source distribution simulated with a Monte Carlo code. The transit component can be negligible or significant depending on the speed profile adopted, which is not clearly reported in the literature. The significance of the transit dose can also be due to the treatment modality; in our study interstitial treatments exhibited the largest effects. Considering the worst case scenario the transit dose can reach 3% of the prescribed dose in a gynecological case with four catheters and up to 11.1% when comparing the average prostate dose for a case with 16 catheters. The transit dose component increases by increasing the number of catheters used for HDR brachytherapy, reducing the total dwell time per catheter or increasing the number of dwell positions with low dwell times. This contribution may become significant (>5%) if it is not corrected appropriately. The transit dose cannot be completely compensated using simple dwell time corrections since it may have a non-uniform distribution. An accurate measurement of the source acceleration and maximum speed should be

  9. The contribution from transit dose for 192Ir HDR brachytherapy treatments

    International Nuclear Information System (INIS)

    Brachytherapy treatment planning systems that use model-based dose calculation algorithms employ a more accurate approach that replaces the TG43-U1 water dose formalism and adopt the TG-186 recommendations regarding composition and geometry of patients and other relevant effects. However, no recommendations were provided on the transit dose due to the source traveling inside the patient. This study describes a methodology to calculate the transit dose using information from the treatment planning system (TPS) and considering the source's instantaneous and average speed for two prostate and two gynecological cases. The trajectory of the 192Ir HDR source was defined by importing applicator contour points and dwell positions from the TPS. The transit dose distribution was calculated using the maximum speed, the average speed and uniform accelerations obtained from the literature to obtain an approximate continuous source distribution simulated with a Monte Carlo code. The transit component can be negligible or significant depending on the speed profile adopted, which is not clearly reported in the literature. The significance of the transit dose can also be due to the treatment modality; in our study interstitial treatments exhibited the largest effects. Considering the worst case scenario the transit dose can reach 3% of the prescribed dose in a gynecological case with four catheters and up to 11.1% when comparing the average prostate dose for a case with 16 catheters. The transit dose component increases by increasing the number of catheters used for HDR brachytherapy, reducing the total dwell time per catheter or increasing the number of dwell positions with low dwell times. This contribution may become significant (>5%) if it is not corrected appropriately. The transit dose cannot be completely compensated using simple dwell time corrections since it may have a non-uniform distribution. An accurate measurement of the source acceleration and maximum speed

  10. Clinical results of iridium-192 high dose rate brachytherapy with external beam radiotherapy

    International Nuclear Information System (INIS)

    Here, we report the clinical results of iridium-192 high dose rate brachytherapy at Kanazawa University Hospital. The study population consisted of 166 patients diagnosed with T1c-T3bN0M0 prostate cancer treated with high dose rate brachytherapy and external beam radiotherapy and followed up for 6 months or longer. Treatment consisted of external beam radiotherapy to the prostate at 44 Gy/22 fractions and high dose rate brachytherapy at 18 Gy/3 fractions. Median follow-up interval was 31.5 months (range 6.2-88.7). The overall 5-year biological recurrence-free survival rate was 93.0%. The 5-year biological recurrence-free survival rates for the patients in low-, intermediate- and high-risk groups according to the D'Amico risk classification criteria were 96.1%, 89.0% and 91.6%, respectively. When limited to the group that did not receive adjuvant hormonal therapy, the 5-year biological recurrence-free survival rates for the patients in low-, intermediate- and high-risk groups were 96.0%, 96.3% and 82.9%, respectively. Grade 3 or greater adverse effects were rare. Urethral stricture was observed in only 1.0% of the patients. Eighty percent of patients retained erectile function after high dose rate brachytherapy and reported satisfaction with sexual function. High dose rate brachytherapy is considered a good form of treatment for localized prostate cancer, although longer follow-up is necessary. (author)

  11. Evaluation of PC-ISO for customized, 3D Printed, gynecologic 192-Ir HDR brachytherapy applicators.

    Science.gov (United States)

    Cunha, J Adam M; Mellis, Katherine; Sethi, Rajni; Siauw, Timmy; Sudhyadhom, Atchar; Garg, Animesh; Goldberg, Ken; Hsu, I-Chow; Pouliot, Jean

    2015-01-01

    The purpose of this study was to evaluate the radiation attenuation properties of PC-ISO, a commercially available, biocompatible, sterilizable 3D printing material, and its suitability for customized, single-use gynecologic (GYN) brachytherapy applicators that have the potential for accurate guiding of seeds through linear and curved internal channels. A custom radiochromic film dosimetry apparatus was 3D-printed in PC-ISO with a single catheter channel and a slit to hold a film segment. The apparatus was designed specifically to test geometry pertinent for use of this material in a clinical setting. A brachytherapy dose plan was computed to deliver a cylindrical dose distribution to the film. The dose plan used an 192Ir source and was normalized to 1500 cGy at 1 cm from the channel. The material was evaluated by comparing the film exposure to an identical test done in water. The Hounsfield unit (HU) distributions were computed from a CT scan of the apparatus and compared to the HU distribution of water and the HU distribution of a commercial GYN cylinder applicator. The dose depth curve of PC-ISO as measured by the radiochromic film was within 1% of water between 1 cm and 6 cm from the channel. The mean HU was -10 for PC-ISO and -1 for water. As expected, the honeycombed structure of the PC-ISO 3D printing process created a moderate spread of HU values, but the mean was comparable to water. PC-ISO is sufficiently water-equivalent to be compatible with our HDR brachytherapy planning system and clinical workflow and, therefore, it is suitable for creating custom GYN brachytherapy applicators. Our current clinical practice includes the use of custom GYN applicators made of commercially available PC-ISO when doing so can improve the patient's treatment.  PMID:25679174

  12. Anisotropy measurement of {sup 192} Ir sources used in high dose rate brachytherapy; Medida da anisotropia de fontes de Ir-192 utilizadas em braquiterapia de altas taxa de dose

    Energy Technology Data Exchange (ETDEWEB)

    Henn, Keli Cristina; Khoury, Helen J.; Luz, Lidia Cristina P. da [Pernambuco Univ., Recife, PE (Brazil). Dept. de Energia Nuclear

    1998-07-01

    This paper presents the dose distribution around the Ir-192 source used in MicroSelectron-HDR remote after loader system. The measurements were made in air with the source stationary, positioned at the position 1, from the indexer of the microSelectron-HDR. Measurements were made using TLD and for radial distances of 3.0, 5.0 and 7.0 cm, for values of the angle from 0 deg c to 360 deg C in steps of 15 deg C. (author)

  13. Interstitial brachytherapy with 192-IR in treatment of recurrent malignant primary brain tumors. Braquiterapia intersticial con iridio-192 en el tratamiento de recidivas de tumores cerebrales tras cirugia y radioterapia

    Energy Technology Data Exchange (ETDEWEB)

    Cardenes, R.; Martinez, R.; Victoria, C.; Nuez, L.; Clavo, B.; Sancedo, G. (Clinica Puerta de Hierro. Madrid (Spain))

    1994-01-01

    Seven patients with recurrent malignant primary brain tumors after surgery and radiation therapy were treated at the Clinica Puerta de Hierro (Madrid) by interstitial brachytherapy with 192-Ir sources. Implantations were performed using computerized tomography and dose prescription were determined following the Paris system rules for interstitial implants. The means dose deliberated was 50 to 65 Gy to the reference isodoses. At the last follow-up all patients except for one are alive and without evidence of progression of the disease. (Author) 35 refs.

  14. Combined chemoradiation and interstitial IR-192 implant for T3 and T4 anal cancer

    International Nuclear Information System (INIS)

    Introduction: We have previously shown that 30 Gy + 5-FU + Mitomycin-C (MMC) combined modality therapy (CM) will control T1 and T2 anal cancers with no late morbidity. However control of T3 and T4 cancers was poor, with an overall local control rate (LCR) of 38%. We now report our experience with the addition of an interstitial Ir-192 implant (SPI) for persistent disease (PD) or T3 or T4 tumors. Methods: All patients received 30 Gy EBRT + infusional 5-FU (1000 mg/m2) + 1 dose of MMC (10 mg/m2). The radiation field encompassed the inguinal nodes and pelvis from mid SI joint to 1 cm below the anus. This was followed by a single plane circular implant (SPI) using a proprietary template which can be loaded with up to 8 needles. Median dose was 28.48 Gy (range 20 to 31.6 Gy), delivered at a median rate of 0.43 Gy/Hr (range 0.28 to 0.50 Gy/Hr). All patients were followed-up at regular intervals including sigmoidoscopy. Results: Of 2 male and 10 female patients treated with CM + implant, 10 were stage T3, 1 was stageT4 and 1 was stage T1; 1 was N1, 11 were N0, 1 was grade 1, 5 were grade 2 and 6 were grade 3. Average tumor size was 6 cm (range 2 to 9 cm). The median interval from EBRT to SPI was 6 weeks (range 4 to 12 weeks). The median decrease in tumor size after CM, but before SPI, was 34% (range 0% to 88%). With a follow-up of 2 to 38 months the LCR is 67% ((8(12))). Four patients had PD and 3 subsequently underwent salvage surgery, 2 of whom died of disease. Overall survival is 75% ((9(12))). Conclusions: Although follow-up time is still relatively short, the addition of SPI to our standard CM protocol appears to markedly improve the LCR for this group of anal cancers

  15. Identification of 192Ir seeds in localization images using a novel statistical pattern recognition approach and a priori information

    International Nuclear Information System (INIS)

    Purpose / Objective: Manual labeling of individual 192Ir seeds in localization images for dosimetry of multi-strand low-dose-rate (LDR) implants is labor intensive, tedious and prone to error. The objective of this investigation is to develop computer-based methods that analyze digitized localization images, improve dosimetric efficiency, and reduce labeling errors. Materials and Methods: 192Ir localization films were digitized with a scanned-laser system and analyzed using Multiscale, Geometric, Statistical Pattern Recognition (MGSPR), a technique that recognizes and classifies pixels in gray-scale images based on their surrounding, neighborhood geometry. To 'teach' MGSPR how to recognize specific objects, a Gaussian-based mathematical filter set is applied to training images containing user-labeled examples of the desired objects. The filters capture a broad range of descriptive geometric information at multiple spatial scales. Principled mathematical analysis is used to determine the linear combination of filters from a large base set that yields the best discrimination between object types. Thus the sensitivity of the filters can be 'tuned' to detect specific objects such as192 Ir seeds. For a given pixel, the output of the filter is a multi-component feature vector that uniquely describes the pixel's geometric characteristics. Pixels with similar geometric attributes have feature vectors that naturally 'cluster', or group, in the multidimensional space called 'feature space'. After statistically quantifying the training-set clusters in feature space, pixels found in new images are automatically labeled by correlation with the nearest cluster, e.g., the cluster representing 192Ir seeds. One of the greatest challenges in statistical pattern recognition is to determine which filters result in the best labeling. Good discrimination is achieved when clusters are compact and well isolated from one another in feature space. The filters used in this study are unique

  16. Estimation of distance error by fuzzy set theory required for strength determination of HDR 192Ir brachytherapy sources

    International Nuclear Information System (INIS)

    Verification of the strength of high dose rate (HDR) 192Ir brachytherapy sources on receipt from the vendor is an important component of institutional quality assurance program. Either reference air-kerma rate (RAKR) or air-kerma strength (AKS) is the recommended quantity to specify the strength of gamma-emitting brachytherapy sources. The use of Farmer-type cylindrical ionization chamber of sensitive volume 0.6 cm3 is one of the recommended methods for measuring RAKR of HDR 192Ir brachytherapy sources. While using the cylindrical chamber method, it is required to determine the positioning error of the ionization chamber with respect to the source which is called the distance error. An attempt has been made to apply the fuzzy set theory to estimate the subjective uncertainty associated with the distance error. A simplified approach of applying this fuzzy set theory has been proposed in the quantification of uncertainty associated with the distance error. In order to express the uncertainty in the framework of fuzzy sets, the uncertainty index was estimated and was found to be within 2.5%, which further indicates that the possibility of error in measuring such distance may be of this order. It is observed that the relative distance li estimated by analytical method and fuzzy set theoretic approach are consistent with each other. The crisp values of li estimated using analytical method lie within the bounds computed using fuzzy set theory. This indicates that li values estimated using analytical methods are within 2.5% uncertainty. This value of uncertainty in distance measurement should be incorporated in the uncertainty budget, while estimating the expanded uncertainty in HDR 192Ir source strength measurement. (author)

  17. Estimation of distance error by fuzzy set theory required for strength determination of HDR (192)Ir brachytherapy sources.

    Science.gov (United States)

    Kumar, Sudhir; Datta, D; Sharma, S D; Chourasiya, G; Babu, D A R; Sharma, D N

    2014-04-01

    Verification of the strength of high dose rate (HDR) (192)Ir brachytherapy sources on receipt from the vendor is an important component of institutional quality assurance program. Either reference air-kerma rate (RAKR) or air-kerma strength (AKS) is the recommended quantity to specify the strength of gamma-emitting brachytherapy sources. The use of Farmer-type cylindrical ionization chamber of sensitive volume 0.6 cm(3) is one of the recommended methods for measuring RAKR of HDR (192)Ir brachytherapy sources. While using the cylindrical chamber method, it is required to determine the positioning error of the ionization chamber with respect to the source which is called the distance error. An attempt has been made to apply the fuzzy set theory to estimate the subjective uncertainty associated with the distance error. A simplified approach of applying this fuzzy set theory has been proposed in the quantification of uncertainty associated with the distance error. In order to express the uncertainty in the framework of fuzzy sets, the uncertainty index was estimated and was found to be within 2.5%, which further indicates that the possibility of error in measuring such distance may be of this order. It is observed that the relative distance li estimated by analytical method and fuzzy set theoretic approach are consistent with each other. The crisp values of li estimated using analytical method lie within the bounds computed using fuzzy set theory. This indicates that li values estimated using analytical methods are within 2.5% uncertainty. This value of uncertainty in distance measurement should be incorporated in the uncertainty budget, while estimating the expanded uncertainty in HDR (192)Ir source strength measurement. PMID:24872605

  18. Estimation of distance error by fuzzy set theory required for strength determination of HDR 192Ir brachytherapy sources

    Science.gov (United States)

    Kumar, Sudhir; Datta, D.; Sharma, S. D.; Chourasiya, G.; Babu, D. A. R.; Sharma, D. N.

    2014-01-01

    Verification of the strength of high dose rate (HDR) 192Ir brachytherapy sources on receipt from the vendor is an important component of institutional quality assurance program. Either reference air-kerma rate (RAKR) or air-kerma strength (AKS) is the recommended quantity to specify the strength of gamma-emitting brachytherapy sources. The use of Farmer-type cylindrical ionization chamber of sensitive volume 0.6 cm3 is one of the recommended methods for measuring RAKR of HDR 192Ir brachytherapy sources. While using the cylindrical chamber method, it is required to determine the positioning error of the ionization chamber with respect to the source which is called the distance error. An attempt has been made to apply the fuzzy set theory to estimate the subjective uncertainty associated with the distance error. A simplified approach of applying this fuzzy set theory has been proposed in the quantification of uncertainty associated with the distance error. In order to express the uncertainty in the framework of fuzzy sets, the uncertainty index was estimated and was found to be within 2.5%, which further indicates that the possibility of error in measuring such distance may be of this order. It is observed that the relative distance li estimated by analytical method and fuzzy set theoretic approach are consistent with each other. The crisp values of li estimated using analytical method lie within the bounds computed using fuzzy set theory. This indicates that li values estimated using analytical methods are within 2.5% uncertainty. This value of uncertainty in distance measurement should be incorporated in the uncertainty budget, while estimating the expanded uncertainty in HDR 192Ir source strength measurement. PMID:24872605

  19. Fast 3D 192Ir-afterloading quality assurance a new general dosimetric concept applying tissue substituting scintillators

    International Nuclear Information System (INIS)

    Problems of brachytherapy: The steep dose gradient demands high precision in dosimetry, localization, planning and quality assurance. 192Ir-Dosimetry: The broad, depth dependent, low energy photon spectrum, requires dosemeter probes with a wide linear range and high spatial resolution, being independent of energy, incidence and temperature, to overcome the disadvantages of common detectors. Tissue substituting plastic scintillators are optimal for brachytherapy dosimetry. Tiny (1-10 mm3) NE 102A detectors, connected by thin multi-fibre plastic light guides (Cerenkov compensated) to photo-multiplier tubes (PMTs) of high sensitivity and stability allow fast measurements of all basic absorbed dose data within ≤2% precision up to 10 cm depth with high spatial resolution. Afterloading quality assurance: Multi-detector arrays and multi-channel PMTs, open new possibilities of fast 3D-quality assurance by simultaneous measurement at many points. In tissue equivalent phantoms this allows fast systematic checks of stepping source hard-and software, as well as individual dosimetric treatment planning, optimization, simulation, and verification. Afterloading dose monitor: Integrated into the applicator, the really delivered distribution of absorbed dose to water is monitored directly during stepping source afterloading brachytherapy with high spatial (≤0.1 mm) or temporal resolution (≤0.1 s). It indicates errors of planning or application, of step position or step size, of dwell time or travel time. In combination with on-line 3D treatment planning the distribution of dose really delivered can be visualized. Verification: The tiny plastic scintillator array is the ideal probe for192 Ir-afterloading in-vivo dosimetry, also in IORT. Conclusion: Plastic scintillation dosimetry enables versatile and fast 3D-quality assurance of 192Ir-afterloading with high precision

  20. Upregulation of miRNA-143, -145, -192, and -194 in esophageal epithelial cells upon acidic bile salt stimulation.

    Science.gov (United States)

    Bus, P; Siersema, P D; Verbeek, R E; van Baal, J W P M

    2014-08-01

    Barrett's esophagus (BE) is a metaplastic condition of the distal esophagus that occurs because of chronic gastroesophageal reflux. Previous studies have identified BE-specific microRNAs (miRNAs) in comparison with normal squamous epithelium (SQ). We hypothesized that BE-specific miRNAs could be induced in esophageal SQ cells by exposure to acid and/or bile salts. We aimed to determine whether BE-specific miRNAs are upregulated in an esophageal SQ cell line (Het-1A) in an environment with acid and/or bile salts and whether this is nuclear factor-κB (NF-κB) dependent. Acid and/or bile salt incubations were performed in Het-1A cells. Experiments were performed with or without inhibiting the NF-κB pathway. Quantitative reverse transcriptase polymerase chain reaction was performed to determine expression of miRNA-143, -145, -192, -194, cyclo-oxygenase-2 (COX2), mucin 2 (MUC2), and sex determining region Y-box 9. For validation, we determined levels of these miRNAs in biopsies from patients with reflux esophagitis and normal SQ. Significantly increased expression levels of miRNA-143 (2.7-fold), -145 (2.6-fold), -192 (2.0-fold), -194 (2.2-fold), COX2, MUC2, and sex determining region Y-box 9 were found upon acidic bile salt incubation, but not upon acid or bile salt alone. NF-κB pathway inhibition significantly decreased miRNA-143, -192, -194, COX2, and MUC2 expression. Additionally, miRNA-143, -145 and -194 expression was increased in reflux esophagitis biopsies compared with normal SQ, but no changes were found in miRNA-192 expression. Our findings suggest that upregulation of BE-specific miRNAs by acidic bile may be an early event in the transition of SQ to BE and that their expression is partly regulated by the NF-κB pathway. PMID:24006894

  1. Search for Excited Leptons in $e^+ e^-$ Interactions at $\\sqrt{s}$=192 - 202 GeV

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, L; Balandras, A; Baldew, S V; Todorova-Nová, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Cucciarelli, S; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Van Dierendonck, D N; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; Durán, I; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ewers, A; Extermann, Pierre; Fabre, M; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Hu, Y; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Käfer, D; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Kopp, A; Koutsenko, V F; Kräber, M H; Krämer, R W; Krenz, W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Levchenko, P M; Li Chuan; Likhoded, S A; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Lugnier, L; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mans, J; Marian, G; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Moulik, T; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nisati, A; Nowak, H; Ofierzynski, R A; Organtini, G; Oulianov, A; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Paramatti, R; Park, H K; Park, I H; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Prokofiev, D O; Prokofev, D; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Rodin, J; Roe, B P; Romero, L; Rosca, A; Rosier-Lees, S; Roth, S; Rosenbleck, C; Rubio, Juan Antonio; Ruggiero, G; Rykaczewski, H; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Sanders, M P; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schopper, Herwig Franz; Schotanus, D J; Schwering, G; Sciacca, C; Seganti, A; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S V; Suter, H; Swain, J D; Szillási, Z; Sztaricskai, T; Tang, X W; Tauscher, Ludwig; Taylor, L; Tellili, B; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, M; Wang, X L; Wang, Z M; Weber, A; Weber, M; Wienemann, P; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, A; Zilizi, G; Zimmermann, B; Zöller, M

    2001-01-01

    Excited leptons are searched for using the L3 detector at LEP. The data collected at centre-of-mass energies in the range from 192 up to 202 GeV correspond to a total luminosity of 233 $\\rm pb^{-1}$. No evidence of either pair production of excited leptons, nor of single production is found. From the searches for pair produced excited leptons, lower mass limits close to the kinematic limit are set. From the searches for singly produced excited leptons, upper limits on their couplings are derived in the mass range up to 200 GeV.

  2. Study of Z Boson Pair Production in $e^+ e^-$ Interactions at $\\sqrt{s}$ = 192-202 GeV

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, L; Balandras, A; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colino, N; Conventi, F; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Cucciarelli, S; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Pietra, M; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Van Dierendonck, D N; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; Durán, I; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Extermann, Pierre; Fabre, M; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Hu, Y; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Kopp, A; Koutsenko, V F; Kräber, M H; Krämer, R W; Krenz, W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Levchenko, P M; Li Chuan; Likhoded, S A; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Lugnier, L; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mans, J; Marian, G; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Moulik, T; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nisati, A; Nowak, H; Ofierzynski, R A; Organtini, G; Oulianov, A; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Paramatti, R; Park, H K; Park, I H; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Prokofiev, D O; Prokofev, D; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Rodin, J; Roe, B P; Romero, L; Rosca, A; Rosier-Lees, S; Rubio, Juan Antonio; Ruggiero, G; Rykaczewski, H; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schopper, Herwig Franz; Schotanus, D J; Schwering, G; Sciacca, C; Seganti, A; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Suter, H; Swain, J D; Szillási, Z; Sztaricskai, T; Tang, X W; Tauscher, Ludwig; Taylor, L; Tellili, B; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, M; Wang, X L; Wang, Z M; Weber, A; Weber, M; Wienemann, P; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, A; Zilizi, G; Zimmermann, B; Zöller, M

    2001-01-01

    The cross section for the production of Z boson pairs is measured using the data collected by the L3 detector at LEP in 1999 in $\\rm e^+e^-$ collisions at centre--of--mass energies ranging from 192 GeV up to 202 GeV. Events in all the visible final states are selected, measuring the cross section of this process. The special case of final states containing b quarks is also investigated. All results are in agreement with the Standard Model predictions.

  3. Proposal of a postal system for Ir-192 sources calibration used in high dose rate brachytherapy with LiF:Mn:Ti thermoluminescent dosemeters; Proposta de um sistema postal para a calibracao de fontes de {sup 192} Ir, utilizadas em braquiterapia de alta taxa de dose, com dosimetros termoluminescentes de LiF: Mn: Ti

    Energy Technology Data Exchange (ETDEWEB)

    Vieira, W.S.; Borges, J.C.; Almeida, C.E.V. [Instituto de Radioprotecao e Dosimetria. CNEN Caixa Postal 37750, 22780-160, Rio de Janeiro (Brazil)

    1998-12-31

    A proposal in order to improve the brachytherapy quality control and to allow postal intercomparison of Ir-192 sources used in high dose rate brachytherapy has been presented. The LiF: Mn: Ti (TLD 100) detector has been selected for such purpose. The experimental array and the TLDs irradiation and calibration techniques, at the treatment units, have been specified in the light of more recent methodology of Ir-192 calibration sources. (Author)

  4. Summary of the Waste Management Programs at uranium recovery facilities as they relate to the 40 CFR Part 192 standards

    International Nuclear Information System (INIS)

    This study evaluates the degree to which surface impoundments at licensed facilities comply with significant changes in NRC requirements initiated by enactment of EPA's final environmental standards for uranium recovery facilities (40 CFR Part 192). Impoundment liner requirements, ground-water protection standards, ground-water monitoring and corrective action programs, and site closure standards are the most significant regulatory modifications. The compliance status of 30 conventional mills and 31 in-situ mines is determined from a review of Nuclear Regulatory Commission and agreement state docket files through November, 1983. Results of this review show that a majority of conventional uranium mill tailings management systems are deficient with respect to liner requirements for new impoundments or proposed expansions to existing impoundments, as well as with respect to some aspects of ground-water monitoring and compliance programs. Furthermore, the status of conventional mill site closure plans is highly uncertain at this time. Although surface impoundments at in-situ uranium mines also are deficient with respect to ground-water monitoring programs, they generally comply with other changes in requirements imposed by 40 CFR Part 192

  5. Interstitial radiation therapy for carcinoma of the penis using iridium 192 wires: the Henri Mondor experience (1970-1979)

    International Nuclear Information System (INIS)

    From 1970 to 1979, a group of 50 patients was treated for squamous cell carcinoma of the penis by interstitial irradiation using an afterloading technique and iridium 192 wires. The group included 9 patients with T1 tumors, 27 with T2 tumors, and 14 with T3 tumors. Forty-five patients presented with no metastatic inguinal nodes (NO), 3 patients with N1 nodes, and 2 patients had N3 nodes. After treatment, 11 patients (1 T1, 6 T2 and 4 T3) developed local recurrences. Three patients developed post-therapeutic necrosis which necessitated partial amputation in 2 cases. Eight patients developed post-therapeutic urethral stenosis, which required surgical treatment in three of the cases. Twenty-one percent of the patients died of their disease. The authors advocate interstitial irradiation using iridium 192 wires for the treatment of non-infiltrating or moderately infiltrating squamous cell carcinoma of the penis in which the largest dimension does no exceed 4 cm. When regular follow-up can be assurred, it is reasonable to forgo prophylactic treatment of the inguinal nodes in patients presenting without groin metastasis

  6. Quality assurance programme in high dose rate brachytherapy with Iridium-192 source. Recommendations of the French Medical Physicists Society

    International Nuclear Information System (INIS)

    A report on Quality Assurance in High Dose Rate brachytherapy with Iridium-192 source has been prepared by the task group of the Brachytherapy committee of the French Medical Physicists Society. This report provides recommendations on what should be tested, the methods to be used, the test frequencies and the tolerances. The Quality Assurance Programme concerns mainly the Q.A. on the treatment unit, the treatment planning system and the patient procedure. Tolerances and action levels are linked to international recommendations. Safety standards are linked to national legislation and to international recommendations. It is the responsibility of the Institution to verify that the source calibration provided by the manufacturer is correct. The calibration of the Iridium-192 source should be an in-air measurement of air-kerma using an ionization chamber. The recommended tolerance between manufacturer and Institution calibration is 3 %. Quality Control on remote afterloading systems should include consideration of the accuracy and reproducibility of positioning of sources in the applicators. Safety features must also be evaluated regularly and emergency procedures should be tested regularly and posted in a prominent place. After the detailed acceptance tests of dose calculation algorithm, routine checks should be done after software update. An independent dose calculation is recommended before treatment. The recommended agreement with the computer calculation should be within 10%. A written dosimetry report for each brachytherapy procedure is recommended to be inserted in patient charts. The results of all tests should be recorded in a logbook. Fault conditions should be carefully documented

  7. Oncologic and functional outcome of base of tongue cancer treated with external-beam radiation and I-192 implant

    International Nuclear Information System (INIS)

    This paper assesses tumor control and functional outcome for squamous cancer of the base of the tongue managed with external irradiation plus Ir-192 implant. Between January 1981 and June 1990, 36 previously untreated patients were treated with 5,000-5,400 cGy of external-beam radiation plus a 2,000-3,000 cGy boost to the base of tongue with an Ir-192 implant. Negative necks were irradiated alone, and positive necks were treated with irradiation followed by neck dissection. Crude local control by T stage are as follows: T1, 10 of 11; T2, 13 of 14; T3, 8 of 10; and T4 1 of 1. Actuarial local control is 87.5%. Of the four local failures, two were salvaged by surgery. Neck control was achieved in 35 of 36 patients. Complications occurred in 25%. When implantation was done with the nonlooping technique, the injury rate was statistically higher than when done with the looping technique (6 of 12 = 50% vs 3 of 24 = 12.5%, P = .02)

  8. Investigation of Dosimetric Parameters of $^{192}$Ir MicroSelectron v2 HDR Brachytherapy Source Using EGSnrc Monte Carlo Code

    CERN Document Server

    Naeem, Hamza; Zheng, Huaqing; Cao, Ruifen; Pei, Xi; Hu, Liqin; Wu, Yican

    2016-01-01

    The $^{192}$Ir sources are widely used for high dose rate (HDR) brachytherapy treatments. The aim of this study is to simulate $^{192}$Ir MicroSelectron v2 HDR brachytherapy source and calculate the air kerma strength, dose rate constant, radial dose function and anisotropy function established in the updated AAPM Task Group 43 protocol. The EGSnrc Monte Carlo (MC) code package is used to calculate these dosimetric parameters, including dose contribution from secondary electron source and also contribution of bremsstrahlung photons to air kerma strength. The Air kerma strength, dose rate constant and radial dose function while anisotropy functions for the distance greater than 0.5 cm away from the source center are in good agreement with previous published studies. Obtained value from MC simulation for air kerma strength is $9.762\\times 10^{-8} \\textrm{UBq}^{-1}$and dose rate constant is $1.108\\pm 0.13\\%\\textrm{cGyh}^{-1} \\textrm{U}^{-1}$.

  9. Limited external irradiation and interstitial 192iridium implant in the treatment of squamous cell carcinoma of the tonsillar region

    International Nuclear Information System (INIS)

    Between January 1976 and March 1982, 80 patients with histologically proven diagnosis of squamous cell carcinoma of the tonsillar region were treated with definitive radiotherapy. Sixty-five (81%) of these patients had locally advanced tumors (Stage III and IV); 49% of patients had clinically palpable cervical lymphadenopathy. All patients received a combined external megavoltage and interstitial irradiation. The dose of external irradiation was limited to 4500-5000 cGy over 41/2 to 51/2 weeks. This was followed by interstitial 192iridium implants to doses of 2000-2500 cGy in 50-60 hours for T1, T2 lesions and 3000-4000 cGy in 60-100 hours for T3, T4 lesions. The neck masses were also separately implanted to deliver additional doses of 2000-4000 cGy in 50-80 hours. Overall local tumor control was observed in 84% of patients with a minimum follow-up period of 2 years. An absolute 3-year disease free survival of the entire group was 72%. Treatment related complications such as soft tissue necrosis or osteoradionecrosis occurred in 6% (5/80) of patients. The salvage of neck failures and local failures was possible in 78 and 38% of patients, respectively, either by surgery or by re-irradiation employing interstitial 192iridium implants. Functional and esthetic integrity was well preserved in most cases

  10. 联合检测血清Cyfra 21-1、CK19-2G2在非小细胞肺癌患者中的诊断%Clinical diagnostic value of combined detection of serum Cyfra 21-1 and CK19-2G2 in patients with non-small cell lung cancer

    Institute of Scientific and Technical Information of China (English)

    廖长征; 徐文莉; 魏晟潇; 许瑞环; 刘紫菱; 罗艺

    2014-01-01

    目的::探讨联合检测血清Cyfra 21-1、CK19-2G2在非小细胞肺癌患者中的诊断。方法:采用化学发光免疫法检测92例非小细胞肺癌患者、83例肺部良性疾病患者和90例健康体检者血清Cyfra 21-1、CK19-2G2的浓度,并判断两者的相关性。比较单独与联合检测Cyfra21-1、CK19-2G2对于诊断非小细胞肺癌的灵敏度和特异性。结果:非小细胞肺癌组血清Cyfra 21-1、CK19-2G2水平显著高于肺部良性疾病组和健康对照组( P<0.01);非小细胞肺癌患者血清Cyfra 21-1与CK19-2G2水平呈正相关性( P<0.05)。两者联合诊断非小细胞肺癌的灵敏度为82.7%、特异性为78%。结论:Cyfra 21-1、CK19-2G2是有效的诊断非小细胞肺癌的肿瘤标志物。血清Cyfra 21-1、CK19-2G2水平在非小细胞肺癌的诊断中有临床应用价值,两者联合检测的灵敏度和特异性高。%Objective:To investigate the clinical diagnostic value of the combined detection of serum Cyfra 21-1 and CK19-2G2 in patients with the non-small cell lung cancer ( NSCLC ) . Methods:The levels of serum Cyfra 21-1 and CK19-2G2 in 92 cases of NSCLC,83 of benign lung diseases and 90 of healthy controls were detected by chemiluminescent immunoassay. And the correlation between Cyfra 21-1 and CK19-2G2 was evaluated.Moreover,the sensitivity and specificity of combined detection of serum Cyfra 21-1 and CK19-2G2 for of the diagnosis of the NSCLC was compared with detection of either alone.Results:The Cyfra 21-1 and CK19-2G2 levels in serum of the NSCLC patients were significantly higher than those with benign lung disease and healthy controls (P<0.01).The Cyfra 21-1 and CK19-2G2 levels of the NSCLC patients were positively correlated (P<0. 05).Combined detection of both biomarkers in NSCLC yielded a sensitivity of 82.7% and a specificity of 78%. Conclusions:Cyfra 21-1 and CK19-2G2 are effective tumor markers for the diagnosis of NSCLC. With high sensitivity and specificity of

  11. Measurement of disintegration rate and decay branching ratio for nuclide 192Ir with β-, EC mixing decays by using 4πβ-γ coincidence counting

    International Nuclear Information System (INIS)

    The absolute disintegration rates for nuclide 192Ir were measured with a 4πβ-γ (HPGe) coincidence apparatus by using parameter method and extrapolation method. The final uncertainties obtained were 0.4% and 0.5% respectively for a confidence level of 99.7%. The method with which both the disintegration rate and the decay branching ratio can be measured for nuclides with β- and EC mixing decays was proposed and described. The β- branching ratio in 192Ir decays was measured being 0.9572. The final uncertainties of disintegration rates and β- decay branching ratio with this method were 1.5% and 1.8% respectively

  12. Air kerma rate measurements of 192Ir source in Gammamed 12i HDR/PDR unit using well type ionization chamber

    International Nuclear Information System (INIS)

    The use of high dose rate (HDR) brachytherapy in radiotherapy department has increased nowadays. The initial activity of 192Ir sources, used in high dose rate brachytherapy unit is approximately 10 Ci. About 3 to 4 times per year, a replacement is made of these sources, because of the decay half-life of 192Ir with 73.83 days. It is recommended that each time a new HDR source is installed for use in clinical routine, a source calibration in the hospital should be carried out

  13. Chemonuclear studies for identification for new production routes for the therapeutically useful radionuclides 140Nd, 192Ir, 191Pt, 193mPt, und 195mPt

    International Nuclear Information System (INIS)

    New production routes for the therapeutically useful radionuclides 140Nd, 192Ir, 191Pt, 193mPt and 195mPt were investigated. Cross section data were measured using the stacked-foil technique and compared with theoretical calculations. A production method for the platinum nuclides was developed. The 141Pr(p, 2n)140Nd and natCe(3He, xn)140Nd reactions were investigated for production of 140Nd. Cross section data of nuclear reactions leading to the side products 141Nd, 139Nd and 139Ce could also be achieved. The experimental data were compared with theoretical calculations using the code ALICE-IPPE. A comparison of the calculated thick target yields showed that the 141Pr(p, 2n)140Nd reaction gives a higher yield. The 192Os(p, n)192Ir reaction was examined in the context of the production of 192Ir. Cross section data were determined and compared with theoretical calculations using the codes ALICE-IPPE and EMPIRE II. The yield of this reaction was compared with the yield of the reactor production of this nuclide. The reactor production seems to be more suitable because of a higher purity and yield. Cross section data were measured for the 192Os(α, n)195mPt, 192Os(α, 3n)193mPt and 192Os(3He, 4n)191Pt reactions. The activity of 193mPt and 195mPt was determined by X-ray spectroscopy after a chemical separation procedure. The ALICE-IPPE code was found to be inappropriate to reproduce the experimental values. The calculated yields were compared with the yields of other reactions, especially the reactor production of 195mPt. The yield of the 192Os(α, n)195mPt reaction is lower compared to the yield of the reactor production, but offers lower target costs and higher specific activity. A production method for 193mPt and 195mPt was developed. Batch yields of 0.9 MBq 195mPt (specific activity of about 150 GBq/g Pt) and 8.7 MBq 193mPt (ca. 3 TBq/g Pt) could be achieved. The experimental yields were compared with the calculated yields. The agreement between these two data sets

  14. Applicability of a prototype for determination of absorbed dose using brachytherapy equipment with Ir-192 sources; Aplicabilidade de um prototipo para determinacao da dose absorvida utilizando equipamentos de braquiterapia com fontes de IR-192

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Vivianne Lucia Bormann; Almeida, Mayara Gabriella Oliveira de; Vieira, Rafaela Etelvina de Amorim; Silva, Waldecy Ananias da; Nascimento, Rizia Keila, E-mail: vlsouza@cnen.gov.br, E-mail: mayaradqf@hotmail.com, E-mail: rodriguesss@hootmail.com, E-mail: waldecy@cnen.gov.br, E-mail: riziakeila@hotmail.com [Centro Regional de Ciencias Nucleares do Nordeste (CRCN-NE/CNEN-PE), Recife, PE (Brazil)

    2014-07-01

    This work aims at the development and improvement of a device to perform the absolute dosimetry sources of Ir-192 using the Fricke solution contained in a flask. The Fricke solution used was prepared using amounts of ferrous ammonium sulfate, sodium chloride and sulfuric acid, diluted with water tri distilled pre-established in the literature. The spectrophotometer used was a UV-VIS spectrophotometer (Beckman DU-640 Counter) for measuring the optical density at wavelength 304 nm. The calculation for determining the radial dose takes into account the radial distance and the angle formed with the transverse axis of the source. As the results obtained can be seen that the states of Pernambuco, Ceara, Paraiba e Piaui are in accordance with the recommendations of international standards of the International Atomic Energy Agency (IAEA), which considers not acceptable a difference greater than 5% of prescribed dose and measured dose.

  15. Influence of the profile of Iridium-192 wire in measurements of quality control for use in brachytherapy

    International Nuclear Information System (INIS)

    Brachytherapy is a method used in the treatment of cancerous tumors, by ionizing radiation produced by sources, introduced into the tumor area, this method seeks a more direct to the tumor, thereby maximizing the radiation dose to diseased tissue, while minimizing the dose to healthy tissues. One of the radionuclides used in brachytherapy is iridium-192. The Radiation Technology Center (CTR), of the Nuclear and Energy Research Institute (IPEN), has produced commercially, since 1998, iridium-192 wires used in low dose rate (LDR) brachytherapy. To produce this radionuclides, firstly an iridium-platinum wire is irradiated in the nuclear reactor IEA-R1 for 30 hours, with a neutron flux of 5x 1013 n cm-2 s-1, the wire is left to decay by 30 days to remove the main contaminants, and then goes through a quality control, before being sent to the hospital. In this quality control is checked the radiation homogeneity along each centimeter of the wire. To implement this procedure, is used a device, consisting of an ionization chamber, surrounded by a lead shield, with a samol 1 cm wide slit, linked to the ionization chamber is a voltage source, and a Keithley 617 electrometer, 2 minutes is the range used to measure the charge by the electrometer. The iridium wire is considered in accordance, when there is no variation higher than 5%, between the average measures and the maximum and minimum values. However, due to design features of the measurement system, the wire may appear to the detector through the slit in larger sizes than the ideal, improperly influencing the final quality control. This paper calculates the difference in size of these variations in profile, and their influence on the final count, it compares the actual values obtained, and describes the improvements, made in quality control procedures, that provided more accurate measurement data, analyzes the results, and suggests changes in devices, aimed at further improving the quality control of iridium-192 weirs

  16. Planck cold clumps in the $\\lambda$ Orionis complex: I. Discovery of an extremely young Class 0 protostellar object and a proto-brown dwarf candidate in a bright rimmed clump PGCC G192.32-11.88

    CERN Document Server

    Liu, Tie; Kim, Kee-Tae; Wu, Yuefang; Lee, Chang Won; Lee, Jeong-Eun; Tatematsu, Kenichi; Choi, Minho; Juvela, Mika; Thompson, Mark; Goldsmith, Paul F; Liu, Sheng-yuan; Naomi, Hirano; Koch, Patrick; Henkel, Christian; Sanhueza, Patricio; He, JinHua; Rivera-Ingraham, Alana; Wang, Ke; Cunningham, Maria R; Tang, Ya-Wen; Lai, Shih-Ping; Yuan, Jinghua; Li, Di; Fuller, Gary; Kang, Miju; Luong, Quang Nguyen; Liu, Hauyu Baobab; Ristorcelli, Isabelle; Yang, Ji; Xu, Ye; Hirota, Tomoya; Mardones, Diego; Qin, Sheng-Li; Chen, Huei-Ru; Kwon, Woojin; Meng, FanYi; Zhang, Huawei; Kim, Mi-Ryang; Yi, Hee-Weon

    2015-01-01

    We are performing a series of observations with ground-based telescopes toward Planck Galactic cold clumps (PGCCs) in the $\\lambda$ Orionis complex in order to systematically investigate the effects of stellar feedback. In the particular case of PGCC G192.32-11.88, we discovered an extremely young Class 0 protostellar object (G192N) and a proto-brown dwarf candidate (G192S). G192N and G192S are located in a gravitationally bound bright-rimmed clump. The velocity and temperature gradients seen in line emission of CO isotopologues indicate that PGCC G192.32-11.88 is externally heated and compressed. G192N probably has the lowest bolometric luminosity ($\\sim0.8$ L$_{\\sun}$) and accretion rate (6.3$\\times10^{-7}$ M$_{\\sun}$~yr$^{-1}$) when compared with other young Class 0 sources (e.g. PACS Bright Red sources (PBRs)) in the Orion complex. It has slightly larger internal luminosity ($0.21\\pm0.01$ L$_{\\sun}$) and outflow velocity ($\\sim$14 km~s$^{-1}$) than the predictions of first hydrostatic cores (FHSCs). G192N...

  17. Metal stent and endoluminal high-dose rate 192iridium brachytherapy in palliative treatment of malignant biliary tract obstruction

    International Nuclear Information System (INIS)

    Since December 1989, 9 patients with inoperable malignant biliary tract obstruction were treated palliatively by a combined modality treatment consisting of placement of a permanent biliary endoprosthesis followed by intraluminal high dose-rate 192Ir brachytherapy. A dose of 10 Gy was delivered in a hyperfractionated schedule at the point of reference in a distance of 7.5 mm of centre of the source. External small field radiotherapy (50.4 Gy, 1.8 Gy per day, 5 fractions per week) was also given in six cases (M/O, Karnofsky >60%). In 9/9 cases an unrestrained bile flow and an interruption of pruritus was achieved, in 78% (7/9) of cases the duration of palliation was as long as the survival time (median survival time 7.5 months). (orig.)

  18. Assessment of Absorbed Dose in Persons close to the Patients during 192Ir brachytherapy for Cervical Cancer

    International Nuclear Information System (INIS)

    According to the 2007 Annual Report of the National Cancer Registry, cervical cancer showed an occurring frequency of 7th in female cancers and 4rd in females with an age of 35-64 years. Both radiotherapy and chemotherapy are mainly used for the treatment of cervical cancer. In case of radiotherapy, brachytherapy using radioisotopes in conjunction with external-beam radiation therapy (EBRT) using a linear accelerator is used in most cases to improve the outcome of cancer treatment. Brachytherapy, one of the cervical cancer radiotherapies, is a method that can minimize the damage of normal tissues restricting absorbed dose to uterus. It is, however, necessary to conduct a quantitative assessment on brachytherapy because it may cause radiation exposure to medical care providers during the radiotherapy. Therefore, the study provides the basic research data regarding brachytherapy for cervical cancer, estimating the absorbed dose in persons close to the patients using a mathematical phantom during 192Ir brachytherapy for cervical cancer

  19. Stem signal suppression in fiber-coupled Al2O3:C dosimetry for 192Ir brachytherapy

    DEFF Research Database (Denmark)

    Kertzscher Schwencke, Gustavo Adolfo Vladimir; Andersen, Claus Erik; Edmund, J.M.;

    2011-01-01

    was adapted for on-line in-vivo dosimetry using fiber-coupled carbon doped aluminum oxide (Al2O3:C). The technique involved a two-channel optical filtration of the radioluminescence (RL) emitted from a pre-irradiated Al2O3:C crystal with enhanced sensitivity. The system responded linearly in the...... absorbed dose range 0.05–50 Gy, as needed under high dose rate (HDR) conditions. The dosimeter was irradiated in a water phantom using a 37 GBq 192Ir source at source-to-crystal distances ranging from 0.5 cm to 6.7 cm. For irradiation conditions that generated a stem component in the range 4%–15% in the...

  20. Interstitial brachytherapy for carcinoma of the base of tongue using a high dose rate 192Ir remote afterloader

    International Nuclear Information System (INIS)

    We have applied an interstitial brachytherapy employing a high dose rate 192Ir remote afterloader to five patients with cancer of the base of tongue since December 1994. Insertion of applicators was carried out with tracheotomy under general anesthesia. Brachytherapy was delivered twice a day with a 6-hour interval. Irradiation dose was estimated at the point of 5 mm from outer applicators. HDR brachytherapy was well tolerated for 4-5 days in all patients and acute radiation reaction was minimal. Local control were observed in two cases. In conclusion, our preliminary experience suggests that HDR brachytherapy may be an option in the radiotherapy for carcinoma of the base of tongue. Optimal dose-fractionation protocol should be established. (author)

  1. Accuracy of applicator tip reconstruction in MRI-guided interstitial 192Ir-high-dose-rate brachytherapy of liver tumors

    International Nuclear Information System (INIS)

    Background and purpose: To evaluate the reconstruction accuracy of brachytherapy (BT) applicators tips in vitro and in vivo in MRI-guided 192Ir-high-dose-rate (HDR)-BT of inoperable liver tumors. Materials and methods: Reconstruction accuracy of plastic BT applicators, visualized by nitinol inserts, was assessed in MRI phantom measurements and in MRI 192Ir-HDR-BT treatment planning datasets of 45 patients employing CT co-registration and vector decomposition. Conspicuity, short-term dislocation, and reconstruction errors were assessed in the clinical data. The clinical effect of applicator reconstruction accuracy was determined in follow-up MRI data. Results: Applicator reconstruction accuracy was 1.6 ± 0.5 mm in the phantom measurements. In the clinical MRI datasets applicator conspicuity was rated good/optimal in ⩾72% of cases. 16/129 applicators showed not time dependent deviation in between MRI/CT acquisition (p > 0.1). Reconstruction accuracy was 5.5 ± 2.8 mm, and the average image co-registration error was 3.1 ± 0.9 mm. Vector decomposition revealed no preferred direction of reconstruction errors. In the follow-up data deviation of planned dose distribution and irradiation effect was 6.9 ± 3.3 mm matching the mean co-registration error (6.5 ± 2.5 mm; p > 0.1). Conclusion: Applicator reconstruction accuracy in vitro conforms to AAPM TG 56 standard. Nitinol-inserts are feasible for applicator visualization and yield good conspicuity in MRI treatment planning data. No preferred direction of reconstruction errors were found in vivo

  2. Microdosimetric evaluation of relative biological effectiveness for 103PD, 125I, 241AM, and 192IR brachytherapy sources

    International Nuclear Information System (INIS)

    Purpose: To determine the microdosimetric-derived relative biological effectiveness (RBE) of 103Pd, 125I, 241Am, and 192Ir brachytherapy sources at low doses and/or low dose rates. Methods and Materials: The Theory of Dual Radiation Action can be used to predict expected RBE values based on the spatial distribution of energy deposition at microscopic levels from these sources. Single-event lineal energy spectra for these isotopes have been obtained both experimentally and theoretically. A grid-defined wall-less proportional counter was used to measure the lineal energy distributions. Unlike conventional Rossi proportional counters, the counter used in these measurements has a conducting nylon fiber as the central collecting anode and has no metal parts. Thus, the Z-dependence of the photoelectric effect is eliminated as a source of measurement error. Single-event spectra for these brachytherapy sources have been also calculated by: (a) the Monte Carlo code MCNP to generate the electron slowing down spectrum, (b) transport of monoenergetic electron tracks, event by event, with our Monte Carlo code DELTA, (c) using the concept of associated volume to obtain the lineal energy distribution f(y) for each monoenergetic electron, and (d) obtaining the composite lineal energy spectrum for a given brachytherapy source based on the electron spectrum calculated at step (a). Results: Relative to 60Co, the RBE values obtained from this study are: 2.3 for 103Pd, 2.1 for 125I, 2.1 for 241Am, and 1.3 for 192Ir. Conclusions: These values are consistent with available data from in vitro cell survival experiments. We suggest that, at least for these brachytherapy sources, microdosimetry may be used as a credible alternative to time-consuming (and often uncertain) radiobiological experiments to obtain information on radition quality and make reliable predictions of RBE in low dose rate brachytherapy

  3. Dosimetric impact of an 192Ir brachytherapy source cable length modeled using a grid-based Boltzmann transport equation solver

    International Nuclear Information System (INIS)

    Purpose: To evaluate the dose distributions of an 192Ir source (model VS2000) in homogeneous water geometry calculated using a deterministic grid-based Boltzmann transport equation solver (GBBS) in the commercial treatment planning system (TPS) (BRACHYVISION-ACUROS v8.8). Methods: Using percent dose differences (%ΔD), the GBBS (BV-ACUROS) was compared to the (1) published TG-43 data, (2) MCNPX Monte Carlo (MC) simulations of the 192Ir source centered in a 15 cm radius water sphere, and (3) TG-43 output from the TPS using vendor supplied (BV-TG43-vendor) and user extended (BV-TG43-extended) 2D anisotropy functions F(r,θ). BV-ACUROS assumes 1 mm of NiTi cable, while the TPS TG-43 algorithm uses data based on a 15 cm cable. MC models of various cable lengths were simulated. Results: The MC simulations resulted in >20% dose deviations along the cable for 1, 2, and 3 mm cable lengths relative to 15 cm. BV-ACUROS comparisons with BV-TG43-vendor and BV-TG43-extended yielded magnitude of differences, consistent with those seen in MC simulations. However, differences >20% extended further (θ≤10 deg.) when using the vendor supplied anisotropy function Fven(r,θ). These differences were also seen in comparisons of F(r,θ) derived from the TPS output. Conclusions: The results suggest that %ΔD near the cable region is larger than previously estimated. The spatial distribution of the dose deviation is highly dependent on the reference TG-43 data used to compare to GBBS. The differences observed, while important to realize, should not have an impact on clinical dosimetry in homogeneous water.

  4. Comparison BIPM.RI(I)-K8 of high dose-rate Ir-192 brachytherapy standards for reference air kerma rate of the VSL and the BIPM

    DEFF Research Database (Denmark)

    Alvarez, J.T.; De Pooter, J.A.; Andersen, Claus E.;

    2014-01-01

    An indirect comparison of the standards for reference air kerma rate for 192Ir high dose rate brachytherapy sources of the Dutch Metrology Institute (VSL), The Netherlands, and of the Bureau International des Poids et Mesures (BIPM) was carried out at the VSL in November 2009. The comparison resu...

  5. 49 CFR 192.505 - Strength test requirements for steel pipeline to operate at a hoop stress of 30 percent or more...

    Science.gov (United States)

    2010-10-01

    ... occupancy within 300 feet (91 meters) of a pipeline, a hydrostatic test must be conducted to a test pressure... 49 Transportation 3 2010-10-01 2010-10-01 false Strength test requirements for steel pipeline to...: MINIMUM FEDERAL SAFETY STANDARDS Test Requirements § 192.505 Strength test requirements for steel...

  6. SU-F-19A-02: Comparison of Absorbed Dose to Water Standards for HDR Ir-192 Brachytherapy Between the LCR, Brazil and NRC, Canada

    Energy Technology Data Exchange (ETDEWEB)

    Salata, C; David, M; Almeida, C de [Universidade do Estado do Rio de Janeiro, Rio De Janeiro, RJ (Brazil); El Gamal, I; Cojocaru, C; Mainegra-Hing, E; McEwen, M [National Research Council, Ottawa, ON (Canada)

    2014-06-15

    Purpose: To compare absorbed dose to water standards for HDR brachytherapy dosimetry developed by the Radiological Science Laboratory of Rio de Janeiro State University (LCR) and the National Research Council, Canada (NRC). Methods: The two institutions have separately developed absorbed dose standards based on the Fricke dosimetry system. There are important differences between the two standards, including: preparation and read-out of the Fricke solution, irradiation geometry of the Fricke holder in relation to the Ir-192 source, and determination of the G-value to be used at Ir-192 energies. All measurements for both standards were made directly at the NRC laboratory (i.e., no transfer instrument was used) using a single Ir-192 source (microSelectron v2). In addition, the NRC group has established a self-consistent method to determine the G-value for Ir-192, based on an interpolation between G-values obtained at Co-60 and 250kVp X-rays, and this measurement was repeated using the LCR Fricke solution to investigate possible systematic uncertainties. Results: G-values for Co-60 and 250 kVp x-rays, obtained using the LCR Fricke system, agreed with the NRC values within 0.5 % and 1 % respectively, indicating that the general assumption of universal G-values is appropriate in this case. The standard uncertainty in the determination of G for Ir-192 is estimated to be 0.6 %. For the comparison of absorbed dose measurements at the reference point for Ir-192 (1 cm depth in water, perpendicular to the seed long-axis), the ratio Dw(NRC)/Dw(LCR) was found to be 1.011 with a combined standard uncertainty of 1.7 %, k=1. Conclusion: The agreement in the absorbed dose to water values for the LCR and NRC systems is very encouraging. Combined with the lower uncertainty in this approach compared to the present air-kerma approach, these results reaffirm the use of Fricke solution as a potential primary standard for HDR Ir-192 brachytherapy.

  7. PON1 Q192R genetic variant and response to clopidogrel and prasugrel: pharmacokinetics, pharmacodynamics, and a meta-analysis of clinical outcomes.

    Science.gov (United States)

    Mega, Jessica L; Close, Sandra L; Wiviott, Stephen D; Man, Michael; Duvvuru, Suman; Walker, Joseph R; Sundseth, Scott S; Collet, Jean-Philippe; Delaney, Jessica T; Hulot, Jean-Sebastien; Murphy, Sabina A; Paré, Guillaume; Price, Matthew J; Sibbing, Dirk; Simon, Tabassome; Trenk, Dietmar; Antman, Elliott M; Sabatine, Marc S

    2016-04-01

    Clopidogrel and prasugrel are antiplatelet therapies commonly used to treat patients with cardiovascular disease. They are both pro-drugs requiring biotransformation into active metabolites. It has been proposed that a genetic variant Q192R (rs662 A>G) in PON1 significantly alters the biotransformation of clopidogrel and affects clinical outcomes; however, this assertion has limited support. The relationship between this variant and clinical outcomes with prasugrel has not been studied. We genotyped PON1 Q192R in 275 healthy subjects treated with clopidogrel or prasugrel and 2922 patients with an ACS undergoing PCI randomized to treatment with clopidogrel or prasugrel in the TRITON-TIMI 38 trial. A meta-analysis was performed including 13 studies and 16,760 clopidogrel-treated patients. Among clopidogrel-treated subjects, there were no associations between Q192R and active drug metabolite levels (P = 0.62) or change in platelet aggregation (P = 0.51). Consistent with these results, in clopidogrel-treated patients in TRITON-TIMI 38, there was no association between Q192R and the rates of CV death, myocardial infarction, or stroke (RR 11.2 %, QR 8.6 %, and QQ 9.3 %; P = 0.66) or stent thrombosis (RR 2.4 %, QR 0.7 %, and QQ 1.6 %, P = 0.30), with patients with the putative at-risk Q variant having numerically lower event rates. Likewise, among prasugrel-treated subjects, there were no associations between Q192R and active drug metabolite levels (P = 0.88), change in platelet aggregation (P = 0.97), or clinical outcomes (P = 0.72). In a meta-analysis, the Q variant was not significantly associated with MACE (QQ vs. RR 1.22, 95 % CI 0.84-1.76) or stent thrombosis (QQ vs. RR OR 1.36, 95 % CI 0.77-2.38). Furthermore, when restricted to the validation studies, the OR (95 % CI) for MACE and stent thrombosis were 0.99 (0.77-1.27) and 1.23 (0.74-2.03), respectively. In the present study, the Q192R genetic variant in PON1 was not associated with the pharmacologic or clinical

  8. SU-F-19A-02: Comparison of Absorbed Dose to Water Standards for HDR Ir-192 Brachytherapy Between the LCR, Brazil and NRC, Canada

    International Nuclear Information System (INIS)

    Purpose: To compare absorbed dose to water standards for HDR brachytherapy dosimetry developed by the Radiological Science Laboratory of Rio de Janeiro State University (LCR) and the National Research Council, Canada (NRC). Methods: The two institutions have separately developed absorbed dose standards based on the Fricke dosimetry system. There are important differences between the two standards, including: preparation and read-out of the Fricke solution, irradiation geometry of the Fricke holder in relation to the Ir-192 source, and determination of the G-value to be used at Ir-192 energies. All measurements for both standards were made directly at the NRC laboratory (i.e., no transfer instrument was used) using a single Ir-192 source (microSelectron v2). In addition, the NRC group has established a self-consistent method to determine the G-value for Ir-192, based on an interpolation between G-values obtained at Co-60 and 250kVp X-rays, and this measurement was repeated using the LCR Fricke solution to investigate possible systematic uncertainties. Results: G-values for Co-60 and 250 kVp x-rays, obtained using the LCR Fricke system, agreed with the NRC values within 0.5 % and 1 % respectively, indicating that the general assumption of universal G-values is appropriate in this case. The standard uncertainty in the determination of G for Ir-192 is estimated to be 0.6 %. For the comparison of absorbed dose measurements at the reference point for Ir-192 (1 cm depth in water, perpendicular to the seed long-axis), the ratio Dw(NRC)/Dw(LCR) was found to be 1.011 with a combined standard uncertainty of 1.7 %, k=1. Conclusion: The agreement in the absorbed dose to water values for the LCR and NRC systems is very encouraging. Combined with the lower uncertainty in this approach compared to the present air-kerma approach, these results reaffirm the use of Fricke solution as a potential primary standard for HDR Ir-192 brachytherapy

  9. Chemonuclear studies for identification for new production routes for the therapeutically useful radionuclides {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt, und {sup 195m}Pt; Kernchemische Studien zur Entwicklung neuerer Produktionsverfahren fuer die therapierelevanten Radionuklide {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt, und {sup 195m}Pt

    Energy Technology Data Exchange (ETDEWEB)

    Hilgers, K.

    2005-12-15

    New production routes for the therapeutically useful radionuclides {sup 140}Nd, {sup 192}Ir, {sup 191}Pt, {sup 193m}Pt and {sup 195m}Pt were investigated. Cross section data were measured using the stacked-foil technique and compared with theoretical calculations. A production method for the platinum nuclides was developed. The {sup 141}Pr(p, 2n){sup 140}Nd and {sup nat}Ce({sup 3}He, xn){sup 140}Nd reactions were investigated for production of {sup 140}Nd. Cross section data of nuclear reactions leading to the side products {sup 141}Nd, {sup 139}Nd and {sup 139}Ce could also be achieved. The experimental data were compared with theoretical calculations using the code ALICE-IPPE. A comparison of the calculated thick target yields showed that the {sup 141}Pr(p, 2n){sup 140}Nd reaction gives a higher yield. The {sup 192}Os(p, n){sup 192}Ir reaction was examined in the context of the production of {sup 192}Ir. Cross section data were determined and compared with theoretical calculations using the codes ALICE-IPPE and EMPIRE II. The yield of this reaction was compared with the yield of the reactor production of this nuclide. The reactor production seems to be more suitable because of a higher purity and yield. Cross section data were measured for the {sup 192}Os({alpha}, n){sup 195m}Pt, {sup 192}Os({alpha}, 3n){sup 193m}Pt and {sup 192}Os({sup 3}He, 4n){sup 191}Pt reactions. The activity of {sup 193m}Pt and {sup 195m}Pt was determined by X-ray spectroscopy after a chemical separation procedure. The ALICE-IPPE code was found to be inappropriate to reproduce the experimental values. The calculated yields were compared with the yields of other reactions, especially the reactor production of {sup 195m}Pt. The yield of the {sup 192}Os({alpha}, n){sup 195m}Pt reaction is lower compared to the yield of the reactor production, but offers lower target costs and higher specific activity. A production method for {sup 193m}Pt and {sup 195m}Pt was developed. Batch yields of 0.9 MBq

  10. The Fornax Deep Survey with VST. I. The Extended and Diffuse Stellar Halo of NGC 1399 out to 192 kpc

    Science.gov (United States)

    Iodice, E.; Capaccioli, M.; Grado, A.; Limatola, L.; Spavone, M.; Napolitano, N. R.; Paolillo, M.; Peletier, R. F.; Cantiello, M.; Lisker, T.; Wittmann, C.; Venhola, A.; Hilker, M.; D'Abrusco, R.; Pota, V.; Schipani, P.

    2016-03-01

    We have started a new, deep multi-imaging survey of the Fornax cluster, dubbed the Fornax Deep Survey (FDS), at the VLT Survey Telescope (VST). In this paper we present the deep photometry inside two square degrees around the bright galaxy NGC 1399 in the core of the cluster. We found that the core of the Fornax cluster is characterized by a very extended and diffuse envelope surrounding the luminous galaxy NGC 1399: we map the surface brightness out to 33 arcmin (˜192 kpc) from the galaxy center and down to μg ˜ 31 mag arcsec-2 in the g band. The deep photometry allows us to detect a faint stellar bridge in the intracluster region on the west side of NGC 1399 and toward NGC 1387. By analyzing the integrated colors of this feature, we argue that it could be due to the ongoing interaction between the two galaxies, where the outer envelope of NGC 1387 on its east side is stripped away. By fitting the light profile, we found that there exists a physical break radius in the total light distribution at R = 10 arcmin (˜58 kpc) that sets the transition region between the bright central galaxy and the outer exponential halo, and that the stellar halo contributes 60% of the total light of the galaxy (Section 3.5). We discuss the main implications of this work on the build-up of the stellar halo at the center of the Fornax cluster. By comparing with the numerical simulations of the stellar halo formation for the most massive bright cluster galaxies (i.e., 13\\lt {log}{M}200/{M}⊙ \\lt 14), we find that the observed stellar halo mass fraction is consistent with a halo formed through the multiple accretion of progenitors with stellar mass in the range 108-1011 M⊙. This might suggest that the halo of NGC 1399 has also gone through a major merging event. The absence of a significant number of luminous stellar streams and tidal tails out to 192 kpc suggests that the epoch of this strong interaction goes back to an early formation epoch. Therefore, different from the Virgo

  11. Carcinoma of the cervix: analysis of complications after primary external beam radiation and Ir-192 HDR brachytherapy

    International Nuclear Information System (INIS)

    Background and purpose: There is still a concern that the use of HDR brachytherapy might result in an increase of late tissue damage. This retrospective study evaluates the incidence and severity of late complications in patients with carcinoma of the cervix who underwent combined external beam radiation (EBR) and Ir-192 HDR brachytherapy and attempts to identify pretreatment and treatment parameters correlating with late complications. Material and methods: Between 1985 and 1992, 161 patients with carcinoma of the cervix (FIGO stages IB-IVB) received EBR to the pelvis (ave. max. dose 48.8 Gy) followed by 1-6 Ir-192 HDR placements (median 2). Doses to point A ranged from 8.5 to 38.7 Gy (median 17 Gy). Parameters examined included age, diabetes, obesity, history of inflammatory bowel disease or diverticulitis, prior surgery, hemoglobin level, FIGO stage, EBR dose, technique and daily dose fraction, number of HDR treatments and total dose to point A, maximum doses to bladder and rectum delivered by brachytherapy and cumulative dose to point A. Median follow-up for all patients was 37 months. Complications were rated using an in-house scoring system and according to the French-Italian Glossary (FIG). Results: Actuarial 5-year survival was 93%, 57%, 46%, and 0% for stages IB, II, IIIB, and IV, respectively. Of 161 patients, 11% developed moderate and 3.7% severe sequelae (FIG: 2.5%, 3.7%). Since some patients experienced more than one complication, the overall incidence was 13.6% and 4.9% (FIG: 3.1%, 4.9%) with respective 5-year actuarial rates of 14% and 5% for moderate, and 2% and 8% for severe bowel and genitourinary tract complications (FIG: 3.5%, 0, and 2%, 8%). All severe bowel complications occurred within 1.5 years whereas urinary tract sequelae continued to develop throughout the follow-up period. FIGO stage was associated with a significant increase in late sequelae (P=0.015). Analysis of the remaining pretreatment and treatment parameters failed to reveal

  12. Production of the sealed gamma-radiation sources of with iridium-192 radionuclide at the WWR-K research reactor

    International Nuclear Information System (INIS)

    Full text: Conversion orientation of the WWR-K research reactor activity was established after renewal of its operation in 1997. A priority in reactor works was determined in the decision of tasks of practical use of nuclear technologies in a national economy in the next directions: in an industry, public health services and agriculture. The items of prime tasks: development and introduction of radiation technologies and manufacturing of radioisotopes for industry. This task included both scientific and technical program in the list of works of the Republican goals. At the WWR-K reactor within the framework of the this task solution the works on pilot production of the sealed sources of radioactive radiations (SSRR) with Ir-192 radionuclide for an industry of Republic of Kazakhstan were made. Organizational questions related to the Kazakhstan authority body and the regulating documentation were solved the first of all. The second stage was the development of the techniques of creating of devices providing an samples irradiation in reactor, control of sources sealing, measurements of the equivalent radiation doze from sources and high-quality support of SSRR manufacture over all technological way. At the third stage was made a little quantity SSRR with Ir-192 radionuclide, such as GIID-A1 (G6), for 'TEKOPS-660' Gammaray Projectors. This work served as experimental check of the decisions correctness, and has allowed to remove those lacks, to find out which it was possible only during direct manufacturing of radioactive sources. During performance of all these works the following was carried out: development and release of the documents and specifications regulating work on SSRR manufacture at the Institute of Nuclear Physics; personnel preparation and certification; preparation and equipment providing of reactor hot chambers by additional devices for work with irradiated iridium samples; development and manufacturing of the devices for iridium samples irradiation in

  13. 192例IgA肾病临床与牛津病理分型的分析%Analysis of the clinical characteristics and the Oxford classification of 192 cases of IgA nephropathy

    Institute of Scientific and Technical Information of China (English)

    马也娉; 李荣山; 王晨; 乔玉峰; 高丽芳

    2013-01-01

    目的 探讨IgA肾病患者的临床表现与牛津病理分型的相关性.方法 分析192例IgA肾病患者的临床表现(年龄、性别、病程、血压、血尿、24 h尿蛋白定量、血肌酐、血清白蛋白、甘油三酯、胆固醇、估计肾小球滤过率(eGFR))与病理资料(系膜细胞增生、内皮细胞增生、节段硬化或粘连、肾小管萎缩或间质纤维化、小动脉积分、细胞或细胞纤维新月体)的相关性.结果 (1)192例IgA肾病患者临床表现以蛋白尿合并血尿最多见,为72例(37.5%),依次为肾病综合征42例(21.9%),肾功能不全29例(15.1%),合并高血压72例(37.5%);(2)牛津病理分型中M1占60.0%,E1占55.2%,S1占46.9%,T0、T1、T2分别占59.9%、22.9%、17.2%,46.9%的患者存在小动脉内膜增厚,48.5%存在细胞或细胞纤维新月体,部分病理类型与年龄有关(P<0.01);(3)尿蛋白定量与系膜细胞增生、肾小管萎缩或间质纤维化、细胞或细胞纤维新月体有关(P <0.01或P<0.05).血压、肾功与节段硬化或粘连、肾小管萎缩或间质纤维化、小动脉内膜增厚、细胞或细胞纤维月体有关(P<0.01或P<0.05).结论 牛津病理分型对IgA肾病的治疗和预后评价有很好的指导作用.%Objective To investigate the relationship of the clinical characteristics and the Oxford classification of IgA nephropathy.Methods Clinical presentation (age,gender,course of disease,blood pressure,hematuria,24-hour proteinuria,serum creatinine,serum albumin,triglyceride,cholesterol,and estimated glomerular filtration rate (eGFR)),pathological data (mesangial hypercellularity,endocapillary hypercellularity,segmental sclerosis or adhesions,tubular atrophy or interstitial fibrosis,artery score,and cellular + fiberocellular crescents) and their correlation of 192 patients with IgA nephropathy patients were analyzed.Results (1)Clinically,hematuria + albuminuria type was the most common among 192 the patients

  14. Bile duct sensitivity to high-dose-rate afterloading irradiation with iridium 192. Experimental investigations in pigs. Strahlenempfindlichkeit des gesunden Gallengangs bei High-dose-rate-Afterloadingbestrahlung mit Iridium 192. Experimentelle Untersuchungen am Schwein

    Energy Technology Data Exchange (ETDEWEB)

    Brambs, H.J. (Abt. Roentgendiagnostik und Roentgen- und Strahlentherapie, Universitaetsklinik Freiburg (Germany) Pathologisches Inst., Freiburg Univ. (Germany) Tierhygienisches Inst., Freiburg Univ. (Germany)); Freund, U. (Abt. Roentgendiagnostik und Roentgen- und Strahlentherapie, Universitaetsklinik Freiburg (Germany) Pathologisches Inst., Freiburg Univ. (Germany) Tierhygienisches Inst., Freiburg Univ. (Germany)); Bruggmoser, G. (Abt. Roentgendiagnostik und Roentgen- und Strahlentherapie, Universitaetsklinik Freiburg (Germany) Pathologisches Inst., Freiburg Univ. (Germany) Tierhygienisches Inst., Freiburg Univ. (Germany)); Laaff, H. (Abt. Roentgendiagnostik und Roentgen- und Strahlentherapie, Universitaetsklinik Freiburg (Germany) Pathologisches Inst., Freiburg Univ. (Germany) Tierhygienisches Inst., Freiburg Univ. (Germany)); Kluger, U.W. (Abt. Roentgendiagnostik und Roentgen- und Strahlentherapie, Universitaetsklinik Freiburg (Germany) Pathologisches Inst., Freiburg Univ. (Ger

    1993-12-01

    This animal study was designed to assess the tolerance of the normal bile duct to a single intraluminal high-dose-rate afterloading irradiation. This information is essential for treatment recommendations in irradiation therapy of malignant bile duct stenoses. In 16 pigs bile duct catheters were inserted surgically. Over these devices single intraductal doses of 7.5 Gy and 15 Gy were applied using an iridium-192 source. After a period of two to three months the bile ducts and the surrounding structures were investigated by means of cholangiography, angiography, and macropathological and histological investigations. A single intraductal dose of 7.5 Gy leads to a slightly scarred shrinkage of the bile duct with sclerosis and obliteration of the capillary vessels. Vasculitis and necrosis of the bile duct wall are still evident three months after irradiation. A single dose of 15 Gy leads to severe lesions with widespread necroses of the bile duct wall which tend to bleed, and result in a high degree of shrinkage of the bile duct. The radiation damage is most prevalent near the papilla and in the narrow segments near the liver. Single intraluminal high-dose-rate afterloading doses of 7.5 and 15 Gy cause significant lesions and complications at the bile ducts. As the intact bile duct is the Achilles heel of intraductal therapy, considerably lower single doses are recommended for a fractioned treatment. (orig.)

  15. Experimental 3D dosimetry around a high-dose-rate clinical 192Ir source using a polyacrylamide gel (PAG) dosimeter

    International Nuclear Information System (INIS)

    It is well known that the experimental dosimetry of brachytherapy sources presents a challenge. Depending on the particular dosimeter used, measurements can suffer from poor spatial resolution (ion chambers), lack of 3D information (film) or errors due to the presence of the dosimeter itself distorting the radiation flux. To avoid these problems, we have investigated the dosimetry of a clinical 192Ir source using a polyacrylamide gel (PAG) dosimeter. Experimental measurements of dose versus radial distance from the centre of the source (cross-line plots) were compared with calculations produced with a Nucletron NPS planning system. Good agreement was found between the planning system and gel measurements in planes selected for analysis. Gel dosimeter measurements in a coronal plane through the phantom showed a mean difference between measured absorbed dose and calculated dose of 0.17 Gy with SD=0.13Gy. Spatially, the errors at the reference point remain within one image pixel (1.0 mm). The use of polymer gel dosimetry shows promise for brachytherapy applications, offering complete, three-dimensional dose information, good spatial resolution and small measurement errors. Measurements close to the source, however, are difficult, due to some of the limiting properties of the polyacrylamide gel. (author)

  16. Treatment of malignant biliary obstruction by endoscopic implantation of iridium 192 using a new double lumen endoprosthesis

    International Nuclear Information System (INIS)

    Iridium 192 seeds contained in a ribbon were preloaded into a new double lumen 11 Fr endoprosthesis which was then inserted into malignant strictures of the bile duct and ampulla and left in place for 48 hours until 5000 rads were delivered to the tumor. The procedure was carried out in 14 patients (7 women, 7 men; mean age, 63.2 years; range, 46 to 86 years). Six patients were treated for cholangiocarcinomas, four with pancreatic carcinomas, and four with ampullary carcinomas. No complications occurred. The mean survival of the group was 7 months (range, 3 days to 27 months). This new technique provides both intraluminal brachytherapy and biliary drainage and is inserted intraduodenally across the papilla of Vater avoiding puncture of the liver and external hardware required by the percutaneous technique and hardware necessitated with a nasobiliary tube. Following removal of the iridium prosthesis, a large caliber endoprosthesis is inserted for continued decompression. Because of proven efficacy of endoprostheses, this new technique should be considered when intraluminal irradiation is indicated

  17. Refresher course title: human health effects abstract title: Case Report: Iridium 192 - Health effects during 20 years after irradiation

    International Nuclear Information System (INIS)

    Case Report has presented health effects of high level of irradiation with gamma rays from 192Ir on the patient M. L. during 21 years after an incident. The main purpose was to investigate long time consequences of partial high level irradiation on human health. Locally, short-term irradiation with high, deadly dose, caused acute radiation syndrome with reversible disorder of function of the individual, most exposed, organs. Frequency of chromosomal aberrations (dicentric), characteristic for direct irradiation, was increased. However, dicentric analyzes did not give expected result for an acute radioactivity illness. Radio-dermatitis had begun already after the incident, while changes on the heart began gradually, not earlier than six months, up to two years after the incident. Irradiated parts of the patient skin have been changed with auto-transplanted skin and appropriate therapy had been taken. More than two decades after the irradiation, system (leukemia) nor solitary tumor on near organs (liver, heart, lungs, bones) did not happened. Radiation illness did not happened in spite of very large dose, because impacts were local and body was uneven irradiated. Also, an appropriate therapy was organized and potential illness did not happen. (authors)

  18. The Fornax Deep Survey with VST. I. The extended and diffuse stellar halo of NGC~1399 out to 192 kpc

    CERN Document Server

    Iodice, E; Grado, A; Limatola, L; Spavone, M; Napolitano, N R; Paolillo, M; Peletier, R F; Cantiello, M; Lisker, T; Wittmann, C; Venhola, A; Hilker, M; D'Abrusco, R; Pota, V; Schipani, P

    2016-01-01

    [Abrigded] We have started a new deep, multi-imaging survey of the Fornax cluster, dubbed Fornax Deep Survey (FDS), at the VLT Survey Telescope. In this paper we present the deep photometry inside two square degrees around the bright galaxy NGC1399 in the core of the cluster. We found a very extended and diffuse envelope surrounding the luminous galaxy NGC1399: we map the surface brightness out to 33 arcmin (~ 192 kpc) from the galaxy center and down to about 31 mag/arcsec^2 in the g band. The deep photometry allows us to detect a faint stellar bridge in the intracluster region between NGC1399 and NGC1387. By analyzing the integrated colors of this feature, we argue that it could be due to the ongoing interaction between the two galaxies, where the outer envelope of NGC1387 on its east side is stripped away. By fitting the light profile, we found that it exists a physical break radius in the total light distribution at R=10 arcmin (~58 kpc) that sets the transition region between the bright central galaxy and...

  19. Combined treatment of localized prostata cancer with HDR-Iridium 192 remote brachytherapy and external beam irradiation

    International Nuclear Information System (INIS)

    Background: The localized prostate cancer can be treated curatively by radiation therapy. The combined treatment of external beam irradiation and HDR-Iridium 192 remote brachytherapy allows higher radiation doses within the tumor without increasing radiation sequelae. Patients and Methods: Patients of our clinic have been treated with this combined procedure since 1991. Between 1991 and 1994 15 patients received 2x9 Gy of high-dose-rate brachytherapy, followed by 36 Gy external beam irradiation (group A). Because of the frequent local failures in group A, the reference dose of external beam irradiation was increased to 50.4 Gy after brachytherapy between 1994 and 1996. Results: Seven of 15 patients (47%) in group A developed a local recurrence after a median of 17 (13 to 30) months. In group B (20 patients) local failure occurred in 3 patients (15%) after 11, 16 and 32 months. Conclusion: The combined radiation therapy of localized prostate cancer cannot substitute radical prostatectomy completely, but it is a promising alternative in the curative treatment in selected patients. (orig.)

  20. Characterization of the four new transiting planets KOI-188b, KOI-195b, KOI-192b, and KOI-830b

    CERN Document Server

    Hebrard, G; Montagnier, G; Bruno, G; Deleuil, M; Havel, M; Almenara, J -M; Damiani, C; Barros, S C C; Bonomo, A S; Bouchy, F; Diaz, R F; Moutou, C

    2014-01-01

    The characterization of four new transiting extrasolar planets is presented here. KOI-188b and KOI-195b are bloated hot Saturns, with orbital periods of 3.8 and 3.2 days, and masses of 0.25 and 0.34 M_Jup, respectively. They are located in the low-mass range of known transiting, giant planets. KOI-192b has a similar mass (0.29 M_Jup) but a longer orbital period of 10.3 days. This places it in a domain where only few planets are known. KOI-830b, finally, with a mass of 1.27 M_Jup and a period of 3.5 days, is a typical hot Jupiter. The four planets have radii of 0.98, 1.09, 1.2, and 1.08 R_Jup, respectively. We detected no significant eccentricity in any of the systems, while the accuracy of our data does not rule out possible moderate eccentricities. The four objects were first identified by the Kepler Team as promising candidates from photometry of the Kepler satellite. We establish here their planetary nature thanks to the radial velocity follow-up we secured with the HARPS-N spectrograph at the Telescopio N...

  1. /sup 192/Ir pharyngoepiglottic fold interstitial implants. The key to successful treatment of base tongue carcinoma by radiation therapy

    Energy Technology Data Exchange (ETDEWEB)

    Goffinet, D.R.; Fee, W.E. Jr.; Wells, J.; Austin-Seymour, M.; Clarke, D.; Mariscal, J.M.; Goode, R.L.

    1985-03-01

    Twenty-eight patients with squamous carcinomas of the base tongue were seen and evaluated in a conjoint Head and Neck Tumor Board at Stanford between 1976 and 1982. Fourteen patients were treated by combined external beam and interstitial irradiation, 11 of whom had Stage III and IV carcinomas (American Joint Committee). An initial dose of 5000 to 5500 rad was first delivered by external beam irradiation in 5 to 5.5 weeks, followed approximately 3 weeks later by an iridium 192 interstitial implant boost by the trocar and loop technique. The key to successful treatment of these neoplasms was found to be the use of a lateral percutaneous cervical technique, which placed horizontal loops through the oropharyngeal wall above and below the hyoid bone; the superior loop included the pharyngoepiglottic fold and the tonsilloglossal groove. Standard multiple loop implants (submentally inserted) of the base tongue from the vallecula anteriorly to the circumvallate papillae were also used routinely. This approach has been successful, since 10 of the 14 patients (71%) remain without evidence of disease (mean follow-up, 32 months). There have been only two local recurrences, both on the pharyngoepiglottic fold in patients who did not receive the now standard pharyngoepiglottic fold/lateral pharyngeal wall implants. No patients have relapsed after 18 months. The other 14 patients were treated prospectively during the same period by combining initial resection, radical neck dissection, and postoperative irradiation.

  2. Refresher course title: human health effects abstract title: Case Report: Iridium 192 - Health effects during 20 years after irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Snezana, Milacica [Belgrade Univ. of Institute of Occupational Medicine and Radiological Protection, Faculty of Medicine, Belgrade (Serbia and Montenegro); Jadranko, Simic [South East Europe Consultants, Belgrade (Serbia and Montenegro)

    2006-07-01

    Case Report has presented health effects of high level of irradiation with gamma rays from {sup 192}Ir on the patient M. L. during 21 years after an incident. The main purpose was to investigate long time consequences of partial high level irradiation on human health. Locally, short-term irradiation with high, deadly dose, caused acute radiation syndrome with reversible disorder of function of the individual, most exposed, organs. Frequency of chromosomal aberrations (dicentric), characteristic for direct irradiation, was increased. However, dicentric analyzes did not give expected result for an acute radioactivity illness. Radio-dermatitis had begun already after the incident, while changes on the heart began gradually, not earlier than six months, up to two years after the incident. Irradiated parts of the patient skin have been changed with auto-transplanted skin and appropriate therapy had been taken. More than two decades after the irradiation, system (leukemia) nor solitary tumor on near organs (liver, heart, lungs, bones) did not happened. Radiation illness did not happened in spite of very large dose, because impacts were local and body was uneven irradiated. Also, an appropriate therapy was organized and potential illness did not happen. (authors)

  3. Establishment of in vitro 192Ir γ-ray dose-response relationship for dose assessment by the lymphocyte dicentric assay

    Science.gov (United States)

    Kowalska, Maria; Meronka, Katarzyna; Szewczak, Kamil

    2012-03-01

    In vitro dose-response relationships are used to describe the relation between dicentric chromosomes and radiation dose for human peripheral blood lymphocytes. The dicentric yield depends on both the dose and the radiation quality. Thus, for reliable dose estimation in vitro dose responses must be determined for different radiation qualities. This paper reports the work for setting up the relationship for the dicentric production in the lymphocytes exposed in vitro to 192Ir g-rays at Central Laboratory for Radiological Protection (CLOR). In a case of a radiation accident in industrial radiography using 192Ir sealed sources, this will be the basis for the indirect evaluation of the g-ray dose to which an accidental victim was exposed.

  4. Dosimetric verification of source strength for HDR afterloading units with 192Ir- and 60Co- photon sources: comparison of three different international protocols

    International Nuclear Information System (INIS)

    Before clinical use of a brachytherapy source, regulations or recommendations by medical physics societies require an independent measurement of its air kerma strength by a qualified medical physicist. Currently, in addition to 192Ir, also HDR-60Co sources are increasingly coming into operation. However, the existing dosimetry protocols do not provide any guidelines for 60Co sources. The purpose of this work was therefore to compare air Kerma rate measurements as recommended by different dosimetry protocols for 192Ir HDR sources and to test their applicability to 60Co sources. Dosimetric verification of HDR afterloading source specification was performed according to three protocols, DIN 6809-2 (1993) in combination with DGMP-Report 13 (2006), IAEA-TECDOC-1274 (2002) and AAPM Report 41 (1993) for the nuclides 192Ir and 60Co. Measurements of the sources reference air kerma rate were performed with 3 different methods (with a cylindrical chamber both in a solid phantom and in free air, and with a well chamber) and evaluated using all three protocols for each type of source and method of measurement. The measurements with all protocols and methods show deviations from the certified specification smaller than about 1.2% for 192Ir and 2.5% for 60Co sources. The measurements with the well chamber showed the lowest deviations from the certificate value. Air kerma rate measurements for 60Co HDR sources using the existing protocols are possible with accuracy sufficient to verify source calibration as provided by the source certificate. However, extension of the protocols by correction factors for measurement with 60Co sources would be helpful. (author)

  5. Role of trypsin-like cleavage at arginine 192 in the enzymatic and cytotonic activities of Escherichia coli heat-labile enterotoxin.

    Science.gov (United States)

    Grant, C C; Messer, R J; Cieplak, W

    1994-01-01

    Previous studies of cholera toxin and Escherichia coli heat-labile enterotoxin have suggested that proteolytic cleavage plays an important role in the expression of ADP-ribosyltransferase activity and toxicity. Specifically, several studies have implicated a trypsin-like cleavage at arginine 192, which lies within an exposed region subtended by a disulfide bond in the intact A subunit, in toxicity. To investigate the role of this modification in the enzymatic and cytotonic properties of heat-labile enterotoxin, the response of purified, recombinant A subunit to tryptic activation and the effect of substituting arginine 192 with glycine on the activities of the holotoxin were examined. The recombinant A subunit of heat-labile enterotoxin exhibited significant levels of ADP-ribosyltransferase activity that were only nominally increased (approximately twofold) by prior limited trypsinolysis. The enzymatic activity also did not appear to be affected by auto-ADP-ribosylation that occurs during the high-level synthesis of the recombinant A subunit in E. coli. A mutant form of the holotoxin containing the arginine 192-to-glycine substitution exhibited levels of cytotonic activity for CHO cells that were similar to that of the untreated, wild-type holotoxin but exhibited a marked delay in the ability to increase intracellular levels of cyclic AMP in Caco-2 cells. The results indicate that trypsin-like cleavage of the A subunit of E. coli heat-labile enterotoxin at arginine 192 is not requisite to the expression of enzymatic activity by the A subunit and further reveal that this modification, although it enhances the biological and enzymatic activities of the toxin, is not absolutely required for the enterotoxin to elicit cytotonic effects. Images PMID:7927684

  6. Role of trypsin-like cleavage at arginine 192 in the enzymatic and cytotonic activities of Escherichia coli heat-labile enterotoxin.

    OpenAIRE

    C.C. Grant; Messer, R J; Cieplak, W

    1994-01-01

    Previous studies of cholera toxin and Escherichia coli heat-labile enterotoxin have suggested that proteolytic cleavage plays an important role in the expression of ADP-ribosyltransferase activity and toxicity. Specifically, several studies have implicated a trypsin-like cleavage at arginine 192, which lies within an exposed region subtended by a disulfide bond in the intact A subunit, in toxicity. To investigate the role of this modification in the enzymatic and cytotonic properties of heat-...

  7. An absorbed dose to water standard for HDR 192Ir brachytherapy sources based on water calorimetry: Numerical and experimental proof-of-principle

    International Nuclear Information System (INIS)

    Water calorimetry is an established technique for absorbed dose to water measurements in external beams. In this paper, the feasibility of direct absorbed dose measurements for high dose rate (HDR) iridium-192 (192Ir) sources using water calorimetry is established. Feasibility is determined primarily by a balance between the need to obtain sufficient signal to perform a reproducible measurement, the effect of heat loss on the measured signal, and the positioning uncertainty affecting the source-detector distance. The heat conduction pattern generated in water by the Nucletron microSelectron-HDR 192Ir brachytherapy source was simulated using COMSOL MULTIPHYSICSTM software. Source heating due to radiation self-absorption was calculated using EGSnrcMP. A heat-loss correction kc was calculated as the ratio of the temperature rise under ideal conditions to temperature rise under realistic conditions. The calorimeter setup used a parallel-plate calorimeter vessel of 79 mm diameter and 1.12 mm thick front and rear glass windows located 24 mm apart. Absorbed dose was measured with two sources with nominal air kerma strengths of 38 000 and 21 000 U, at source-detector separations ranging from 24.7 to 27.6 mm and irradiation times of 36.0 to 80.0 s. The preliminary measured dose rate per unit air kerma strength of (0.502±0.007) μGy/(s U) compares well with the TG-43 derived 0.505 μGy/(s U). This work shows that combined dose uncertainties of significantly less than 5% can be achieved with only modest modifications of current water calorimetry techniques and instruments. This work forms the basis of a potential future absolute dose to water standard for HDR 192Ir brachytherapy

  8. An absorbed dose to water standard for HDR 192Ir brachytherapy sources based on water calorimetry: numerical and experimental proof-of-principle.

    Science.gov (United States)

    Sarfehnia, Arman; Stewart, Kristin; Seuntjens, Jan

    2007-12-01

    Water calorimetry is an established technique for absorbed dose to water measurements in external beams. In this paper, the feasibility of direct absorbed dose measurements for high dose rate (HDR) iridium-192 (192Ir) sources using water calorimetry is established. Feasibility is determined primarily by a balance between the need to obtain sufficient signal to perform a reproducible measurement, the effect of heat loss on the measured signal, and the positioning uncertainty affecting the source-detector distance. The heat conduction pattern generated in water by the Nucletron microSelectron-HDR 192Ir brachytherapy source was simulated using COMSOL MULTIPHYSICS software. Source heating due to radiation self-absorption was calculated using EGSnrcMP. A heat-loss correction k(c) was calculated as the ratio of the temperature rise under ideal conditions to temperature rise under realistic conditions. The calorimeter setup used a parallel-plate calorimeter vessel of 79 mm diameter and 1.12 mm thick front and rear glass windows located 24 mm apart. Absorbed dose was measured with two sources with nominal air kerma strengths of 38 000 and 21 000 U, at source-detector separations ranging from 24.7 to 27.6 mm and irradiation times of 36.0 to 80.0 s. The preliminary measured dose rate per unit air kerma strength of (0.502 +/- 0.007) microGy/(s U) compares well with the TG-43 derived 0.505 microGy/(s U). This work shows that combined dose uncertainties of significantly less than 5% can be achieved with only modest modifications of current water calorimetry techniques and instruments. This work forms the basis of a potential future absolute dose to water standard for HDR 192Ir brachytherapy. PMID:18196821

  9. Phosphorylation of serine residue modulates cotton Di19-1 and Di19-2 activities for responding to high salinity stress and abscisic acid signaling

    Science.gov (United States)

    Qin, Li-Xia; Nie, Xiao-Ying; Hu, Rong; Li, Gang; Xu, Wen-Liang; Li, Xue-Bao

    2016-01-01

    Di19 (drought-induced protein 19) family is a novel type of Cys2/His2 zinc-finger proteins. In this study, we demonstrated that cotton Di19-1 and Di19-2 (GhDi19-1/-2) proteins could be phosphorylated in vitro by the calcium-dependent protein kinase (CDPK). Mutation of Ser to Ala in N-terminus of GhDi19-1/-2 led to the altered subcellular localization of the two proteins, but the constitutively activated form (Ser was mutated to Asp) of GhDi19-1/-2 still showed the nuclear localization. GhDi19-1/-2 overexpression transgenic Arabidopsis seedlings displayed the hypersensitivity to high salinity and abscisic acid (ABA). However, Ser site-mutated GhDi19-1(S116A) and GhDi19-2(S114A), and Ser and Thr double sites-mutated GhDi19-1(S/T-A/A) and GhDi19-2(S/T-A/A) transgenic Arabidopsis did not show the salt- and ABA-hypersensitive phenotypes. In contrast, overexpression of Thr site-mutated GhDi19-1(T114A) and GhDi19-2(T112A) in Arabidopsis still resulted in salt- and ABA-hypersensitivity phenotypes, like GhDi19-1/-2 transgenic lines. Overexpression of GhDi19-1/-2 and their constitutively activated forms in Atcpk11 background could recover the salt- and ABA-insensitive phenotype of the mutant. Thus, our results demonstrated that Ser phosphorylation (not Thr phosphorylation) is crucial for functionally activating GhDi19-1/-2 in response to salt stress and ABA signaling during early plant development, and GhDi19-1/-2 proteins may be downstream targets of CDPKs in ABA signal pathway. PMID:26829353

  10. Technical Note: Removing the stem effect when performing Ir-192 HDR brachytherapy in vivo dosimetry using plastic scintillation detectors: A relevant and necessary step

    International Nuclear Information System (INIS)

    Purpose: The purpose of this study was to investigate whether or not a stem effect removal technique is necessary when performing Ir-192 HDR brachytherapy in vivo dosimetry using a scintillation detector. Methods: A red-green-blue photodiode connected to a multichannel electrometer was used to detect the light emitted from a plastic scintillation detector (PSD) during irradiation with an Ir-192 HDR brachytherapy source. Accuracy in dose measurement was compared with and without the use of stem effect removal techniques. Monochromatic and polychromatic filtration techniques were studied. An in-house template was built for accurate positioning of catheters in which the source and the PSD were inserted. Dose distribution was measured up to 5 cm from source to detector in the radial and longitudinal directions. Results: The authors found the stem effect to be particularly important when the source was close to the optical fiber guide and far from the scintillation component of the detector. It can account for up to (72±3)% of the signal under clinically relevant conditions. The polychromatic filtration outperformed the monochromatic filtration as well as the absence of filtration in regard to dose measurement accuracy. Conclusions: It is necessary to implement a stem effect removal technique when building a PSD for in vivo dosimetry during Ir-192 HDR brachytherapy. The PSD that the authors have developed for this study would be suitable for such an application.

  11. A practical implementation of the 2010 IPEM high dose rate brachytherapy code of practice for the calibration of {sup 192}Ir sources

    Energy Technology Data Exchange (ETDEWEB)

    Awunor, O A; Lecomber, A R; Richmond, N; Walker, C, E-mail: Onuora.Awunor@stees.nhs.uk [Regional Medical Physics Department, James Cook University Hospital, Marton Road, Middlesbrough, TS4 3BW (United Kingdom)

    2011-08-21

    This paper details a practical method for deriving the reference air kerma rate calibration coefficient for Farmer NE2571 chambers using the UK Institute of Physics and Engineering in Medicine (IPEM) code of practice for the determination of the reference air kerma rate for HDR {sup 192}Ir brachytherapy sources based on the National Physical Laboratory (NPL) air kerma standard. The reference air kerma rate calibration coefficient was derived using pressure, temperature and source decay corrected ionization chamber response measurements over three successive {sup 192}Ir source clinical cycles. A secondary standard instrument (a Standard Imaging 1000 Plus well chamber) and four tertiary standard instruments (one additional Standard Imaging 1000 Plus well chamber and three Farmer NE2571 chambers housed in a perspex phantom) were used to provide traceability to the NPL primary standard and enable comparison of performance between the chambers. Conservative and optimized estimates on the expanded uncertainties (k = 2) associated with chamber response, ion recombination and reference air kerma rate calibration coefficient were determined. This was seen to be 2.3% and 0.4% respectively for chamber response, 0.2% and 0.08% respectively for ion recombination and 2.6% and 1.2% respectively for the calibration coefficient. No significant change in ion recombination with source decay was observed over the duration of clinical use of the respective {sup 192}Ir sources.

  12. An asteroseismic constraint on the mass of the axion from the period drift of the pulsating DA white dwarf star L19-2

    CERN Document Server

    Córsico, Alejandro H; Althaus, Leandro G; García-Berro, Enrique; Isern, Jordi; Kepler, S O; Bertolami, Marcelo M Miller; Sullivan, Denis J; Chote, Paul

    2016-01-01

    We employ an asteroseismic model of L19-2, a relatively massive ($M_{\\star} \\sim 0.75 M_{\\sun}$) and hot ($T_{\\rm eff} \\sim 12\\,100$ K) pulsating DA (H-rich atmosphere) white dwarf star (DAV or ZZ Ceti variable), and use the observed values of the temporal rates of period change of its dominant pulsation modes ($\\Pi \\sim 113$ s and $\\Pi \\sim 192$ s), to derive a new constraint on the mass of the axion, the hypothetical non-barionic particle considered as a possible component of the dark matter of the Universe. If the asteroseismic model employed is an accurate representation of L19-2, then our results indicate hints of extra cooling in this star, compatible with emission of axions of mass $m_{\\rm a} \\cos^2 \\beta \\lesssim 25$ meV or an axion-electron coupling constant of $g_{\\rm ae} \\lesssim 7 \\times 10^{-13}$.

  13. Quality control for thermoluminescent dosemeters TLD-100 de Li F: Mg, Ti for high dose rate treatments using Ir-192 sources in breast, esophagus and bronchus; Control de calidad con dosimetros thermoluminiscentes TLD-100 de Li F: Mg, Ti para tratamientos de alta tasa de dosis com fuentes de Ir-192 en canceres de seno, esofago y bronchio

    Energy Technology Data Exchange (ETDEWEB)

    Torres, F. [Universidad Nacional de Colombia, Bogota (Colombia)]. E-mail: franciscotorreshoyos@yahoo.com; Plazas, M.C. [Instituto Nacional de Cancerologia, Bogota (Colombia); Cavadia, W. [Universidad de Cordoba (Colombia)

    2004-07-01

    Rods - shaped, TLD - 100, LiF: Mg,Ti thermoluminescence dosimeters are used to check duality control during breast, esophagus and bronchus cancer treatments with high rate dose and Ir -192 source. We conclude that the specificity dose in prescription points is in agreement with parameters given in international protocols. (author)

  14. SU-E-T-102: Determination of Dose Distributions and Water-Equivalence of MAGIC-F Polymer Gel for 60Co and 192Ir Brachytherapy Sources

    Energy Technology Data Exchange (ETDEWEB)

    Quevedo, A; Nicolucci, P [University of Sao Paulo, Ribeirao Preto, SP (Brazil)

    2014-06-01

    Purpose: Analyse the water-equivalence of MAGIC-f polymer gel for {sup 60}Co and {sup 192}Ir clinical brachytherapy sources, through dose distributions simulated with PENELOPE Monte Carlo code. Methods: The real geometry of {sup 60} (BEBIG, modelo Co0.A86) and {sup 192}192Ir (Varian, model GammaMed Plus) clinical brachytherapy sources were modelled on PENELOPE Monte Carlo simulation code. The most probable emission lines of photons were used for both sources: 17 emission lines for {sup 192}Ir and 12 lines for {sup 60}. The dose distributions were obtained in a cubic water or gel homogeneous phantom (30 × 30 × 30 cm{sup 3}), with the source positioned in the middle of the phantom. In all cases the number of simulation showers remained constant at 10{sup 9} particles. A specific material for gel was constructed in PENELOPE using weight fraction components of MAGIC-f: wH = 0,1062, wC = 0,0751, wN = 0,0139, wO = 0,8021, wS = 2,58×10{sup −6} e wCu = 5,08 × 10{sup −6}. The voxel size in the dose distributions was 0.6 mm. Dose distribution maps on the longitudinal and radial direction through the centre of the source were used to analyse the water-equivalence of MAGIC-f. Results: For the {sup 60} source, the maximum diferences in relative doses obtained in the gel and water were 0,65% and 1,90%, for radial and longitudinal direction, respectively. For {sup 192}Ir, the maximum difereces in relative doses were 0,30% and 1,05%, for radial and longitudinal direction, respectively. The materials equivalence can also be verified through the effective atomic number and density of each material: Zef-MAGIC-f = 7,07 e .MAGIC-f = 1,060 g/cm{sup 3} and Zef-water = 7,22. Conclusion: The results showed that MAGIC-f is water equivalent, consequently being suitable to simulate soft tissue, for Cobalt and Iridium energies. Hence, gel can be used as a dosimeter in clinical applications. Further investigation to its use in a clinical protocol is needed.

  15. Characterization of TLD-100 in powders for dosimetric quality control of 192 Ir sources used in brachytherapy of high dose rate

    International Nuclear Information System (INIS)

    The Secondary Standard Dosimetric at the National Institute of Nuclear Research (ININ) calibrated a lot of powdered TLD-100 (LiF:Mg,Ti) in terms of absorbed dose to water Dw for the energy of: 60Co, 137Cs, X rays of 250 and 50 kVp. Later on, it is carried out an interpolation of the calibration for the energy of the 192Ir. This calibration is part of a dosimetric quality control program, to solve the problems of traceability for the measurements carried out by the users of 192Ir sources employed in the treatments of High Dose Rate Brachytherapy (HDR) at the Mexican Republic. The calibrations of the radiation beams are made with the following protocols: IAEA TRS-398 for the 60Co for Dw, using a secondary standard ionization chamber PTW N30013 calibrated in Dw by the National Research Council (NRC, Canada). AAPM TG-43 for Dw in terms of the strength kerma Sk, calibrating this last one quantity for the 137Cs radioactive source, with a well chamber HDR 1000 PLUS traceable to the University of Wisconsin (US). AAPM TG-61 for X ray of 250 and 50 kVp for Dw start to Ka using field standard a Farmer chamber PTW 30001 traceable to K for the Central Laboratory of Electric Industries (CLEI, France). The calibration curves (CC) they built for the response of the powder TLD: RTLD vs Dw: For the energy of 60Co, 137Cs, X rays of 250 and 50 kVp. Fitting them with the least square method weighed by means of a polynomial of second grade that corrects the supra linearity of the response. iii. Each one of the curves was validated with a test by lack of fitting and for the Anderson Darling normality test, using the software MINITAB in both cases. iv. The sensibility factor (Fs) for each energy corresponds to the slope of the CC, v. The Fs for the two 192Ir sources used are interpolated: one for a Micro Selectron source and the other one a Vari Source source. Finally, a couple of capsules were sent to two hospitals that have the HDR Brachytherapy with sources of 192Ir and that

  16. Fractionated intraluminal HDR {sup 192}Ir brachytherapy as palliative treatment in patients with endobronchial metastases from non-bronchogenic primaries

    Energy Technology Data Exchange (ETDEWEB)

    Stranzl, H.; Gabor, S.; Mayer, R.; Prettenhofer, U.; Wurzinger, G.; Hackl, A. [University Medical School of Graz (Austria)

    2002-08-01

    Aim: To evaluate the efficacy of iridium-192 high-dose rate (HDR) endobronchial brachytherapy for the palliation of symptoms caused by endobronchial metastases of non-bronchogenic primaries. Patients and method: Between 1991 and 1998, eleven patients (female n=3, male n=8; age: median 66 years, range 44-81 years) underwent intraluminal HDR brachytherapy for histologically confirmed endobronchial metastases from non-pulmonary primary tumors of various sites like urogenital tract (n=5), gastrointestinal tract (n=3), ear/nose/throat (n=2) and breast (n=1). The median time between diagnosis of the primary non-bronchogenic tumor and histopathological diagnosis of the endobronchial metastases was 39 months, range 1-99 months. A total dose of 15-20 Gy was delivered in three to four fractions of 5-6 Gy once a week. No palliative chemotherapy was added. Results: Median follow-up after palliative brachytherapy was 15 months (range 1.4-59 months). Objectively, complete endoscopic response was observed in three (27%) patients, and in five (46%) others partial opening of the initially obstructed airway was achieved. Treatment was judged unsuccessful in three (27%) patients. No patient showed up with local progression. At date of analysis five patients were alive with documented residual tumor (80%) or complete response (20%). Relief of symptoms occurred in the vast majority of patients (n=8, 73%). Conclusion: HDR intraluminal brachytherapy palliates symptoms in patients suffering from endobronchial metastases of nonpulmonary primary tumors. The applied treatment is a safe, effective and well tolerated palliative procedure leading to an improved patient quality of life. (orig.) [German] Hintergrund: Untersuchung des palliativen Effektes einer fraktionierten intraluminalen Iridium-192-High-Dose-Rate-(HDR-)Brachytherapie bei Patienten mit endobronchialen Metastasen eines primaer nicht bronchogenen Tumors. Patienten und Methode: Zwischen April 1991 und September 1998 wurden elf

  17. Cuban laboratory proficiency test for calibration of well-type chambers using two types of HDR 192Ir sources

    International Nuclear Information System (INIS)

    The proficiency test by inter-laboratory comparisons is the commonly accepted procedure both for validation of the testing methods and assuring the quality of the calibration undertaken by the competence laboratories. The Secondary Standard Dosimetry Laboratory (SSDL) of Cuba is located at the Centro de Proteccion e Higiene de las Radiaciones (CPHR). The SSDL has recently implemented the calibration methodology of well-type chambers using the High Dose Rate 192Ir sources under activities of the technical co-operation project with the International Atomic Energy Agency. The reference standard of CPHR is traceable to the primary standard of the German National Metrology Institute (Physikalisch-Technische Bundesanstalt - PTB). The method used by the secondary laboratory follows the Technical Document 1274. On this method the source available is measured in a well-type chamber calibrated against the primary standard. Because there is no HDR afterloader at the SSDL, the calibration of the client source can be done only in the hospital set-up. The user's chamber is calibrated by means of a calibrated source. This method has the advantage that the measurement set-up is simplified but problems can arise from the use of different source designs during calibration of the secondary standard at the primary laboratory and calibration of the user's chambers at the hospital set-up. The variation of the calibration coefficient of the PTW 33004 chamber due to the use of different sources and adapters has already been measured experimentally. The larger differences can be found near 4%. All those facts reinforced the idea to conduct a proficiency test to demonstrate that the calibration procedure used by SSDL can be applied in practice and will not lead to the incorrect calibration coefficient within the stated uncertainty

  18. SU-E-T-457: Design and Characterization of An Economical 192Ir Hemi-Brain Small Animal Irradiator

    Energy Technology Data Exchange (ETDEWEB)

    Grams, M; Wilson, Z; Sio, T; Beltran, C; Tryggestad, E; Gupta, S; Blackwell, C; McCollough, K; Sarkaria, J; Furutani, K [Mayo Clinic, Rochester, MN (United States)

    2014-06-01

    Purpose: To describe the design and dosimetric characterization of a simple and economical small animal irradiator. Methods: A high dose rate 192Ir brachytherapy source from a commercially available afterloader was used with a 1.3 centimeter thick tungsten collimator to provide sharp beam penumbra suitable for hemi-brain irradiation of mice. The unit is equipped with continuous gas anesthesia to allow robust animal immobilization. Dosimetric characterization of the device was performed with Gafchromic film. The penumbra from the small animal irradiator was compared under similar collimating conditions to the penumbra from 6 MV photons, 6 MeV electrons, and 20 MeV electrons from a linear accelerator as well as 300 kVp photons from an orthovoltage unit and Monte Carlo simulated 90 MeV protons. Results: The tungsten collimator provides a sharp penumbra suitable for hemi-brain irradiation, and dose rates on the order of 200 cGy/minute were achieved. The sharpness of the penumbra attainable with this device compares favorably to those measured experimentally for 6 MV photons, and 6 and 20 MeV electron beams from a linear accelerator. Additionally, the penumbra was comparable to those measured for a 300 kVp orthovoltage beam and a Monte Carlo simulated 90 MeV proton beam. Conclusions: The small animal irradiator described here can be built for under $1,000 and used in conjunction with any commercial brachytherapy afterloader to provide a convenient and cost-effective option for small animal irradiation experiments. The unit offers high dose rate delivery and sharp penumbra, which is ideal for hemi-brain irradiation of mice. With slight modifications to the design, irradiation of sites other than the brain could be accomplished easily. Due to its simplicity and low cost, the apparatus described is an attractive alternative for small animal irradiation experiments requiring a sharp penumbra.

  19. Surface dose characterisation of the Varian Ir-192 HDR conical surface applicator set with a vertically orientated source

    International Nuclear Information System (INIS)

    Conical surface applicators with an Ir-192 high-dose-rate brachytherapy source are a common modality for the treatment of non-melanomatous skin cancer with high tumour control rates. Surface dose characterisation of the Varian Varisource GammaMed+ IX afterloader vertical type surface applicators is performed two dimensionally using high-resolution film dosimetry. The focus of this study was to determine if Varian surface applicators with a vertical source suffer from the dose distribution irregularities reported for comparable applicators. Our goal was to evaluate if the irregularities found affected treatment and dose output verification procedures. Ionisation chamber-based verification of applicator output was established according to guidelines provided by the manufacturer. For additional measurement of surface dose Gafchromic EBT3 film dosimetry was used. The term ''therapeutic dose'' was defined as 85 % of the prescribed dose level. For the 10 different applicator inserts evaluated, cold spots were observed. Mean cold spot size was 2.0 mm x 3.6 mm (± 0.6 mm). The cold spots were dosimetrically well below 85 % of the prescribed dose. The cold spot was situated 2.2 mm (1.4-2.7 mm) unilaterally from the central axis and caused general asymmetry in the dose profiles intersecting the cold spot area. A source tilt of approximately 8 (± 1 ) was determined for the source used for irradiation. A central underdosed area exceeding 15 % of the prescribed dose has not been previously reported. Source tilt was observed and found to affect clinical use and possibly treatment outcome in applicators using a vertically arranged source. Surface applicators with a vertically orientated source were subject to dose irregularities that could impact on chamber-based applicator output verification procedures. We recommend film dosimetry-backed applicator commissioning to avoid systematic errors. (orig.)

  20. SU-E-T-457: Design and Characterization of An Economical 192Ir Hemi-Brain Small Animal Irradiator

    International Nuclear Information System (INIS)

    Purpose: To describe the design and dosimetric characterization of a simple and economical small animal irradiator. Methods: A high dose rate 192Ir brachytherapy source from a commercially available afterloader was used with a 1.3 centimeter thick tungsten collimator to provide sharp beam penumbra suitable for hemi-brain irradiation of mice. The unit is equipped with continuous gas anesthesia to allow robust animal immobilization. Dosimetric characterization of the device was performed with Gafchromic film. The penumbra from the small animal irradiator was compared under similar collimating conditions to the penumbra from 6 MV photons, 6 MeV electrons, and 20 MeV electrons from a linear accelerator as well as 300 kVp photons from an orthovoltage unit and Monte Carlo simulated 90 MeV protons. Results: The tungsten collimator provides a sharp penumbra suitable for hemi-brain irradiation, and dose rates on the order of 200 cGy/minute were achieved. The sharpness of the penumbra attainable with this device compares favorably to those measured experimentally for 6 MV photons, and 6 and 20 MeV electron beams from a linear accelerator. Additionally, the penumbra was comparable to those measured for a 300 kVp orthovoltage beam and a Monte Carlo simulated 90 MeV proton beam. Conclusions: The small animal irradiator described here can be built for under $1,000 and used in conjunction with any commercial brachytherapy afterloader to provide a convenient and cost-effective option for small animal irradiation experiments. The unit offers high dose rate delivery and sharp penumbra, which is ideal for hemi-brain irradiation of mice. With slight modifications to the design, irradiation of sites other than the brain could be accomplished easily. Due to its simplicity and low cost, the apparatus described is an attractive alternative for small animal irradiation experiments requiring a sharp penumbra

  1. Loss of an iridium-192 source and therapy misadministration at Indiana Regional Cancer Center, Indiana, Pennsylvania, on November 16, 1992

    International Nuclear Information System (INIS)

    On December 1, 1992, the Indiana Regional Cancer Center reported to the US Nuclear Regulatory Commission's (NRC) Region I that they believed a 1.37 E + 11 becquerel (3.7-curie) iridium-192 source from their Omnitron 2000 high dose rate remote brachytherapy afterloader had been found at a biohazard waste transfer station in Carnegie, Pennsylvania. After notifying the NRC, this cancer center, one of several operated by the licensee, Oncology Services Corporation, retrieved the source, and Region I dispatched an inspector and a supervisor to investigate the event. The source was first detected when it triggered radiation alarms at a waste incinerator facility in. Warren, Ohio. The licensee informed the NRC that the source wire had apparently broken during treatment of a patient on November 16, 1992, leaving the source in the patient. On the basis of the seriousness of the incident, the NRC elevated its response to an Incident Investigation. The Incident Investigation Team initiated its investigation on December 3, 1992. The investigation team concluded that the patient received a serious misadministration and died on November 21, 1992, and that over 90 individuals were exposed to radiation from November 16 to December 1, 1992. In a press release dated January 26, 1993, the Indiana County Coroner stated that the cause of death listed in the official autopsy report was ''Acute Radiational Exposure and Consequences Thereof'' An almost identical source wire failure occurred with an afterloader in Pittsburgh, Pennsylvania, on December 7, 1992, but with minimal radiological consequences. This incident was included in the investigation. This report discusses the Omnitron 2000 high dose rate afterloader source-wire failure, the reasons why the failure was not detected by Indiana Regional Cancer Center, the potential consequences to the patient, the estimated radiological doses to workers and the public, and regulatory aspects associated with this incident

  2. Comparison of organ doses for patients undergoing balloon brachytherapy of the breast with HDR 192Ir or electronic sources using Monte Carlo simulations in a heterogeneous human phantom

    International Nuclear Information System (INIS)

    Purpose: Accelerated partial breast irradiation via interstitial balloon brachytherapy is a fast and effective treatment method for certain early stage breast cancers. The radiation can be delivered using a conventional high-dose rate (HDR) 192Ir gamma-emitting source or a novel electronic brachytherapy (eBx) source which uses lower energy x rays that do not penetrate as far within the patient. A previous study [A. Dickler, M. C. Kirk, N. Seif, K. Griem, K. Dowlatshahi, D. Francescatti, and R. A. Abrams, ''A dosimetric comparison of MammoSite high-dose-rate brachytherapy and Xoft Axxent electronic brachytherapy,'' Brachytherapy 6, 164-168 (2007)] showed that the target dose is similar for HDR 192Ir and eBx. This study compares these sources based on the dose received by healthy organs and tissues away from the treatment site. Methods: A virtual patient with left breast cancer was represented by a whole-body, tissue-heterogeneous female voxel phantom. Monte Carlo methods were used to calculate the dose to healthy organs in a virtual patient undergoing balloon brachytherapy of the left breast with HDR 192Ir or eBx sources. The dose-volume histograms for a few organs which received large doses were also calculated. Additional simulations were performed with all tissues in the phantom defined as water to study the effect of tissue inhomogeneities. Results: For both HDR 192Ir and eBx, the largest mean organ doses were received by the ribs, thymus gland, left lung, heart, and sternum which were close to the brachytherapy source in the left breast. eBx yielded mean healthy organ doses that were more than a factor of ∼1.4 smaller than for HDR 192Ir for all organs considered, except for the three closest ribs. Excluding these ribs, the average and median dose-reduction factors were ∼28 and ∼11, respectively. The volume distribution of doses in nearby soft tissue organs that were outside the PTV were also improved with eBx. However, the maximum dose to the closest rib

  3. Using LiF:Mg,Cu,P TLDs to estimate the absorbed dose to water in liquid water around an 192Ir brachytherapy source

    International Nuclear Information System (INIS)

    Purpose: The absorbed dose to water is the fundamental reference quantity for brachytherapy treatment planning systems and thermoluminescence dosimeters (TLDs) have been recognized as the most validated detectors for measurement of such a dosimetric descriptor. The detector response in a wide energy spectrum as that of an192Ir brachytherapy source as well as the specific measurement medium which surrounds the TLD need to be accounted for when estimating the absorbed dose. This paper develops a methodology based on highly sensitive LiF:Mg,Cu,P TLDs to directly estimate the absorbed dose to water in liquid water around a high dose rate 192Ir brachytherapy source. Methods: Different experimental designs in liquid water and air were constructed to study the response of LiF:Mg,Cu,P TLDs when irradiated in several standard photon beams of the LNE-LNHB (French national metrology laboratory for ionizing radiation). Measurement strategies and Monte Carlo techniques were developed to calibrate the LiF:Mg,Cu,P detectors in the energy interval characteristic of that found when TLDs are immersed in water around an192Ir source. Finally, an experimental system was designed to irradiate TLDs at different angles between 1 and 11 cm away from an 192Ir source in liquid water. Monte Carlo simulations were performed to correct measured results to provide estimates of the absorbed dose to water in water around the 192Ir source. Results: The dose response dependence of LiF:Mg,Cu,P TLDs with the linear energy transfer of secondary electrons followed the same variations as those of published results. The calibration strategy which used TLDs in air exposed to a standard N-250 ISO x-ray beam and TLDs in water irradiated with a standard137Cs beam provided an estimated mean uncertainty of 2.8% (k = 1) in the TLD calibration coefficient for irradiations by the 192Ir source in water. The 3D TLD measurements performed in liquid water were obtained with a maximum uncertainty of 11% (k = 1) found

  4. EME 192 Report

    Energy Technology Data Exchange (ETDEWEB)

    Mora, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Pascall, A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Dudoff, J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Moran, B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2016-03-15

    I spent the quarter working in Lawrence Livermore National Laboratory’s (LLNL) Materials Engineering Division. The group I have been working with (I’ve been here for two summers already) focuses on advanced manufacturing techniques such as stereolithography, electrophoretic deposition, and the printing of silicon based inks. Part of the goal of what is done in our group is to create designer materials not by altering the composition but by altering the micro-architecture. Our technology can create shapes that are not possible with traditional manufacturing techniques. This allows us to create structures that are light, yet very strong and stiff. It also allows us to create materials with property gradients. In other words, we can make structures and parts that are stronger in some locations than others. I have been working with electrophoretic deposition for the duration of my stay and have focused on advancing the technology from a thin-film technique to a true additive manufacturing paradigm. Put succinctly, electrophoretic deposition is the deposition of particles in suspension with electric fields. Particles have a potential on the surface which allows them to be driven to an electrode using an electric field. The particles then deposit onto the conductive regions of the substrate, traditionally, the entire surface. Electrophoretic deposition is powerful in that it can handle a wide variety of materials (ceramics, metals, bacteria), create material gradients in the deposits, and create layered deposition of multiple materials. A drawback of traditional electrophoretic deposition is that patterned deposits are only possible with a non-reconfigurable patterned electrode. A technique was developed at LLNL that allows for the arbitrary patterning of the electric field using photoconductive electrodes and light. This way, you can create interesting shapes and reconfigure the pattern of the deposit using the same electrode. A photoconductive electrode is made by hydrothermally growing titania nanorods onto a transparent current collector. A photomask is used to block incoming some light and only allow the desired pattern of light through. The photoconductive electrode then activates when and where the light hits, once an electric field is applied. Particles will migrate to the areas of illumation and deposit.

  5. External beam irradiation plus 192Ir implant after breast-preserving surgery in women with early breast cancer

    International Nuclear Information System (INIS)

    Purpose: To provide more information for the clinician and to analyze the impact of the boost with brachytherapy on the local disease-free survival (LDFS), disease-free survival (DFS), specific overall survival (OS), and cosmesis, a retrospective study of external radiation therapy and 192Ir implantation in early breast cancer at Institut Catala d'Oncologia has been undertaken. Patients and Methods: From 1986 to 1996, 530 patients were selected for this study with a median follow-up period of 39.5 months (range, 10-115 months). External radiation therapy (combined with brachytherapy) was administered postoperatively to the breast in all patients. Mean given dose was 48.7 Gy (range, 42-52 Gy) with external radiation therapy to the breast, and 16.8 Gy (range, 10-27 Gy) was the mean dose with brachytherapy. Variables have been tested for cosmesis. Univariate and multivariate analysis have also been carried out. Results: Mean age of the patients was 54 years (range, 28-81 years). Stages were distributed as follows: 350 patients (66%) in Stage I, 173 in Stage II (32.8%), and 7 in Stage III (1.1%). Pathologic distribution was 445 patients with infiltrating ductal carcinoma (84%), 20 patients with infiltrating lobular carcinoma (4%), and 65 patients (12%) of a miscellaneous group. OS for the entire group was 89.4% and 85.9% at 5 and 7 years respectively. Probability of DFS was 81.7% and 70.1% at 5 and 7 years. The LDFS was 94.9% and 91.7% at 5 and 7 years. The MFS probability was 85.5% and 76.9% at 5 and 7 years, respectively. Univariate analysis demonstrated that age (older than 52 years), premenopausal status, moderate and high histologic grades (Grades II-III), and presence of intraductal comedocarcinoma were prognostic factors for local relapse. Multivariate analysis for local disease-free survival demonstrated that only perineural or muscular infiltration remain as prognostic factors. Tumor dose bed of 70 Gy or higher had a negative impact in breast subcutaneous

  6. Combined surgery and brachytherapy in the treatment of some cancers of the bladder (partial cystectomy and interstitial iridium-192)

    International Nuclear Information System (INIS)

    Eighty-five bladder cancers were treated at the Urology Clinic of Nancy and the Centre Alexis Vautrin from 1975 to 1992 with short course preoperative radiation therapy (3 x 3.5 Gy), conservative surgery and brachytherapy by iridium-192. The tumours were classified according to the 1979 UCCA pTNM classification. There were 27 pT1, pT2 and 22 pT3, two pT4 and three pTx. The pT1-pT2 cases received only one brachytherapy (50 Gy at least) after the short course preoperative irradiation. The pT3 cases received only 30 Gy of brachytherapy and an external irradiation boost (generally 40 Gy to the node areas and 30 Gy to the tumour, but the dose varied during the time course). Surgery was often preceded by an endoscopic resection consisting of a tumoral resection or a partial cystectomy according to the localisation. The plastic vector tubes were put into place at the time of partial cystectomy. Until 1983 the radioactive wires were loaded into the vector tubes on the day following surgery, thereafter it was done one week later. The 85 patients were classified into two groups: 63 patients who were untreated previously and 22 patients who had received one or more endoscopic resections for recurrences. The median follow-up was 84 months. The local controls at 5 years were 78% in the first group versus 56% in the second group (p = 0.005) with an overall survival of 73 and 65%, respectively. The local control did not vary according to the differentiation (grade (1(2)) vs. grade 3). The local control for pT1, pT2, pT3 was 85, 64 and 70% with a specific survival of 85, 76 and 72%, and an overall survival of 78, 66 and 66%. Among early complications, delay in healing of the bladder wall with subsequent vesico-cutaneous fistula depends mainly on the loading time of radioactive wires after surgery and is rare if the loading is delayed by one week. The late complications depend mostly on dosimetric factors. We found 24 grade 1, three grade 2, four grade 3 and one grade 4. The

  7. AAPM and GEC-ESTRO guidelines for image-guided robotic brachytherapy: Report of Task Group 192

    Energy Technology Data Exchange (ETDEWEB)

    Podder, Tarun K., E-mail: tarun.podder@uhhospitals.org [Department of Radiation Oncology, University Hospitals, Case Western Reserve University, Cleveland, Ohio 44122 (United States); Beaulieu, Luc [Department of Radiation Oncology, Centre Hospitalier Univ de Quebec, Quebec G1R 2J6 (Canada); Caldwell, Barrett [Schools of Industrial Engineering and Aeronautics and Astronautics, Purdue University, West Lafayette, Indiana 47907 (United States); Cormack, Robert A. [Department of Radiation Oncology, Harvard Medical School, Boston, Massachusetts 02115 (United States); Crass, Jostin B. [Department of Radiation Oncology, Vanderbilt University, Nashville, Tennessee 37232 (United States); Dicker, Adam P.; Yu, Yan [Department of Radiation Oncology, Thomas Jefferson University, Philadelphia, Pennsylvania 19107 (United States); Fenster, Aaron [Department of Imaging Research, Robarts Research Institute, London, Ontario N6A 5K8 (Canada); Fichtinger, Gabor [School of Computer Science, Queen’s University, Kingston, Ontario K7L 3N6 (Canada); Meltsner, Michael A. [Philips Radiation Oncology Systems, Fitchburg, Wisconsin 53711 (United States); Moerland, Marinus A. [Department of Radiotherapy, University Medical Center Utrecht, Utrecht, 3508 GA (Netherlands); Nath, Ravinder [Department of Therapeutic Radiology, Yale University School of Medicine, New Haven, Connecticut 06520 (United States); Rivard, Mark J. [Department of Radiation Oncology, Tufts University School of Medicine, Boston, Massachusetts 02111 (United States); Salcudean, Tim [Department of Electrical and Computer Engineering, University of British Columbia, Vancouver, British Columbia V6T 1Z4 (Canada); Song, Danny Y. [Department of Radiation Oncology, Johns Hopkins University School of Medicine, Baltimore, Maryland 21231 (United States); Thomadsen, Bruce R. [Department of Medical Physics, University of Wisconsin, Madison, Wisconsin 53705 (United States)

    2014-10-15

    In the last decade, there have been significant developments into integration of robots and automation tools with brachytherapy delivery systems. These systems aim to improve the current paradigm by executing higher precision and accuracy in seed placement, improving calculation of optimal seed locations, minimizing surgical trauma, and reducing radiation exposure to medical staff. Most of the applications of this technology have been in the implantation of seeds in patients with early-stage prostate cancer. Nevertheless, the techniques apply to any clinical site where interstitial brachytherapy is appropriate. In consideration of the rapid developments in this area, the American Association of Physicists in Medicine (AAPM) commissioned Task Group 192 to review the state-of-the-art in the field of robotic interstitial brachytherapy. This is a joint Task Group with the Groupe Européen de Curiethérapie-European Society for Radiotherapy and Oncology (GEC-ESTRO). All developed and reported robotic brachytherapy systems were reviewed. Commissioning and quality assurance procedures for the safe and consistent use of these systems are also provided. Manual seed placement techniques with a rigid template have an estimated in vivo accuracy of 3–6 mm. In addition to the placement accuracy, factors such as tissue deformation, needle deviation, and edema may result in a delivered dose distribution that differs from the preimplant or intraoperative plan. However, real-time needle tracking and seed identification for dynamic updating of dosimetry may improve the quality of seed implantation. The AAPM and GEC-ESTRO recommend that robotic systems should demonstrate a spatial accuracy of seed placement ≤1.0 mm in a phantom. This recommendation is based on the current performance of existing robotic brachytherapy systems and propagation of uncertainties. During clinical commissioning, tests should be conducted to ensure that this level of accuracy is achieved. These tests

  8. AAPM and GEC-ESTRO guidelines for image-guided robotic brachytherapy: Report of Task Group 192

    International Nuclear Information System (INIS)

    In the last decade, there have been significant developments into integration of robots and automation tools with brachytherapy delivery systems. These systems aim to improve the current paradigm by executing higher precision and accuracy in seed placement, improving calculation of optimal seed locations, minimizing surgical trauma, and reducing radiation exposure to medical staff. Most of the applications of this technology have been in the implantation of seeds in patients with early-stage prostate cancer. Nevertheless, the techniques apply to any clinical site where interstitial brachytherapy is appropriate. In consideration of the rapid developments in this area, the American Association of Physicists in Medicine (AAPM) commissioned Task Group 192 to review the state-of-the-art in the field of robotic interstitial brachytherapy. This is a joint Task Group with the Groupe Européen de Curiethérapie-European Society for Radiotherapy and Oncology (GEC-ESTRO). All developed and reported robotic brachytherapy systems were reviewed. Commissioning and quality assurance procedures for the safe and consistent use of these systems are also provided. Manual seed placement techniques with a rigid template have an estimated in vivo accuracy of 3–6 mm. In addition to the placement accuracy, factors such as tissue deformation, needle deviation, and edema may result in a delivered dose distribution that differs from the preimplant or intraoperative plan. However, real-time needle tracking and seed identification for dynamic updating of dosimetry may improve the quality of seed implantation. The AAPM and GEC-ESTRO recommend that robotic systems should demonstrate a spatial accuracy of seed placement ≤1.0 mm in a phantom. This recommendation is based on the current performance of existing robotic brachytherapy systems and propagation of uncertainties. During clinical commissioning, tests should be conducted to ensure that this level of accuracy is achieved. These tests

  9. Application of the Cavity theory in the calibration of the powder TLD-100 for energies of 60 Co, 137 Cs, 192 Ir and RX 50, 250 k Vp

    International Nuclear Information System (INIS)

    A powder lot TLD-100 (LiF:Mg,Ti) in absorbed dose terms in water Dw for the following radiation sources: 60 Co, 137 Cs and RX 50 and 250 k Vp is calibrated; to continuation is made a lineal interpolation of the TLD response in function of the effective energy of the sources to calibrate a source of 192 Ir. The calibration of those fields in Dw are carried out with aid of the Bragg-Gray cavity theory, the one which finds implicit in the following protocols: IAEA-TRS 398 for the 60 Co and the AAPM TG61 for X Rays of 50 and 250 k Vp. Additionally the AAPM protocol TG43 to determine the Dw in function of the kerma intensity Sk in the case of the 137 Cs is used. The calibration curves for the response of the TLD-100 RTLD vs Dw, corresponding to each one of the sources already mentioned are constructed. The RTLD vs Dw by least heavy square by means of a second order polynomial that corrects the supralineality of the response is adjusted. The curves are validated by lack of LOF adjustment and by the Anderson Darling normality test. Later the factors of sensitivity (Fs) for the sources of 192 Ir: Micro Selectron and Vari Source are interpolated, used respectively in the A and B hospitals for treatments of brachytherapy of high dose rate (HDR), the expanded uncertainties associated to the Dw and Fs are also determined. Finally, an acrylic phantom and a couple of capsules are already sent to the hospitals mentioned, to verify a nominal Dw of 2 Gy, in a case an underestimate in 5.5% in the imparted Dw and in other an overestimation in a range of -1.5 to -8.0% was obtained. The obtained results in this work establish the bases for the development of a national dosimetric quality control program for brachytherapy of HDR with sources of 192 Ir. (Author)

  10. A Genetic Biomarker of Oxidative Stress, the Paraoxonase-1 Q192R Gene Variant, Associates with Cardiomyopathy in CKD: A Longitudinal Study

    Directory of Open Access Journals (Sweden)

    E. Dounousi

    2016-01-01

    Full Text Available Background. Oxidative stress is a hallmark of CKD and this alteration is strongly implicated in LV hypertrophy and in LV dysfunction. Methods and Patients. We resorted to the strongest genetic biomarker of paraoxonase-1 (PON1 activity, the Q192R variant in the PON1 gene, to unbiasedly assess (Mendelian randomization the cross-sectional and longitudinal association of this gene-variant with LV mass and function in 206 CKD patients with a 3-year follow-up. Results. The R allele of Q192R polymorphism associated with oxidative stress as assessed by plasma 8-isoPGF2α (P=0.03 and was dose-dependently related in a direct fashion to LVMI (QQ: 131.4 ± 42.6 g/m2; RQ: 147.7 ± 51.1 g/m2; RR: 167.3 ± 41.9 g/m2; P=0.001 and in an inverse fashion to systolic function (LV Ejection Fraction (QQ: 79 ± 12%; RQ: 69 ± 9%; RR: 65 ± 10% P=0.002. On longitudinal observation, this gene variant associated with the evolution of the same echocardiographic indicators [LVMI: 13.40 g/m2 per risk allele, P=0.005; LVEF: −2.96% per risk allele, P=0.001]. Multivariate analyses did not modify these associations. Conclusion. In CKD patients, the R allele of the Q192R variant in the PON1 gene is dose-dependently related to the severity of LVH and LV dysfunction and associates with the longitudinal evolution of these cardiac alterations. These results are compatible with the hypothesis that oxidative stress is implicated in cardiomyopathy in CKD patients.

  11. A simplified analytical approach to estimate the parameters required for strength determination of HDR 192Ir brachytherapy sources using a Farmer-type ionization chamber

    International Nuclear Information System (INIS)

    Measuring the strength of high dose rate (HDR) 192Ir brachytherapy sources on receipt from the vendor is an important component of a quality assurance program. Owing to their ready availability in radiotherapy departments, the Farmer-type ionization chambers are also used to determine the strength of HDR 192Ir brachytherapy sources. The use of a Farmer-type ionization chamber requires the estimation of the scatter correction factor along with positioning error (c) and the constant of proportionality (f) to determine the strength of HDR 192Ir brachytherapy sources. A simplified approach based on a least squares method was developed for estimating the values of f and Ms. The seven distance method was followed to record the ionization chamber readings for parameterization of f and Ms. Analytically calculated values of Ms were used to determine the room scatter correction factor (Ksc). The Monte Carlo simulations were also carried out to calculate f and Ksc to verify the magnitude of the parameters determined by the proposed analytical approach. The value of f determined using the simplified analytical approach was found to be in excellent agreement with the Monte Carlo simulated value (within 0.7%). Analytically derived values of Ksc were also found to be in good agreement with the Monte Carlo calculated values (within 1.47%). Being far simpler than the presently available methods of evaluating f, the proposed analytical approach can be adopted for routine use by clinical medical physicists to estimate f by hand calculations. - Highlights: ► RAKR measurement of a brachytherapy source by 7 distance method requires the evaluation of ‘f’. ► A simplified analytical approach based on least square method to evaluate ‘f’ and ‘Ms’ was developed. ► Parameter ‘f’ calculated by proposed analytical approach was verified using the Monte Carlo method. ► Proposed analytical approach can be adopted for routine use to estimate ‘f’.

  12. Evaluation of Gafchromic EBT2 film for the measurement of anisotropy function for high-dose-rate 192Ir brachytherapy source with respect to thermoluminescent dosimetry

    International Nuclear Information System (INIS)

    Aim: The aim of this work was to assess the suitability of the use of a Gafchromic EBT2 film for the measurement of anisotropy function for micro Selectron HDR 192Ir (classic) source with a comparative dosimetry method using a Gafchromic EBT2 film and thermoluminescence dosimeters (TLDs). Background: Sealed linear radiation sources are commonly used for high dose rate (HDR) brachytherapy treatments. Due to self-absorption and oblique filtration of radiation in the source capsule material, an inherent anisotropy is present in the dose distribution around the source which can be described by a measurable two-dimensional anisotropy function, F(γ, Θ ). Materials and methods: Measurements were carried out in a specially designed and locally fabricated PMMA phantom with provisions to accommodate miniature LiF TLD rods and EBT2 film dosimeters at identical radial distances with respect to the 192Ir source. Results: The data of anisotropy function generated by the use of the Gafchromic EBT2 film method are in agreement with their TLD measured values within 4%. The produced data are also consistent with their experimental and Monte Carlo calculated results for this source available in the literature. Conclusion: Gafchromic EBT2 film was found to be a feasible dosimeter in determining anisotropy in the dose distribution of 192Ir source. It offers high resolution and is a viable alternative to TLD dosimetry at discrete points. The method described in this paper is useful for comparing the performances of detectors and can be applied for other brachytherapy sources as well. (authors)

  13. A Genetic Biomarker of Oxidative Stress, the Paraoxonase-1 Q192R Gene Variant, Associates with Cardiomyopathy in CKD: A Longitudinal Study

    Science.gov (United States)

    Bouba, I.; Spoto, B.; Pappas, K.; Tripepi, G.; Georgiou, I.; Tselepis, A.; Elisaf, M.; Tsakiris, D.; Zoccali, C.; Siamopoulos, K.

    2016-01-01

    Background. Oxidative stress is a hallmark of CKD and this alteration is strongly implicated in LV hypertrophy and in LV dysfunction. Methods and Patients. We resorted to the strongest genetic biomarker of paraoxonase-1 (PON1) activity, the Q192R variant in the PON1 gene, to unbiasedly assess (Mendelian randomization) the cross-sectional and longitudinal association of this gene-variant with LV mass and function in 206 CKD patients with a 3-year follow-up. Results. The R allele of Q192R polymorphism associated with oxidative stress as assessed by plasma 8-isoPGF2α (P = 0.03) and was dose-dependently related in a direct fashion to LVMI (QQ: 131.4 ± 42.6 g/m2; RQ: 147.7 ± 51.1 g/m2; RR: 167.3 ± 41.9 g/m2; P = 0.001) and in an inverse fashion to systolic function (LV Ejection Fraction) (QQ: 79 ± 12%; RQ: 69 ± 9%; RR: 65 ± 10% P = 0.002). On longitudinal observation, this gene variant associated with the evolution of the same echocardiographic indicators [LVMI: 13.40 g/m2 per risk allele, P = 0.005; LVEF: −2.96% per risk allele, P = 0.001]. Multivariate analyses did not modify these associations. Conclusion. In CKD patients, the R allele of the Q192R variant in the PON1 gene is dose-dependently related to the severity of LVH and LV dysfunction and associates with the longitudinal evolution of these cardiac alterations. These results are compatible with the hypothesis that oxidative stress is implicated in cardiomyopathy in CKD patients.

  14. A dual-plane co-RASOR technique for accurate and rapid tracking and position verification of an Ir-192 source for single fraction HDR brachytherapy

    Science.gov (United States)

    de Leeuw, Hendrik; Moerland, Marinus A.; van Vulpen, Marco; Seevinck, Peter R.; Bakker, Chris J. G.

    2013-11-01

    Effective high-dose-rate (HDR) treatment requires accurate and independent treatment verification to ensure that the treatment proceeds as prescribed, in particular if a high dose is given, as in single fraction therapy. Contrary to CT imaging and fluoroscopy, MR imaging provides high soft tissue contrast. Conventional MR techniques, however, do not offer the temporal resolution in combination with the 3D spatial resolution required for accurate brachytherapy source localization. We have developed an MR imaging method (center-out RAdial Sampling with Off-Resonance (co-RASOR)) that generates high positive contrast in the geometrical center of field perturbing objects, such as HDR brachytherapy sources. co-RASOR generates high positive contrast in the geometric center of an Ir-192 source by applying a frequency offset to center-out encoded data. To obtain high spatial accuracy in 3D with adequate temporal resolution, two orthogonal center-out encoded 2D images are applied instead of a full 3D acquisition. Its accuracy in 3D is demonstrated by 3D MRI and CT. The 2D images show high positive contrast in the geometric center of non-radioactive Ir-192 sources, with signal intensities up to 160% of the average signal intensity in the surrounding medium. The accuracy with which the center of the Ir-192 source is located by the dual-plane MRI acquisition corresponds closely to the accuracy obtained by 3D MRI and CT imaging. The positive contrast is shown to be obtained in homogeneous and in heterogeneous tissue. The dual-plane MRI technique allows the brachytherapy source to be tracked in 3D with millimeter accuracy with a temporal resolution of approximately 4 s.

  15. Process for producing astatine-211 for radiopharmaceutical use

    International Nuclear Information System (INIS)

    A one-step chemical manipulation is described in combination with a distillation and collection process for producing At-211 comprising; a. providing a target of irradiated Bismuth coated to a predetermined thickness of a backing member, b. providing a vapor-producing still operably connected with a condenser that has a water cooled condensate collector formed of a dry silica gel mesh maintained at a temperature above the freezing point of water, and providing an effluent gas filter that is operably connected to receive effluent gas from the condenser, c. heating the target in the still at a temperature in the range of about 6300-6800C for a time period in the range of 50 to 80 minutes, to evole At-211 vapor from the target, c. providing a dry carrier gas having an oxygen concentration that is sufficient to form Bi/sub 2/O/sub 3/ thereby to essentially preclude vaporization of Bi metal, passing the carrier gas through the still to carry the At-211 vapor to the condenser, and to carry effluent from the condenser to the effluent gas filter, e. eluting At-211 from the condensate collector of the condenser with a controlled volume of eluent containing predetermined solvents that are compatible with a given desired radiopharmaceutical procedure, and f. collecting the At-211 in the controlled volume of eluent for use in the given radiopharmaceutical procedure

  16. Search for supersymmetric particles assuming R-parity non-conservation in $e^+e^-$ collisions at $\\sqrt{s}$ = 192 to 208 GeV

    CERN Document Server

    Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alderweireld, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barbier, R; Bardin, Dimitri Yuri; Barker, G J; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Bugge, L; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F R; Chapkin, M M; Charpentier, P; Checchia, P; Chierici, R; Shlyapnikov, P; Chudoba, J; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, F; Costa, M J; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Dalmau, J; Da Silva, T; Da Silva, W; Della Ricca, G; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; De Paula, L S; Di Ciaccio, L; Di Simone, A; Doroba, K; Drees, J; Dris, M; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J A; Gandelman, M; García, C; Gavillet, P; Gazis, E N; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Herr, H; Hoffman, J; Holmgren, S O; Holt, P J; Houlden, M A; Hultqvist, K; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E K; Johansson, P D; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Katsoufis, E C; Kernel, G; Kersevan, B P; Kerzel, U; Kiiskinen, A P; King, B T; Kjaer, N J; Kluit, P; Kokkinias, P; Kourkoumelis, C; Kuznetsov, O; Krumshtein, Z; Kucharczyk, M; Lamsa, J; Leder, G; Ledroit, F; Leinonen, L; Leitner, R; Lemonne, J; Lepeltier, V; Lesiak, T; Liebig, W; Liko, D; Lipniacka, A; Lopes, J H; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, F; Mazzucato, M; McNulty, R; Meroni, C; Migliore, E; Mitaroff, W A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L; Murray, W; Muryn, B; Myatt, G; Myklebust, T; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Nicolaidou, R; Nikolenko, M; Oblakowska-Mucha, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, R; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Palacios, J P; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V F; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Pozdnyakov, V; Pukhaeva, N; Pullia, Antonio; Rames, J; Read, A; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Roudeau, P; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Sander, C; Savoy-Navarro, A; Schwickerath, U; Segar, A; Sekulin, R L; Siebel, M; Sissakian, A N; Smadja, G; Smirnova, O G; Sokolov, A; Sopczak, A; Sosnowski, R; Spassoff, Tz; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Timmermans, J; Tkatchev, L G; Tobin, M; Todorovova, S; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G; van Dam, P; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I; Vegni, G; Veloso, F; Venus, W A; Verdier, P; Verzi, V; Vilanova, D; Vitale, L; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G; Winter, M; Witek, M; Yushchenko, O P; Zalewska-Bak, A; Zalewski, P; Zavrtanik, D; Zhuravlov, V; Zimin, N I; Zintchenko, A; Zupan, M

    2004-01-01

    Searches for pair-production of supersymmetric particles under the assumption of non-conservation of R-parity with a dominant LLEbar or UbarDbarDbar term have been performed using the data collected by the DELPHI experiment at LEP in e+e- collisions at centre-of-mass energies from 192 up to 208 GeV. No excess of data above Standard Model expectations was observed. The results were used to constrain the MSSM parameter space and to derive limits on the masses of supersymmetric particles.

  17. Search for a lepton flavor violation signal in e+e- collisions at √s = 192 - 208 GeV at LEP

    International Nuclear Information System (INIS)

    The search for LFV signal in e+e- → l+l- is suggested by theoretical predictions in the frame of supersymmetry models. We looked for charged lepton flavor violation (LFV) at energies between 192 and 208 GeV in e+e- interactions at LEP2. A Standard Model simulation has been analyzed in order to find preselection and selection criteria. Upper limits for cross sections in eμ, eτ, μτ channels have been found and compared with other experimental results and theoretical predictions. (authors)

  18. In-house validation of an Event-specific Method for the Quantification of Oliseed Rape Topas 19/2 using Real-time PCR

    OpenAIRE

    Mazzara, Marco; LUQUE PEREZ Encarnacion; Bevilacqua, A; Van den Eede, Guy

    2011-01-01

    The European Union Reference Laboratory for GM Food and Feed (EU-RL GMFF), established by Regulation (EC) No 1829/2003, has carried out an in-house validation study to assess the performance of a quantitative event-specific method on the oilseed rape event Topas 19/2 (unique identifier ACS-BN007-1). In accordance to Regulation (EC) No 1829/2003 of 22 September 2003 on genetically modified food and feed and to Regulation (EC) No 641/2004 of 6 April 2004 on detailed rules for the implementatio...

  19. Absolute activity measurement of the electron-capture-based radionuclides 139Ce, 125I, 192Ir and 65Zn by liquid scintillation coincidence counting

    International Nuclear Information System (INIS)

    Four radionuclides with electron-capture-based decay schemes have been directly measured by a liquid scintillation coincidence extrapolation technique. 125I, 192Ir and 65Zn were measured as part of international key comparisons held under the auspices of the International Bureau of Weights and Measures (BIPM). The 139Ce measurements formed part of a regional comparison organized by the Asia Pacific Metrology Programme (APMP). Since 139Ce decays purely by electron-capture, the basic method is described for this radionuclide. Results and difficulties encountered are discussed and uncertainty budgets are presented

  20. Cross section measurement for reaction 193Ir(n,2n)192m2Ir at 14.7 MeV

    International Nuclear Information System (INIS)

    The cross sections induced by neutron on long-lived radionuclides of importance in fusion reactor technology are measured by activation method for 193Ir(n,2n)192m2Ir reaction at 14.7 MeV. The neutron fluences are determined by the cross section of 93Nb(n,2n)92mNb. The neutron energies in these measurements are determined by cross section ratios for 90Zr(n,2n)89Zr and 93Nb(n,2n)92mNb reactions. (2 tabs.)

  1. The atomic structure of protons and hydrides in Sm1.92Ca0.08Sn2O7-δ pyrochlore from DFT calculations and FTIR spectroscopy

    DEFF Research Database (Denmark)

    Bork, Nicolai Christian; Eurenius, K. E. J.; Rossmeisl, Jan; Knee, C. S.; Vegge, Tejs

    2012-01-01

    A combined density functional theory and Fourier transform infrared spectroscopy study of the structure and specific site preference of protons and hydrides in the pyrochlore Sm1.92Ca0.08Sn2O7-δ is presented. Two protonic sites of particular high stability are identified, both located on O(1......) oxygen atoms closely associated with a Ca dopant. Further, the unexpected presence of Ho hydride defects in undoped, oxygen deficient Sm2Sn2O7 is reported. Finally, the stretching frequencies and relative intensities for these and other sites are calculated. The main features of the Fourier transform...

  2. Development and implementation of a remote audit tool for high dose rate (HDR) Ir-192 brachytherapy using optically stimulated luminescence dosimetry

    International Nuclear Information System (INIS)

    Purpose: The aim of this work was to create a mailable phantom with measurement accuracy suitable for Radiological Physics Center (RPC) audits of high dose-rate (HDR) brachytherapy sources at institutions participating in National Cancer Institute-funded cooperative clinical trials. Optically stimulated luminescence dosimeters (OSLDs) were chosen as the dosimeter to be used with the phantom.Methods: The authors designed and built an 8 × 8 × 10 cm3 prototype phantom that had two slots capable of holding Al2O3:C OSLDs (nanoDots; Landauer, Glenwood, IL) and a single channel capable of accepting all 192Ir HDR brachytherapy sources in current clinical use in the United States. The authors irradiated the phantom with Nucletron and Varian 192Ir HDR sources in order to determine correction factors for linearity with dose and the combined effects of irradiation energy and phantom characteristics. The phantom was then sent to eight institutions which volunteered to perform trial remote audits.Results: The linearity correction factor was kL= (−9.43 × 10−5× dose) + 1.009, where dose is in cGy, which differed from that determined by the RPC for the same batch of dosimeters using 60Co irradiation. Separate block correction factors were determined for current versions of both Nucletron and Varian 192Ir HDR sources and these vendor-specific correction factors differed by almost 2.6%. For the Nucletron source, the correction factor was 1.026 [95% confidence interval (CI) = 1.023–1.028], and for the Varian source, it was 1.000 (95% CI = 0.995–1.005). Variations in lateral source positioning up to 0.8 mm and distal/proximal source positioning up to 10 mm had minimal effect on dose measurement accuracy. The overall dose measurement uncertainty of the system was estimated to be 2.4% and 2.5% for the Nucletron and Varian sources, respectively (95% CI). This uncertainty was sufficient to establish a ±5% acceptance criterion for source strength audits under a formal RPC audit

  3. The Effect of Regular Moderate Exercise on miRNA-192 Expression Changes in Kidney of Streptozotocin-Induced Diabetic Male Rats

    OpenAIRE

    Hajar Oghbaei; Naser Ahmadi Asl; Farzam Sheikhzadeh; Mohammad Reza Alipour; Amir Mahdi Khamaneh

    2015-01-01

    Purpose: The purpose of this study was to investigate the regular moderate exercise effect on the miR-192 expression changes in kidney of Streptozotocin- induced diabetic rats. Methods: Forty adult male Wistar rats were divided into four groups of 10, including Sedentary Control group, Healthy 60 days Exercise group, diabetic group and Diabetic 60 days Exercise. Diabetes was induced by injection of 60 mg/kg Streptozotocin and after 48 hour blood glucose levels higher than 250 mg/dl were in...

  4. Shape effects along the Z=82 line: study of the $\\beta$- decay of $^{188,190,192}$Pb using total absorption spectroscopy

    CERN Multimedia

    Caballero ontanaya, L; Garcia borge, M J; Malbrunot, S

    2002-01-01

    This proposal is aimed at the study of the $\\beta$- decay of the neutron-deficient $^{188,190,192}$Pb nuclei. The main motivation of the proposed experiment is to determine the Gamow-Teller strength distribution in the daughter nuclei using the Total Absorption Spectrometer "Lucrecia". Recent theoretical results show that from this measurement the shapes of the ground states of the decaying Pb nuclei can be inferred. This study offers an independent way to study the phenomenon of shape co-existence in a region of particular interest.

  5. Search for Neutral Higgs Bosons of the Minimal Supersymmetric Standard Model in $e^+ e^-$ Interactions at $\\sqrt{s}$=192-202 GeV

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, L; Balandras, A; Baldew, S V; Todorova-Nová, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Cucciarelli, S; Dai, T S; van Dalen, J A; D'Alessandro, R; De Asmundis, R; Déglon, P L; Degré, A; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Van Dierendonck, D N; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Dufournaud, D; Duinker, P; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ewers, A; Extermann, Pierre; Fabre, M; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hidas, P; Hirschfelder, J; Hofer, H; Holzner, G; Hoorani, H; Hou, S R; Hu, Y; Iashvili, I; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Khan, R A; Käfer, D; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Kopp, A; Koutsenko, V F; Kräber, M H; Krämer, R W; Krenz, W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Levchenko, P M; Li Chuan; Likhoded, S A; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Lugnier, L; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mans, J; Marian, G; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Moulik, T; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nisati, A; Nowak, H; Ofierzynski, R A; Organtini, G; Oulianov, A; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Paramatti, R; Park, H K; Park, I H; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Pothier, J; Prokofiev, D O; Prokofev, D; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Raven, G; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Rodin, J; Roe, B P; Romero, L; Rosca, A; Rosier-Lees, S; Roth, S; Rosenbleck, C; Roux, B; Rubio, Juan Antonio; Ruggiero, G; Rykaczewski, H; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Sanders, M P; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schopper, Herwig Franz; Schotanus, D J; Schwering, G; Sciacca, C; Seganti, A; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S V; Suter, H; Swain, J D; Szillási, Z; Sztaricskai, T; Tang, X W; Tauscher, Ludwig; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Uchida, Y; Ulbricht, J; Valente, E; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, M; Wang, X L; Wang, Z M; Weber, A; Weber, M; Wienemann, P; Wilkens, H; Wu, S X; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Ye, J B; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhu, G Y; Zhu, R Y; Zichichi, A; Zilizi, G; Zimmermann, B; Zöller, M

    2001-01-01

    A search for the lightest neutral CP-even and the neutral CP-odd Higgs bosons of the Minimal Supersymmetric Standard Model is performed using 233.2 pb-1 of integrated luminosity collected with the L3 detector at LEP at centre-of-mass energies 192-202 GeV. No signal is observed and lower mass limits are given as a function of tan(beta) for two scalar top mixing hypotheses. For tan(beta) greater than 0.8, they are mh > 83.4 GeV and mA > 83.8 GeV at 95 % confidence level.

  6. Intercomparison of calibration procedures of high dose rate {sup 192} Ir sources in Brazil and a proposal of a new methodology; Intercomparacao de procedimientos de calibracao de fontes de {sup 192} Ir de alta taxa de dose no Brasil e proposta de uma nova metodologia

    Energy Technology Data Exchange (ETDEWEB)

    Marechal, M.H.; Almeida, C.E. de [Laboratorio Nacional de Metrologia das Radiacoes Ionizantes IRD/CNEN. Caixa Postal 37750 CEP 22780-160 Rio de Janeiro (Brazil)

    1998-12-31

    The objective of this paper is to report the results of an intercomparison of the calibration procedures for {sup 192} Ir sources presently in use in Brazil and to proposal a calibration procedure to derive the N{sub k} for a Farmer type ionization chamber for {sup 192} Ir energy by interpolating from a {sup 60} Co gamma-rays and 250 kV x-rays calibration factors. the intercomparison results were all within {+-} 3.0 % except one case where 4.6 % was observed and latter identified as a problem with N-k value for X-rays. The method proposed by the present work make possible the improvement of the metrological coherence among the calibration laboratories and their users once the N{sub k} values could then provided by any of the members of SSDL network. (Author)

  7. Detection of 192Ir in ground level air in Ursvik 20 September 2004, with Quarterly report on measurements of radionuclides in ground level air in Sweden. Fourth quarter 2004

    International Nuclear Information System (INIS)

    The radioisotope 192Ir was found in the filter from Ursvik, Monday 20 September 2004. There were no indications of 192Ir in filters from any of the other national stations during that period. The measured activity concentration of 192Ir was about 50 μBq/m, corresponding to a total collected activity of 2.36 Bq of 192Ir in the filter. The source of the release was the Studsvik Nuclear AB production site about 80 km south of Ursvik and the preliminary estimation of released activity was 58 kBq. Locally performed measurements and dispersion calculations show that the released amount of 192Ir was in the order of 1 GBq. This is in agreement both with the measurements at the filter station in Ursvik, and with the dispersion calculations performed by FOI. Filtering of ground level air is performed weekly at six different locations in Sweden: Kiruna, Umeaa, Gaevle, Ursvik, Visby and Ljungbyhed. The filters are pressed and the contents of different radionuclides are measured by gamma spectroscopy. Precipitation is also collected at four of the stations: Kiruna, Gaevle, Ursvik and Ljungbyhed, the samples are ashed and the contents of radionuclides are measured. The levels of Be-7 and Cs-137 in air and precipitation are presented for the different stations. Other anthropogenic radionuclides detected, if any are also presented

  8. High-dose rate iridium-192 brachytherapy with flexible applicator. A trial toward decrease of stress during treatment and improvement of quality of life

    Energy Technology Data Exchange (ETDEWEB)

    Inoue, Keiji; Kasahara, Kotaro; Karashima, Takashi; Inoue, Yuichiro; Kariya, Shinji; Inomata, Taisuke; Yoshida, Shoji; Shuin, Taro [Kochi Medical School, Nankoku (Japan)

    2001-07-01

    We tried to improve the materials and methods of high-dose rate Iridium-192 brachytherapy for localized prostate cancer and evaluated the stress during the treatment in 20 patients with whom the therapy was performed. Rigid applicators made of stainless steel of 1.6 mm in diameter were indwelt with a template as usual for 30 hours in 14 patients (group A). Flexible applicators made of polyoxymethylene rosin (POM) of 2.0 mm in diameter were indwelt without a template for 30 hours after the applicator insertion in 6 patients (group B). We made inquiries about lumbago, inconvenience and necessity of assistant help and sleep in the course of therapy, and urinary incontinence and erectile function after the course of therapy as the QOL. The stress during the course of therapy in the patients of group B was obviously less than that of group A. There were no significant differences in urinary incontinence and erectile function after the course of therapy between group A and B. In this study, our trial successfully reduced the stress during the course of therapy in the patients with localized prostate cancer in the course of high-dose rate Iridium-192 brachytherapy. (author)

  9. Attitudes and treatment outcome of breast conservation therapy for stage I and II breast cancer using peroperative iridium-192 implant boost to the tumour bed

    International Nuclear Information System (INIS)

    Breast conservation therapy for early breast cancer is an established but grossly under-utilized treatment option in India for various reasons. Breast conservation therapy was offered to 200 suitable breast cancer patients between June 1993 and June 1998. Fifty-one patients (25%) opted for breast conservation and the remaining preferred mastectomy. In patients agreeing to conservation therapy, surgery was performed first along with peroperative implantation of iridium-192 to deliver a boost. Whole breast irradiation of 45 Gy was delivered 3-4 weeks after the boost. Cosmesis was assessed at the end of 6 months from completion of therapy. The main reason for refusal of breast conservation therapy was fear of recurrence in the remaining breast (60%). There were no loco-regional failures in our study at a median follow up of 42 months; one patient experienced a systemic relapse. Cosmesis was good to excellent in 80% of patients. Breast conservation therapy using peroperative iridium-192 implant provides excellent loco-regional disease control and cosmesis. The results of our study indicate that patient preference for mastectomy is an important reason for the under-utilization of breast conservation therapy in India. Copyright (2001) Blackwell Science Pty Ltd

  10. Study on the cycle decomposition of CO2 over NiCr0.08Fe1.92O4 and the microstructure of products

    International Nuclear Information System (INIS)

    The reduced NiFe2O4 has high activity of CO2 decomposition and can be used repeatedly. The performance of NiFe2O4-doped 4 wt% Cr3+ (NiCr0.08Fe1.92O4) is much better than non-doped sample. The fresh NiCr0.08Fe1.92O4 is of spinel structure and nanometric scale. During H2/CO2 cycle reactions their spinel structure is gradually destroyed and new species such as carbon, FexNi1-x (0≤ x ≤1) alloy and Fe3C appear. Their morphology, phase composition and pore structure are characterized by means of X-ray diffraction (XRD), high-resolution transmission electron microscopy (HRTEM), Raman spectroscopy and low-temperature N2 adsorption. The crystallite size increases with number of reaction cycle. From TEM pictures, it is found that deposited carbon on the surface is amorphous at first and transformed gradually to crystallite carbon, even in carbon nanotubes which increase with number of cycle reaction

  11. Radiological protection on interstitial brachytherapy and dose determination and exposure rate of an Ir-192 source through the MCNP-4B

    International Nuclear Information System (INIS)

    The present work was carried out in the Neurological Sciences Institute having as objective to determine the dose and the rate of exhibition of the sources of Iridium 192, Iodine 125 and Palladium 103; which are used to carry out implant in the Interstitial Brachytherapy according to the TG43. For it we carry out a theoretical calculation, its are defined in the enter file: the geometry, materials of the problem and the radiation source, etc; in the MCNP-4B Monte Carlo code, considering a punctual source and for the dose determination we simulate thermoluminescent dosemeters (TLD): at 5 cm, 50 cm, 100 cm and 200 cm of the source. Our purpose is to analyze the radioprotection measures that should take into account in this Institute in which are carried out brain biopsies using a Micro mar stereotactic mark, and in a near future with the collaboration of a doctor and a cuban physique seeks to be carried out the Interstitial Brachytherapy technique with sources of Ir-192 for patient with tumors like glioblastoma, astrocytoma, etc. (Author)

  12. Treatment of squamous cell carcinomas of the floor of the mouth and tongue by interstitial high-dose-rate irradiation using iridium-192

    International Nuclear Information System (INIS)

    The results are presented of afterloading high-dose-rate-radiation with iridium-192 in 34 patients with squamous cell carcinomas of the floor of the mouth and tongue. Some patients were also treated surgically or given percutaneous radio- or chemotherapy. At the time of diagnosis, 28.0% had a T2 tumour, 41.9% a T3 tumour and 30.1% a T4 tumour. 41.2% had positive lymph nodes and 2.9% distant metastases. The response rate was 64.7%, 26.5% of which were complete remissions and 38.2% partial remissions. In 61.8% of cases, the tumour was recurrent and responded with a rate as high as 57.2%, 23.9% of which were complete remissions and 33.3% partial remissions. Survival times were dependent upon therapy results. The mean survival of patients with complete remission was 40.3 months, with partial remission 16.1 months as opposed to 7.2 and 3.5 months respectively in patients showing no change or progressive disease. It can be concluded that afterloading therapy using high-dose-rate-radiation with iridium-192 achieves good palliative results and should be looked at as a supplementary treatment modality for squamous cell carcinomas of the floor of the mouth and tongue. (au)

  13. A statistical approach to infer the minimum setup distance of a well chamber to the wall or to the floor for 192Ir HDR calibration

    International Nuclear Information System (INIS)

    We propose a new method based on statistical analysis technique to determine the minimum setup distance of a well chamber used in the calibration of 192Ir high dose rate (HDR). The chamber should be placed at least this distance away from any wall or from the floor in order to mitigate the effect of scatter. Three different chambers were included in this study, namely, Sun Nuclear Corporation, Nucletron, and Standard Imaging. The results from this study indicated that the minimum setup distance varies depending on the particular chamber and the room architecture in which the chamber was used. Our result differs from that of a previous study by Podgorsak et al. [Med. Phys. 19, 1311-1314 (1992)], in which 25 cm was suggested, and also differs from that of the International Atomic Energy Agency (IAEA)-TECDOC-1079 report, which suggested 30 cm. The new method proposed in this study may be considered as an alternative approach to determine the minimum setup distance of a well-type chamber used in the calibration of 192Ir HDR

  14. Characterization of a mutant Escherichia coli heat-labile toxin, LT(R192G/L211A), as a safe and effective oral adjuvant.

    Science.gov (United States)

    Norton, Elizabeth B; Lawson, Louise B; Freytag, Lucy C; Clements, John D

    2011-04-01

    Despite the fact that the adjuvant properties of the heat-labile enterotoxins of Escherichia coli (LT) and Vibrio cholerae (CT) have been known for more than 20 years, there are no available oral vaccines containing these molecules as adjuvants, primarily because they are both very potent enterotoxins. A number of attempts with various degrees of success have been made to reduce or eliminate the enterotoxicity of LT and CT so they can safely be used as oral adjuvants or immunogens. In this report we characterize the structural, enzymatic, enterotoxic, and adjuvant properties of a novel mutant of LT, designated LT(R192G/L211A), or dmLT. dmLT was not sensitive to trypsin activation, had reduced enzymatic activity for induction of cyclic AMP in Caco-2 cells, and exhibited no enterotoxicity in the patent mouse assay. Importantly, dmLT retained the ability to function as an oral adjuvant for a coadministered antigen (tetanus toxoid) and to elicit anti-LT antibodies. In vitro and in vivo data suggest that the reduced enterotoxicity of this molecule compared to native LT or the single mutant, LT(R192G), is a consequence of increased sensitivity to proteolysis and rapid intracellular degradation in mammalian cells. In conclusion, dmLT is a safe and powerful detoxified enterotoxin with the potential to function as a mucosal adjuvant for coadministered antigens and to elicit anti-LT antibodies without undesirable side effects. PMID:21288994

  15. High-dose rate iridium-192 brachytherapy with flexible applicator. A trial toward decrease of stress during treatment and improvement of quality of life

    International Nuclear Information System (INIS)

    We tried to improve the materials and methods of high-dose rate Iridium-192 brachytherapy for localized prostate cancer and evaluated the stress during the treatment in 20 patients with whom the therapy was performed. Rigid applicators made of stainless steel of 1.6 mm in diameter were indwelt with a template as usual for 30 hours in 14 patients (group A). Flexible applicators made of polyoxymethylene rosin (POM) of 2.0 mm in diameter were indwelt without a template for 30 hours after the applicator insertion in 6 patients (group B). We made inquiries about lumbago, inconvenience and necessity of assistant help and sleep in the course of therapy, and urinary incontinence and erectile function after the course of therapy as the QOL. The stress during the course of therapy in the patients of group B was obviously less than that of group A. There were no significant differences in urinary incontinence and erectile function after the course of therapy between group A and B. In this study, our trial successfully reduced the stress during the course of therapy in the patients with localized prostate cancer in the course of high-dose rate Iridium-192 brachytherapy. (author)

  16. A generic high-dose rate {sup 192}Ir brachytherapy source for evaluation of model-based dose calculations beyond the TG-43 formalism

    Energy Technology Data Exchange (ETDEWEB)

    Ballester, Facundo, E-mail: Facundo.Ballester@uv.es [Department of Atomic, Molecular and Nuclear Physics, University of Valencia, Burjassot 46100 (Spain); Carlsson Tedgren, Åsa [Department of Medical and Health Sciences (IMH), Radiation Physics, Faculty of Health Sciences, Linköping University, Linköping SE-581 85, Sweden and Department of Medical Physics, Karolinska University Hospital, Stockholm SE-171 76 (Sweden); Granero, Domingo [Department of Radiation Physics, ERESA, Hospital General Universitario, Valencia E-46014 (Spain); Haworth, Annette [Department of Physical Sciences, Peter MacCallum Cancer Centre and Royal Melbourne Institute of Technology, Melbourne, Victoria 3000 (Australia); Mourtada, Firas [Department of Radiation Oncology, Helen F. Graham Cancer Center, Christiana Care Health System, Newark, Delaware 19713 (United States); Fonseca, Gabriel Paiva [Instituto de Pesquisas Energéticas e Nucleares – IPEN-CNEN/SP, São Paulo 05508-000, Brazil and Department of Radiation Oncology (MAASTRO), GROW, School for Oncology and Developmental Biology, Maastricht University Medical Center, Maastricht 6201 BN (Netherlands); Zourari, Kyveli; Papagiannis, Panagiotis [Medical Physics Laboratory, Medical School, University of Athens, 75 MikrasAsias, Athens 115 27 (Greece); Rivard, Mark J. [Department of Radiation Oncology, Tufts University School of Medicine, Boston, Massachusetts 02111 (United States); Siebert, Frank-André [Clinic of Radiotherapy, University Hospital of Schleswig-Holstein, Campus Kiel, Kiel 24105 (Germany); Sloboda, Ron S. [Department of Medical Physics, Cross Cancer Institute, Edmonton, Alberta T6G 1Z2, Canada and Department of Oncology, University of Alberta, Edmonton, Alberta T6G 2R3 (Canada); and others

    2015-06-15

    Purpose: In order to facilitate a smooth transition for brachytherapy dose calculations from the American Association of Physicists in Medicine (AAPM) Task Group No. 43 (TG-43) formalism to model-based dose calculation algorithms (MBDCAs), treatment planning systems (TPSs) using a MBDCA require a set of well-defined test case plans characterized by Monte Carlo (MC) methods. This also permits direct dose comparison to TG-43 reference data. Such test case plans should be made available for use in the software commissioning process performed by clinical end users. To this end, a hypothetical, generic high-dose rate (HDR) {sup 192}Ir source and a virtual water phantom were designed, which can be imported into a TPS. Methods: A hypothetical, generic HDR {sup 192}Ir source was designed based on commercially available sources as well as a virtual, cubic water phantom that can be imported into any TPS in DICOM format. The dose distribution of the generic {sup 192}Ir source when placed at the center of the cubic phantom, and away from the center under altered scatter conditions, was evaluated using two commercial MBDCAs [Oncentra{sup ®} Brachy with advanced collapsed-cone engine (ACE) and BrachyVision ACUROS{sup TM}]. Dose comparisons were performed using state-of-the-art MC codes for radiation transport, including ALGEBRA, BrachyDose, GEANT4, MCNP5, MCNP6, and PENELOPE2008. The methodologies adhered to recommendations in the AAPM TG-229 report on high-energy brachytherapy source dosimetry. TG-43 dosimetry parameters, an along-away dose-rate table, and primary and scatter separated (PSS) data were obtained. The virtual water phantom of (201){sup 3} voxels (1 mm sides) was used to evaluate the calculated dose distributions. Two test case plans involving a single position of the generic HDR {sup 192}Ir source in this phantom were prepared: (i) source centered in the phantom and (ii) source displaced 7 cm laterally from the center. Datasets were independently produced by

  17. Identification and Analysis of Conserved Sequence Motifs in Cytochrome P450 Family 2: FUNCTIONAL AND STRUCTURAL ROLE OF A MOTIF 187RFDYKD192 IN CYP2B ENZYMES*S⃞

    OpenAIRE

    Oezguen, Numan; Kumar, Santosh; Hindupur, Aditya; Braun, Werner; Muralidhara, B. K.; Halpert, James R.

    2008-01-01

    Using a multiple alignment of 175 cytochrome P450 (CYP) family 2 sequences, 20 conserved sequence motifs (CSMs) were identified with the program PCPMer. Functional importance of the CSM in CYP2B enzymes was assessed from available data on site-directed mutants and genetic variants. These analyses suggested an important role of the CSM 8, which corresponds to187RFDYKD192 in CYP2B4. Further analysis showed that residues 187, 188, 190, and 192 have a very high rank order ...

  18. The correlation between DVH at CT-image based 192Ir intracavitary brachytherapy and effects or complications for patients with locally advanced cervical cancer

    International Nuclear Information System (INIS)

    Objective: To investigate the correlation between dose volume histogram (DVH) of tumor targets and organs at risk (OAR) at CT-image based 192Ir brachytherapy and effects and complications for patients with locally advanced cervical cancer. Methods: Ten patients with FIGO stage IIIB cervical cancer received CT image-based 192Ir intracavitary brachytherapy after 54 Gy of three-dimensional four-field pelvic external beam radiotherapy and concurrent weekly cisplatin chemotherapy. Before each brachytherapy, CT images were acquired with applicators in place. Gross tumor volume (GTV), clinical target volume (CTV) and OAR were contoured and inverse treatment planning was designed and optimized by using PLATO treatment planning system. Conventional two-dimensional plans were also designed for comparison.The total intracavitary brachytherapy dose was 30-42 Gy in 5-7 fractions. The patients were followed, and the local control and complications were analyzed. The biologically equivalent dose (BED) and biologically equivalent dose in 2 Gy fractions (BED2) for GTV, CTV and OAR were calculated. The minimum dose in the most irradiated tissue volume 2 cm3 (D2cm3)adjacent to the applicator of the sigmoid colon, rectum,bladder and small bowel was determined from the DVH. Results: The 1-year local pelvic control rate was 90% and grade 1-2 late complication of sigmoid colon and rectum was 50%. No grade 3 or more complications developed. On CT-image based planning, the BED and BED2 to 90% of the CTV (D90) were 95.50 Gy ± 7. 81 Gy and 79. 73 Gy ± 6. 57 Gy. The BED and BED2 to 90% of the GTV (D90) were 101.86 Gy ± 7.27 Gy and 84. 95 Gy ± 6. 1 Gy. The volume enclosed by 90% of prescribed dose (V90) for GTV and CTV were 92% ±4% and 87% ±7% respectively. The D2cm3 for rectum and sigmoid colon were 74. 97 Gy ±1.64 Gy and 67. 93 Gy ± 4. 30 Gy(EQD2, α/β = 3). Comparing with 2D brachytherapy plans , CT - image based planning has improved D90 and V90 for GTV and CTV with similar dose

  19. Dosimetric characterization of low dose rate Iridium 192 wires used in interstitial brachytherapy, produced by Brachytherapy Sources Laboratory the CTRS/IPEN/CNEN-SP, Brazil

    International Nuclear Information System (INIS)

    In this work they were some dosimetric parameters established by the dosimetry protocol AAPM TG-43 for the thread of 192Ir with the purpose of complementing the dosimetric specifications of an original source produced at the country. For so much quantities such as the constant of dose rate, A , function of radial dose, g(r), and anisotropy function, F(r,θ), they were experimentally determined and the geometry function, G(r,θ), it was calculated. Measurements with TLD of LiF, with dimensions of 1 mm X 1 mm X 1 mm, was made in a phantom made of 5 plates of solid water RW3 material with dimensions of 300 mm X 300 mm X 10 mm, where it was obtained values of dose rate for some radial distances of the source, between 10 and 100 mm, to for an angle of 90 deg, for g(r), and also for other angles between 0 deg and 180 deg for F(r,θ). Threads of 192Ir were studied in the lengths of 10 mm, 20 mm, 30 mm, 50 mm and 100 mm. The stored energy on the thermoluminescent dosimeters was integrated by means of a TLD reader Harshaw 2000 meantime into a cycle of thermal treatment to which the thermoluminescent dosimeters was submitted being, 400 C in an interval of time of 1 hour proceeded immediately for more 2 hours to 105 C, after this treatment the thermoluminescent dosimeters was irradiated; even so, before the reading the detectors was still warm to 105 deg C for 10 minutes. The constant of dose rate for the threads of 192Ir of 10 mm, 20 mm, 30 mm, 50 mm and 100 mm are (1,076 =- 3,7%); (0,931 =- 3,7%); (0,714 =- 3,7%); (0,589 =-3,7%) and (0,271 =- 3,7%) cGyh-1 U-1, respectively (1U = unit of kerma intensity in the air = 1mGy m2 h-1 = 1cGy cm2 h-1). The results obtained for g(r) and F(r,θ) have uncertainties of (=- 4,5%) and they are compared with values obtained by Monte Carlo simulation and also for other values presented in the literature. (author)

  20. Description of E4 Transitions in A = 192, 194,196, 198 Platinum Isotopes in a Microscopic sdgIBM- 1

    Institute of Scientific and Technical Information of China (English)

    ZHANG ZhanJun; YANG Jie; WANG Xin; LIU Yong

    2001-01-01

    Influence of the effective fermion hexadecapole force newly incorporated in a microscopic sdgIBM-1 on spectra, reduced E2 and E4 transition matrix elements (T(E2)s and T(E4)s) in the even-even platinum isotopes (A = 192,194,196,198) is investigated in terms of numerical calculations. It is found that the introduced interaction causes only limited modification to the spectrum and T(E2)s, apart from a few exceptions. However, it plays an essential role in describing E4 transitions. Thus in the case that the interaction is incorporated with certain strength, a reasonable description of all the E4 transitions in the platinum isotopes is reached in the microscopic sdgIBM-1 in comparing both to experimental data and the results calculated in phenomenological boson model.``

  1. Search for shape coexistence in {sup 188,190}Pb via fine structure in the alpha decay of {sup 192,194}Po

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, I.; Davids, C.; Janssens, R.V.F. [and others

    1995-08-01

    The interaction between coexisting shapes in nuclei near closed shells was of great interest in the past decade. Excited 0{sup +} states at low energy can often be identified as the bandheads of structures with differing shapes built on those states, These structures were identified in {sup 190-198}Pb via beta decay and alpha decay {open_quotes}fine structure{close_quotes} studies. Coexistence of different shapes in Pb nuclei was predicted by Nilsson-Strutinsky calculations, in which both the oblate and prolate minima were predicted to have excitation energies near 1 MeV. It was our intention to continue the systematic study of the Pb nuclides by searching for excited O{sup +} states in {sup 188}Pb by observing the fine structure in the alpha decay of {sup 192}Po.

  2. Comparison BIPM.RI(I)-K8 of high dose-rate Ir-192 brachytherapy standards for reference air kerma rate of the NMIJ and the BIPM

    Science.gov (United States)

    Kessler, C.; Kurosawa, T.; Mikamoto, T.

    2016-01-01

    An indirect comparison of the standards for reference air kerma rate for 192Ir high dose rate (HDR) brachytherapy sources of the National Metrology Institute of Japan (AIST-NMIJ), Japan, and of the Bureau International des Poids et Mesures (BIPM) was carried out at the Japan Radioisotope Association (JRIA) in April 2015. The comparison result, based on the calibration coefficients for a transfer standard and expressed as a ratio of the NMIJ and the BIPM standards for reference air kerma rate, is 1.0036 with a combined standard uncertainty of 0.0054. Main text To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCRI, according to the provisions of the CIPM Mutual Recognition Arrangement (CIPM MRA).

  3. Measurement of hadron and lepton-pair production in $e^{+}e^{-}$ collisions at $\\sqrt{s} = 192 - 208 GeV$ at LEP

    CERN Document Server

    Achard, P; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Anderhub, H; Andreev, V P; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, G; Baksay, L; Baldew, S V; Banerjee, S; Banerjee, S W; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biglietti, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, G J; Böhm, A; Boldizsar, L; Borgia, B; Bottai, S; Bourilkov, D; Bourquin, M; Braccini, S; Branson, J G; Brochu, F; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A; Casaus, J; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Chamizo-Llatas, M; Chang, Y H; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, L; Cindolo, F; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; de la Cruz, B; Cucciarelli, S; De Asmundis, R; Deglon, P; Debreczeni, J; Degré, A; Dehmelt, K; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Dionisi, C; Dittmar, M; Doria, A; Dova, M T; Duchesneau, D; Duda, M; Echenard, B; Eline, A; El-Hage, A; El-Mamouni, H; Engler, A; Eppling, F J; Extermann, P; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, M; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, F; Fisher, P H; Fisher, W; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gentile, S; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hirschfelder, J; Hofer, H; Hohlmann, M; Holzner, G; Hou, S R; Jin, B N; Jindal, P; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kaur, M; Kienzle-Focacci, M N; Kim, J K; Kirkby, Jasper; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Koutsenko, V F; Kraber, M; Krämer, R W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Levtchenko, M; Levchenko, P M; Li, C; Likhoded, S; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Luci, C; Luminari, L; Lustermann, W; Ma, W G; Malgeri, L; Malinin, A; Maña, C; Mans, J; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Muanza, G S; Muijs, A J M; Musy, M; Nagy, S; Natale, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nisati, A; Novák, T; Nowak, H; Ofierzynski, R A; Organtini, G; Pal, I; Palomares, C; Paolucci, P; Paramatti, R; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, F; Pedace, M; Pensotti, S; Perret-Gallix, D; Piccolo, D; Pierella, F; Pieri, M; Pioppi, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Pothier, J; Prokofev, D; Prokofiev, D O; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Razis, P; Rembeczki, S; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Roe, B P; Romero, L; Rosca, A; Rosemann, C; Rosenbleck, C; Rosier-Lees, S; Roth, S; Rubio, J A; Ruggiero, G; Rykaczewski, H; Sakharov, A; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Schäfer, C; Shchegelskii, V; Schopper, Herwig Franz; Schotanus, D J; Sciacca, C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A; Son, D; Souga, C; Spillantini, P; Steuer, M; Stickland, D P; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tarjan, P; Tauscher, L; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Ulbricht, J; Valente, E; Van de Walle, R T; Vásquez, R; Vesztergombi, G; Vetlitskii, I; Viertel, G; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Wadhwa, M; Wang, Q; Wang, X L; Wang, Z M; Weber, M; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhao, J; Zhu, G Y; Zhu, R Y; Zhuang, H L; Zichichi, A; Zimmermann, B; Zöller, M

    2006-01-01

    Hadron production and lepton-pair production in e+e- collisions are studied with data collected with the L3 detector at LEP at centre-of-mass energies sqrt{s}=192-208GeV. Using a total integrated luminosity of 453/pb, 36057 hadronic events and 12863 lepton-pair events are selected. The cross sections for hadron production and lepton-pair production are measured for the full sample and for events where no high-energy initial-state-radiation photon is emitted prior to the collisions. Lepton-pair events are further investigated and forward-backward asymmetries are measured. Finally, the differential cross sections for electron-positron pair-production is determined as a function of the scattering angle. An overall good agreement is found with Standard Model predictions.

  4. Characterization of a fiber-coupled Al2O3:C luminescence dosimetry system for online in vivo dose verification during Ir-192 brachytherapy

    DEFF Research Database (Denmark)

    Andersen, Claus Erik; Nielsen, Søren Kynde; Greilich, Steffen;

    2009-01-01

    fit into applicators such as standard needles or catheters. The system measures the absorbed dose rate (0.1 s time resolution) and total absorbed dose on the basis of radioluminescence (RL) and optically stimulated luminescence (OSL) from aluminum oxide crystals attached to optical fiber cables (1 mm...... outer diameter). The system was tested in the range from 0 to 4 Gy using a solid-water phantom, a Varian GammaMed Plus Ir-192 PDR afterloader, and dosimetry probes inserted into stainless-steel brachytherapy needles. The calibrated system was found to be linear in the tested dose range. The...... reproducibility (one standard deviation) for RL and OSL measurements was 1.3%. The measured depth-dose profiles agreed well with the theoretical expectations computed with the EGSNRC Monte Carlo code, suggesting that the energy dependence for the dosimeter probes (relative to water) is less than 6% for source...

  5. Intraluminal hyperthermia and radiotherapy using {sup 192}Ir remote after loading system in the treatment of unresectable hilar bile duct cancer

    Energy Technology Data Exchange (ETDEWEB)

    Tsuchida, Akira; Itoh, Masaki; Fujii, Tohru [Hiroshima Univ. (Japan). School of Medicine] [and others

    1995-10-01

    The efficacy of combined therapy of intraluminal hyperthermia and radiotherapy using remote after loading system (RALS) was compared with that of percutaneous transhepatic biliary endoprosthesis (PTBE) alone. The subjects were 60 patients having unresectable hilar bile duct cancer. Percutaneous transhepatic biliary drainage (PTBD) was performed in the all patients, and additionally PTBE in 39, local infusion of bleomycin and intraluminal hyperthermia in 11, and internal irradiation (RALS) in 10. Four fractionated irradiation (4 Gy x 4) was performed on the site 10 mm from the source using {sup 192}Ir high dose RALS, and subsequently two fractionated brachytherapy of 10 Gy and 20 fractionated external irradiation of 40 Gy. The outcome was significantly improved in the RALS group, showing 50% survival time of 444.8 days (PTBE group, 228.7 days; hyperthermia group, 472 days). (S.Y.).

  6. Determination of $\\alpha_s$ from Hadronic Event Shapes in $e^+ e^-$ Annihilation at $192 \\le \\sqrt{s} \\le 208$ GeV

    CERN Document Server

    Achard, P; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Anderhub, H; Andreev, V P; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, G; Baksay, L; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biglietti, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bottai, S; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Chamizo-Llatas, M; Chang, Y H; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; de la Cruz, B; Cucciarelli, S; van Dalen, J A; De Asmundis, R; Déglon, P L; Debreczeni, J; Degré, A; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Dionisi, C; Dittmar, Michael; Doria, A; Dova, M T; Duchesneau, D; Echenard, B; Eline, A; El-Mamouni, H; Engler, A; Eppling, F J; Ewers, A; Extermann, Pierre; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisher, W; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gentile, S; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hakobyan, R S; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hirschfelder, J; Hofer, H; Hohlmann, M; Holzner, G; Hou, S R; Hu, Y; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Käfer, D; Kaur, M; Kienzle-Focacci, M N; Kim, J K; Kirkby, Jasper; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Koutsenko, V F; Kräber, M H; Krämer, R W; Krenz, W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Levtchenko, M; Levchenko, P M; Li, C; Likhoded, S A; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luminari, L; Lustermann, W; Ma Wen Gan; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mans, J; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Nagy, S; Natale, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nisati, A; Nowak, H; Ofierzynski, R A; Organtini, G; Palomares, C; Pandoulas, D; Paolucci, P; Paramatti, R; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pioppi, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Pothier, J; Prokofiev, D O; Prokofev, D; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Roe, B P; Romero, L; Rosca, A; Rosier-Lees, S; Roth, S; Rosenbleck, C; Roux, B; Rubio, Juan Antonio; Ruggiero, G; Rykaczewski, H; Sakharov, A; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Sanders, M P; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schopper, Herwig Franz; Schotanus, D J; Schwering, G; Sciacca, C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Spillantini, P; Steuer, M; Stickland, D P; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S V; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tarjan, P; Tauscher, Ludwig; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Ulbricht, J; Valente, E; Van de Walle, R T; Veszpremi, V; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Wadhwa, M; Wallraff, W; Wang, X L; Wang, Z M; Weber, M; Wienemann, P; Wilkens, H; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhao, J; Zhu, G Y; Zhu, R Y; Zhuang, H L; Zichichi, A; Zilizi, G; Zimmermann, B; Zöller, M

    2002-01-01

    Results are presented from a study of the structure of high energy hadronic events recorded by the L3 detector at sqrt(s)>192 GeV. The distributions of several event shape variables are compared to resummed O(alphaS^2) QCD calculations. We determine the strong coupling constant at three average centre-of-mass energies: 194.4, 200.2 and 206.2 GeV. These measurements, combined with previous L3 measurements at lower energies demonstrate the running of alphaS as expected in QCD and yield alphaS(mZ) = 0.1227 +- 0.0012 +- 0.0058, where the first uncertainty is experimental and the second is theoretical.

  7. MiR-192-Mediated Positive Feedback Loop Controls the Robustness of Stress-Induced p53 Oscillations in Breast Cancer Cells.

    Directory of Open Access Journals (Sweden)

    Richard Moore

    2015-12-01

    Full Text Available The p53 tumor suppressor protein plays a critical role in cellular stress and cancer prevention. A number of post-transcriptional regulators, termed microRNAs, are closely connected with the p53-mediated cellular networks. While the molecular interactions among p53 and microRNAs have emerged, a systems-level understanding of the regulatory mechanism and the role of microRNAs-forming feedback loops with the p53 core remains elusive. Here we have identified from literature that there exist three classes of microRNA-mediated feedback loops revolving around p53, all with the nature of positive feedback coincidentally. To explore the relationship between the cellular performance of p53 with the microRNA feedback pathways, we developed a mathematical model of the core p53-MDM2 module coupled with three microRNA-mediated positive feedback loops involving miR-192, miR-34a, and miR-29a. Simulations and bifurcation analysis in relationship to extrinsic noise reproduce the oscillatory behavior of p53 under DNA damage in single cells, and notably show that specific microRNA abrogation can disrupt the wild-type cellular phenotype when the ubiquitous cell-to-cell variability is taken into account. To assess these in silico results we conducted microRNA-perturbation experiments in MCF7 breast cancer cells. Time-lapse microscopy of cell-population behavior in response to DNA double-strand breaks, together with image classification of single-cell phenotypes across a population, confirmed that the cellular p53 oscillations are compromised after miR-192 perturbations, matching well with the model predictions. Our study via modeling in combination with quantitative experiments provides new evidence on the role of microRNA-mediated positive feedback loops in conferring robustness to the system performance of stress-induced response of p53.

  8. Pathological characteristics of extremely severe acute radiation injury in a patient's legs and hands after a very uneven accidental exposure to an extremely high dose of 192Ir

    International Nuclear Information System (INIS)

    The pathological characteristics of an extremely high dose radiation in the legs and hands of a patient is reported. the patient was exposed to 192Ir γ-rays for 9 hours and 20 minutes, the activity of which was 2.76 TBq. The amputations of the right thigh and left forearm had to be performed 8 days after the irradiation and the debridements and skin graftings were performed on the right hand and the inner side of left knee 55 days after the radiation. Microscopically, massive necrosis of cells of the epidermis, cutaneous appendages, hypodermics and skeletal muscles, and hemorrhage in the dermis, hypodermics and skeletal muscles were seen in the local irradiated parts of the right shank. But the arrector pili muscles in the dermis of the right shank remained. On the fingers and the palm of the left hand, vacuolar degeneration and massive necrosis of the cells of epidermis were present with extensive neutrophil infiltration. Cysts of large or small size were formed from the necrotic cells, separating epidermis from dermis. There were degeneration and necrosis of glandular epithelium cells of sweat glands. Hemorrhage was present in dermis and hypodermics. All the hematopoietic tissues in the bone marrow in the upper ends of the tibia and fibula and in the lower ends of the femur, the radius and the ulna disappeared. Acute radiation ulcers were present on the skin of the left knee and on the skin of the thumb, index finger and middle finger of the right hand. The extremely severe acute radiation injury caused by extremely high dose of 192Ir led to the necrosis of the extensive soft tissues deep to skeletal muscles and the disappearance of the hematopoietic tissues in the bone marrow

  9. Dose specification for 192Ir high dose rate brachytherapy in terms of dose-to-water-in-medium and dose-to-medium-in-medium

    Science.gov (United States)

    Paiva Fonseca, Gabriel; Carlsson Tedgren, Åsa; Reniers, Brigitte; Nilsson, Josef; Persson, Maria; Yoriyaz, Hélio; Verhaegen, Frank

    2015-06-01

    Dose calculation in high dose rate brachytherapy with 192Ir is usually based on the TG-43U1 protocol where all media are considered to be water. Several dose calculation algorithms have been developed that are capable of handling heterogeneities with two possibilities to report dose: dose-to-medium-in-medium (Dm,m) and dose-to-water-in-medium (Dw,m). The relation between Dm,m and Dw,m for 192Ir is the main goal of this study, in particular the dependence of Dw,m on the dose calculation approach using either large cavity theory (LCT) or small cavity theory (SCT). A head and neck case was selected due to the presence of media with a large range of atomic numbers relevant to tissues and mass densities such as air, soft tissues and bone interfaces. This case was simulated using a Monte Carlo (MC) code to score: Dm,m, Dw,m (LCT), mean photon energy and photon fluence. Dw,m (SCT) was derived from MC simulations using the ratio between the unrestricted collisional stopping power of the actual medium and water. Differences between Dm,m and Dw,m (SCT or LCT) can be negligible (brachytherapy studies clearly report the dose quantity. It further shows that while differences between Dm,m and Dw,m (SCT) mainly depend on tissue type, differences between Dm,m and Dw,m (LCT) are, in addition, significantly dependent on the local photon energy fluence spectrum which varies with distance to implanted sources.

  10. Systematic decay studies of even-even 132-138Nd, 144-158Gd, 176-196Hg and 192-198Pb isotopes

    International Nuclear Information System (INIS)

    The alpha and cluster decay properties of the 132-138Nd, 144-158Gd, 176-196Hg and 192-198Pb even-even isotopes in the two mass regions A=130-158 and A=180-198 are analyzed using the Coulomb and Proximity Potential Model. On examining the clusters at corresponding points in the cold valleys (points with same A2) of the various isotopes of a particular nucleus we find that at certain mass numbers of the parent nuclei, the clusters emitted are getting shifted to the next lower atomic number. It is interesting to see that the change in clusters appears at those isotopes where a change in shape is occurring correspondingly. Such a change of clusters with shape change is studied for the first time in cluster decay. The alpha decay half lives of these nuclei are computed and these are compared with the available experimental alpha decay data. It is seen that the two are in good agreement. On making a comparison of the alpha half lives of the normal deformed and superdeformed nuclei, it can be seen that the normal deformed 132Nd, 176-188Hg and 192Pb nuclei are found to be better alpha emitters than the superdeformed (in excited state) 134,136Nd, 190-196Hg and 194Pb nuclei. The cluster decay studies reveal that as the atomic number of the parent nuclei increases the N≠Z cluster emissions become equally or more probable than the N=Z emissions. On the whole the alpha and cluster emissions are more probable from the parents in the heavier mass region (A=180-198) than from the parents in the lighter mass region (A=130-158). The effect of quadrupole (β2) and hexadecapole (β4) deformations of parent and fragments on half life times are also studied.

  11. Direct measurement of absorbed dose to water in HDR 192Ir brachytherapy: Water calorimetry, ionization chamber, Gafchromic film, and TG-43

    International Nuclear Information System (INIS)

    Purpose: Gafchromic film and ionometric calibration procedures for HDR 192Ir brachytherapy sources in terms of dose rate to water are presented and the experimental results are compared to the TG-43 protocol as well as with the absolute dose measurement results from a water calorimetry-based primary standard. Methods: EBT-1 Gafchromic films, an A1SL Exradin miniature Shonka thimble type chamber, and an SI HDR 1000 Plus well-type chamber (Standard Imaging, Inc., Middleton, WI) with an ADCL traceable Sk calibration coefficient (following the AAPM TG-43 protocol) were used. The Farmer chamber and Gafchromic film measurements were performed directly in water. All results were compared to direct and absolute absorbed dose to water measurements from a 4 deg. C stagnant water calorimeter. Results: Based on water calorimetry, the authors measured the dose rate to water to be 361±7 μGy/(h U) at a 55 mm source-to-detector separation. The dose rate normalized to air-kerma strength for all the techniques agree with the water calorimetry results to within 0.83%. The overall 1-sigma uncertainty on water calorimetry, ionization chamber, Gafchromic film, and TG-43 dose rate measurement amounts to 1.90%, 1.44%, 1.78%, and 2.50%, respectively. Conclusions: This work allows us to build a more realistic uncertainty estimate for absorbed dose to water determination using the TG-43 protocol. Furthermore, it provides the framework necessary for a shift from indirect HDR 192Ir brachytherapy dosimetry to a more accurate, direct, and absolute measurement of absorbed dose to water.

  12. Early breast cancer: influence of type of boost (electrons vs iridium-192 implant) on local control and cosmesis after conservative surgery and radiation therapy

    International Nuclear Information System (INIS)

    Between December 1981 and December 1988, 329 consecutive patients with stage I and II breast cancers who underwent wide excision (n = 261) or quadrantectomy (n = 68) with (n = 303) or without (n = 26) axillary dissection were referred to radiotherapy. Final margins of resection were microscopically free from tumor involvement in all cases. Radiotherapy consisted in 40-45 Gy over 4-4.5 weeks to the breast, with (n = 168) or without (n = 161) regional nodal irradiation of 45-50 Gy over 4.5-5 weeks. A mean booster dose of 15 Gy was delivered to the primary site by iridium-192 implant in 169 patients (group 1) or by electrons in 160 patients (group 2). Twenty-seven percent (n = 88) of patients received tamoxifen for ≥ 2 years. Adjuvant chemotherapy was administered in 22% (n = 71) of patients. Groups 1 and 2 were not strictly comparable. Group 1 patients were significantly younger, had smaller tumors, were treated with cobalt at 5 x 2 Gy per week and axillary dissection was more frequently performed. Group 2 patients were more frequently bifocal and more frequently treated by quadrantectomy and tamoxifen, and irradiation used accelerator photons at 4 x 2.50 Gy per week. No difference in terms of follow-up and survival rates was observed between the two groups. For all patients the 5- and 10-year local breast relapse rates were 6.7% and 11%, respectively. No difference was observed regarding local control either by the electron or the iridium-192 implant boosts. Axillary dissection and age had an impact on the breast cosmetic outcome. Furthermore, the cosmetic results seemed to be poorer in group 1 than in group 2. This may be related to other factors; group 1 patients were treated with telecobalt and axillary dissection was more frequently performed; on the other hand, group 2 patients were treated with accelarator photons

  13. SU-F-19A-10: Recalculation and Reporting Clinical HDR 192-Ir Head and Neck Dose Distributions Using Model Based Dose Calculation

    International Nuclear Information System (INIS)

    Purpose: To retrospectively re-calculate dose distributions for selected head and neck cancer patients, earlier treated with HDR 192Ir brachytherapy, using Monte Carlo (MC) simulations and compare results to distributions from the planning system derived using TG43 formalism. To study differences between dose to medium (as obtained with the MC code) and dose to water in medium as obtained through (1) ratios of stopping powers and (2) ratios of mass energy absorption coefficients between water and medium. Methods: The MC code Algebra was used to calculate dose distributions according to earlier actual treatment plans using anonymized plan data and CT images in DICOM format. Ratios of stopping power and mass energy absorption coefficients for water with various media obtained from 192-Ir spectra were used in toggling between dose to water and dose to media. Results: Differences between initial planned TG43 dose distributions and the doses to media calculated by MC are insignificant in the target volume. Differences are moderate (within 4–5 % at distances of 3–4 cm) but increase with distance and are most notable in bone and at the patient surface. Differences between dose to water and dose to medium are within 1-2% when using mass energy absorption coefficients to toggle between the two quantities but increase to above 10% for bone using stopping power ratios. Conclusion: MC predicts target doses for head and neck cancer patients in close agreement with TG43. MC yields improved dose estimations outside the target where a larger fraction of dose is from scattered photons. It is important with awareness and a clear reporting of absorbed dose values in using model based algorithms. Differences in bone media can exceed 10% depending on how dose to water in medium is defined

  14. SU-F-19A-10: Recalculation and Reporting Clinical HDR 192-Ir Head and Neck Dose Distributions Using Model Based Dose Calculation

    Energy Technology Data Exchange (ETDEWEB)

    Carlsson Tedgren, A [Linkoping University, Linkoping, Linkoping (Sweden); Persson, M; Nilsson, J [Karolinska hospital, Stockholm, Stockholm (Sweden)

    2014-06-15

    Purpose: To retrospectively re-calculate dose distributions for selected head and neck cancer patients, earlier treated with HDR 192Ir brachytherapy, using Monte Carlo (MC) simulations and compare results to distributions from the planning system derived using TG43 formalism. To study differences between dose to medium (as obtained with the MC code) and dose to water in medium as obtained through (1) ratios of stopping powers and (2) ratios of mass energy absorption coefficients between water and medium. Methods: The MC code Algebra was used to calculate dose distributions according to earlier actual treatment plans using anonymized plan data and CT images in DICOM format. Ratios of stopping power and mass energy absorption coefficients for water with various media obtained from 192-Ir spectra were used in toggling between dose to water and dose to media. Results: Differences between initial planned TG43 dose distributions and the doses to media calculated by MC are insignificant in the target volume. Differences are moderate (within 4–5 % at distances of 3–4 cm) but increase with distance and are most notable in bone and at the patient surface. Differences between dose to water and dose to medium are within 1-2% when using mass energy absorption coefficients to toggle between the two quantities but increase to above 10% for bone using stopping power ratios. Conclusion: MC predicts target doses for head and neck cancer patients in close agreement with TG43. MC yields improved dose estimations outside the target where a larger fraction of dose is from scattered photons. It is important with awareness and a clear reporting of absorbed dose values in using model based algorithms. Differences in bone media can exceed 10% depending on how dose to water in medium is defined.

  15. Cluster pattern analysis of energy deposition sites for the brachytherapy sources 103Pd, 125I, 192Ir, 137Cs, and 60Co

    International Nuclear Information System (INIS)

    Analysing the pattern of energy depositions may help elucidate differences in the severity of radiation-induced DNA strand breakage for different radiation qualities. It is often claimed that energy deposition (ED) sites from photon radiation form a uniform random pattern, but there is indication of differences in RBE values among different photon sources used in brachytherapy. The aim of this work is to analyse the spatial patterns of EDs from 103Pd, 125I, 192Ir, 137Cs sources commonly used in brachytherapy and a 60Co source as a reference radiation. The results suggest that there is both a non-uniform and a uniform random component to the frequency distribution of distances to the nearest neighbour ED. The closest neighbouring EDs show high spatial correlation for all investigated radiation qualities, whilst the uniform random component dominates for neighbours with longer distances for the three higher mean photon energy sources (192Ir, 137Cs, and 60Co). The two lower energy photon emitters (103Pd and 125I) present a very small uniform random component. The ratio of frequencies of clusters with respect to 60Co differs up to 15% for the lower energy sources and less than 2% for the higher energy sources when the maximum distance between each pair of EDs is 2 nm. At distances relevant to DNA damage, cluster patterns can be differentiated between the lower and higher energy sources. This may be part of the explanation to the reported difference in RBE values with initial DSB yields as an endpoint for these brachytherapy sources. (paper)

  16. Radiological protection on interstitial brachytherapy and dose determination and exposure rate of an Ir-192 source through the MCNP-4B; Proteccion radiologica en braquiterapia intersticial y determinacion de la dosis y tasa de exposicion de una fuente de Ir-192 mediante el MCNP-4B

    Energy Technology Data Exchange (ETDEWEB)

    Morales L, M.E. [INEN, Av. Angamos Este 2520- Surquillo, Lima (Peru)

    2006-07-01

    The present work was carried out in the Neurological Sciences Institute having as objective to determine the dose and the rate of exhibition of the sources of Iridium 192, Iodine 125 and Palladium 103; which are used to carry out implant in the Interstitial Brachytherapy according to the TG43. For it we carry out a theoretical calculation, its are defined in the enter file: the geometry, materials of the problem and the radiation source, etc; in the MCNP-4B Monte Carlo code, considering a punctual source and for the dose determination we simulate thermoluminescent dosemeters (TLD): at 5 cm, 50 cm, 100 cm and 200 cm of the source. Our purpose is to analyze the radioprotection measures that should take into account in this Institute in which are carried out brain biopsies using a Micro mar stereotactic mark, and in a near future with the collaboration of a doctor and a cuban physique seeks to be carried out the Interstitial Brachytherapy technique with sources of Ir-192 for patient with tumors like glioblastoma, astrocytoma, etc. (Author)

  17. Characterization of TLD-100 in powders for dosimetric quality control of {sup 192} Ir sources used in brachytherapy of high dose rate; Caracterizacion de TLD-100 en polvo para control de calidad dosimetrico de fuentes de Ir{sup 192} usadas en braquiterapia de alta tasa de dosis

    Energy Technology Data Exchange (ETDEWEB)

    Loaiza C, S.P

    2007-07-01

    The Secondary Standard Dosimetric at the National Institute of Nuclear Research (ININ) calibrated a lot of powdered TLD-100 (LiF:Mg,Ti) in terms of absorbed dose to water D{sub w} for the energy of: {sup 60}Co, {sup 137C}s, X rays of 250 and 50 kVp. Later on, it is carried out an interpolation of the calibration for the energy of the {sup 192}Ir. This calibration is part of a dosimetric quality control program, to solve the problems of traceability for the measurements carried out by the users of {sup 192}Ir sources employed in the treatments of High Dose Rate Brachytherapy (HDR) at the Mexican Republic. The calibrations of the radiation beams are made with the following protocols: IAEA TRS-398 for the {sup 60}Co for D{sub w}, using a secondary standard ionization chamber PTW N30013 calibrated in D{sub w} by the National Research Council (NRC, Canada). AAPM TG-43 for D{sub w} in terms of the strength kerma Sk, calibrating this last one quantity for the {sup 137}Cs radioactive source, with a well chamber HDR 1000 PLUS traceable to the University of Wisconsin (US). AAPM TG-61 for X ray of 250 and 50 kVp for D{sub w} start to Ka using field standard a Farmer chamber PTW 30001 traceable to K for the Central Laboratory of Electric Industries (CLEI, France). The calibration curves (CC) they built for the response of the powder TLD: R{sub TLD} vs D{sub w}: For the energy of {sup 60}Co, {sup 137}Cs, X rays of 250 and 50 kVp. Fitting them with the least square method weighed by means of a polynomial of second grade that corrects the supra linearity of the response. iii. Each one of the curves was validated with a test by lack of fitting and for the Anderson Darling normality test, using the software MINITAB in both cases. iv. The sensibility factor (F{sub s}) for each energy corresponds to the slope of the CC, v. The F{sub s} for the two {sup 192}Ir sources used are interpolated: one for a Micro Selectron source and the other one a Vari Source source. Finally, a couple of

  18. Combined modality therapy for localized prostate carcinoma using Iridium-192 brachytherapy and external beam radiotherapy: results, morbidity, and the lack of value of surgical lymph node staging

    International Nuclear Information System (INIS)

    Purpose/Objective: (1) To quantitate the morbidity and 5 and 10 year bNED survival of Ir-192 temporary implant combined with external beam radiotherapy in the treatment of clinically localized Prostate Carcinoma. (2) To determine the need for nodal staging prior to implant. Materials and Methods: 335 consecutively treated patients seen between 8/17/84 and 8/13/93 were analyzed. All patents had retropertoneal nodal dissection and were implanted with Ir-192 using the Syed-Neblett template. Thirteen percent who completed treatment per protocol were found to have microscopically involved nodes on permanent section. 277 patients had completed the entire treatment protocol and had at least 2 years follow-up with DRE and serial serum PSAs. All patients were evaluated for morbidity using the standard RTOG morbidity scales. The bNED survival was determined using Kaplan-Meier methods with a non-rising PSA value of < 1.0 used as an indicator of disease control. All patients received 30 Gy in 50 hrs. to the implant volume, followed in two weeks by 34.2 Gy external beam (19 fx/ 25 days). The median follow up for the group is 55 months. Results: Morbidity: 69.2% of the patients experienced no reportable morbidity. Urinary morbidity was usually transient and mild (Grade 1 or 2 in 9.7%). 4.9 % experienced grade 3 urinary complaints (6.6% stress incontinence) and the incidence of grade 4 urinary complaints was 0.6%. Urinary complications were 2.5 times more common in patients who had previously undergone a TURP. Rectal complications were mild or moderate in 10.5% and usually consisted of asymptomatic rectal bleeding (6.9%). Severe rectal ulcer requiring temporary colostomy occurred in 1.4% and always healed after colostomy. Other morbidity consisted of mild, self-limited edema (2.1%). One patient had persistent edema post treatment, and there was one death from a CVA perioperatively (0.3%). 75% of patients who were potent prior to treatment maintained useful sexual function post

  19. Dosimetric accuracy of a deterministic radiation transport based 192Ir brachytherapy treatment planning system. Part I: Single sources and bounded homogeneous geometries

    International Nuclear Information System (INIS)

    Purpose: The aim of this work is to validate a deterministic radiation transport based treatment planning system (TPS) for single 192Ir brachytherapy source dosimetry in homogeneous water geometries. Methods: TPS results were obtained using the deterministic radiation transport option of a BRACHYVISION v. 8.8 system for three characteristic source designs (VS2000, GMPlus HDR, and GMPlus PDR) with each source either centered in a 15 cm radius spherical water phantom, or positioned at varying distance away from the phantom center. Corresponding MC simulations were performed using the MCNPX code v.2.5.0 and source geometry models prepared using information provided by the manufacturers. Results: Comparison in terms of the AAPM TG-43 dosimetric formalism quantities, as well as dose rate distributions per unit air kerma strength with a spatial resolution of 0.1 cm, yielded close agreement between TPS and MC results for the sources centered in the phantom. Besides some regions close to the source longitudinal axes where discrepancies could be characterized as systematic, overall agreement for all three sources studied is comparable to the statistical (type A) uncertainty of MC simulations (1% at the majority of points in the geometry increasing to 2%-3% at points lying both away from the source center and close to the source longitudinal axis). A corresponding good agreement was also found between TPS and MC results for the sources positioned away from the phantom center. Conclusions: Results of this work attest the capability of the TPS to accurately account for the scatter conditions regardless of the size or shape of a given geometry of dosimetric interest, and the position of a source within it. This is important since, as shown in the literature and summarized also in this work, these factors could introduce a significant dosimetric effect that is currently ignored in clinical treatment planning. It is concluded that the implementation of the deterministic radiation

  20. Dose specification for 192Ir high dose rate brachytherapy in terms of dose-to-water-in-medium and dose-to-medium-in-medium

    International Nuclear Information System (INIS)

    Dose calculation in high dose rate brachytherapy with 192Ir is usually based on the TG-43U1 protocol where all media are considered to be water. Several dose calculation algorithms have been developed that are capable of handling heterogeneities with two possibilities to report dose: dose-to-medium-in-medium (Dm,m) and dose-to-water-in-medium (Dw,m). The relation between Dm,m and Dw,m for 192Ir is the main goal of this study, in particular the dependence of Dw,m on the dose calculation approach using either large cavity theory (LCT) or small cavity theory (SCT). A head and neck case was selected due to the presence of media with a large range of atomic numbers relevant to tissues and mass densities such as air, soft tissues and bone interfaces. This case was simulated using a Monte Carlo (MC) code to score: Dm,m, Dw,m (LCT), mean photon energy and photon fluence. Dw,m (SCT) was derived from MC simulations using the ratio between the unrestricted collisional stopping power of the actual medium and water. Differences between Dm,m and Dw,m (SCT or LCT) can be negligible (<1%) for some tissues e.g. muscle and significant for other tissues with differences of up to 14% for bone. Using SCT or LCT approaches leads to differences between Dw,m (SCT) and Dw,m (LCT) up to 29% for bone and 36% for teeth. The mean photon energy distribution ranges from 222 keV up to 356 keV. However, results obtained using mean photon energies are not equivalent to the ones obtained using the full, local photon spectrum. This work concludes that it is essential that brachytherapy studies clearly report the dose quantity. It further shows that while differences between Dm,m and Dw,m (SCT) mainly depend on tissue type, differences between Dm,m and Dw,m (LCT) are, in addition, significantly dependent on the local photon energy fluence spectrum which varies with distance to implanted sources. (paper)